Create successful ePaper yourself
Turn your PDF publications into a flip-book with our unique Google optimized e-Paper software.
INDUSTRIAL LADDERSPAGES 133-141PROTECTIVE BARRIERSPAGES 142-166TABLE OF CONTENTS142-144 144-145146-147 147-152 153-154155Safety Railing Guidance Barriers Guard Rail SystemsBollardsMachinery & Rack GuardsBarricades156156-158159-161 161-162 163-165166Triple Elbow GuardsColumn & Pipe GuardsRack GuardsCorner Protectors GatesWarning SirensDRUM HANDLING EQUIPMENTPAGES 167-202186188-189 190-192 194-195195-196197-202Drum DeheadersDrum Faucets & PumpsCylinder EquipmentPail EquipmentPailsContainers & Bottles167 167-174174-178 179-181182-183184-185Drum Crushers & Compactors Drum Carrier/Rotators Drum Trucks & Dispensers Drum Lifters Drum DolliesSteel & Fiber Drums229-230 231-234235 239-241 242-243245Pallet Racking &Accessories Cantilever RacksBar RackShelving & CabinetsCases & Containers Storage BuildingsVESTIL.COM Phone (800) 348-0868INDUSTRIAL CARTS & DOLLIESPAGES 203-228203-204 206-209211-215 215-217221-225Stockpicker Trucks Platform Trucks Hand TrucksPanel CartsDolliesFloor Locks227-228STORAGE SOLUTIONSPAGES 229-245133 135136-137 138-139 140141Steel Warehouse LaddersStandard Slope LaddersCross-Over LaddersAluminum LaddersAluminum Folding Step Platforms Rolling Step Stools
LOADING DOCK EQUIPMENT4Shown withOptional Aluminum Bridge(one steel bridge standard)MODELNUMBERPLATFORM SIZE(W x L)LOWEREDHEIGHTRAISEDHEIGHTUNIFORMCAPACITYOVERALL FRAMESIZE (W x L)NET WT.(POUNDS)LIST PRICEEACHWL-100-5-48 48" x 96" 8" 68" 5,000 41" x 93" 3125 $6,707.00WL-100-5-68 72" x 96" 8" 68" 5,000 62" x 93" 3485 7,200.00WL-100-5-78 84" x 96" 8" 68" 5,000 62" x 93" 3706 7,930.00WL-100-5-88* 96" x 96" 8" 68" 5,000 86" x 93" 3952 8,388.00WL-100-5-610 72" x 120" 8" 68" 5,000 62" x 93" 3823 8,249.00WL-100-5-710 84" x 120" 8" 68" 5,000 62" x 93" 4027 8,614.00WL-100-5-810* 96" x 120" 8" 68" 5,000 86" x 93" 4107 8,978.00WL-100-6-68 72" x 96" 10" 70" 6,000 62" x 93" 3648 $7,518.00WL-100-6-78 84" x 96" 10" 70" 6,000 62" x 93" 3788 8,229.00WL-100-6-88* 96" x 96" 10" 70" 6,000 86" x 93" 4167 8,939.00WL-100-6-610 72" x 120" 10" 70" 6,000 62" x 93" 3939 8,730.00WL-100-6-710 84" x 120" 10" 70" 6,000 62" x 93" 4038 8,950.00WL-100-6-810* 96" x 120" 10" 70" 6,000 86" x 93" 4301 8,994.00WL-100-8-68 72" x 96" 10" 70" 8,000 62" x 93" 4396 $10,554.00WL-100-8-78 84" x 96" 10" 70" 8,000 62" x 93" 4592 11,096.00WL-100-8-88* 96" x 96" 10" 70" 8,000 86" x 93" 4698 11,282.00WL-100-8-610 72" x 120" 10" 70" 8,000 62" x 118" 4807 11,394.00WL-100-8-710 84" x 120" 10" 70" 8,000 62" x 118" 4913 11,742.00WL-100-8-810* 96" x 120" 10" 70" 8,000 86" x 118" 5157 12,242.00WL-100-10-68 72" x 96" 14" 72" 10,000 62" x 93" 5804 $12,736.00WL-100-10-78 84" x 96" 14" 72" 10,000 62" x 93" 5991 13,444.00WL-100-10-88* 96" x 96" 14" 72" 10,000 86" x 93" 6177 13,807.00WL-100-10-610 72" x 120" 14" 72" 10,000 62" x 118" 6037 13,832.00WL-100-10-710 84" x 120" 14" 72" 10,000 62" x 118" 6224 14,036.00WL-100-10-810* 96" x 120" 14" 72" 10,000 86" x 118" 6410 14,462.00WL-100-10-612 72" x 144" 14" 72" 10,000 62" x 118" 6504 14,670.00WL-100-10-712 84" x 144" 14" 72" 10,000 62" x 118" 6690 14,793.00WL-100-10-812* 96" x 144" 14" 72" 10,000 86" x 118" 6876 16,822.00WL-100-12-68 72" x 96" 14" 72" 12,000 62" x 93" 6387 $13,641.00WL-100-12-78 84" x 96" 14" 72" 12,000 62" x 93" 6573 14,373.00WL-100-12-88* 96" x 96" 14" 72" 12,000 86" x 93" 6731 14,499.00WL-100-12-610 72" x 120" 14" 72" 12,000 62" x 118" 6620 14,591.00WL-100-12-710 84" x 120" 14" 72" 12,000 62" x 118" 6807 14,925.00WL-100-12-810* 96" x 120" 14" 72" 12,000 86" x 118" 6993 15,310.00WL-100-12-612 72" x 144" 14" 72" 12,000 62" x 118" 7098 15,187.00WL-100-12-712 84" x 144" 14" 72" 12,000 62" x 118" 7225 15,470.00WL-100-12-812* 96" x 144" 14" 72" 12,000 86" x 118" 7436 17,586.00*Units 96" wide cannot ship LTL. These sizes will ship either flat bed or in an oversized swing door trailer.SPLIT ALUMINUM TRUCK BRIDGE: Standard steel bridge can be replacedwith an aluminum bridge 72" wide x 18" long. Ideal for governmentapplications. For 5 & 6K units. (38 lbs.) Model WL-SATB. $330.00SPLIT STEEL BRIDGE: An additional split steel bridge can be added to oppositeside of unit. 72" wide x 18" long. (120 lbs.) Model WL-SSTB. $405.00REMOVABLE HANDRAILS/TOEBOARDS: When mounting this liftin a pit, this option allows platform to be flush with the floor for forktruck cross traffic. Deduct 7½" from overall width for usable width.Model WL-RHT. $141.00WARNING BEEPER & STROBE: Sounds and flashes during liftingand lowering operations. 80 decibels. Model WL-WB. $422.00Phone (800) 348-0868Premium Truck Scissor Dock LiftsSave time and reduce man-hours where there are no docks. Pit orsurface mount with the optional approach ramp. Engineered anddesigned for maximum safety and efficiency. Checkered plate deckis made of heavy gauge steel for years of use. Hydraulic cylindersfeature emergency velocity fuse if line breaks. Complete with uppertravel limit switch and overload relief valve. Push-button control is24V AC on a 20 foot long coil cord. Prewired control box includesmagnetic starter and overload fuse. High visibility safety yellowremovable handrails with fixed toeboards are standard. Includesbeveled toe-guards and electric toe-guards around perimeter ofplatform. External 6.5 HP 460V, 3-phase, 60 Hz motor may belocated up to 8 feet away from lift (weighs 300 pounds). OSHA andANSI compliant.DVD or VIDEOAVAILABLE 460V 3-PHASE STD, OPTIONS ON PG. 5Premium Truck Scissor Dock Lift OptionsDC-20/FC-70A) ALUMINUM BRIDGE • WL-SATBB) STEEL BRIDGE • WL-SSTBNewOPTIONSREMOVABLE HANDRAILINGAND TOEBOARDSmodel WL-RHTSTOP SIGNAL SIGNmodel WL-SSSPROTECTIVE CANOPYmodel WL-CANOPYADDITIONAL HYDRAULIC LINE: Allows you to locate power unitfurther away from lift. 8 foot of hose standard.Model WL-HH-(LENGTH). $7.70/foot.APPROACH RAMP FOR 8" LOWERED HEIGHT LIFTS: 60" wide x65" long. 7° ramp angle. 397 lbs. Model WL-AR8. $613.00APPROACH RAMP FOR 10" LOWERED HEIGHT: 60" wide x 82"long. 7° ramp angle. 517 lbs. Model WL-AR10. $794.00APPROACH RAMP FOR 14" LOWERED HEIGHT: 60" wide x 116"long. 7° ramp angle. 788 lbs. Model WL-AR14. $1,240.00**APPROACH RAMPS MUST BE ANCHORED TO THE FLOOR**ABwww.vestil.com
5Premium Truck Scissor Dock Lift Options50,000 lbs. ROLLOVER CAPACITY (25,000 lbs. per axle): Add'l structural channeland supports for deck. Increases lowered height 2". Model WL-50. $1,113.00MOBILE WHEEL KIT: Kit may be used on the 5,000 and 6,000 lbs.capacity units only. System includes a dolly jack. Requires modification ifused with WL-AR, contact factory. Model WL-WK. $675.00SAFETY ACCORDION SKIRTS: Keep people and debris from gettingunder lift. We recommend customer installed skirts to avoid freight damage.Model WL-ASC. $12.00/square foot (customer installed)Model WL-ASF. $16.00/square foot (factory installed)SPECIAL RESERVOIR MOUNTING: Choose either wall mount orhandrail mount (non-removable).Model WL-RMB. $90.00AUTOMATIC WHEEL CHOCKS: As the unit lifts, this option willblock dock end of ramp to avoid roll off. System requires a special pitmount. Model WL-AWC. $816.00STOP SIGNAL SIGN: As the truck approaches the lift, the sign raises tolet the driver know when to stop for safe loading/unloading. Available onsurface mount units with fixed toeboards only. Model WL-SSS. $105.00PROTECTIVE CANOPY: Fits 6' x 8' platforms. Measures 108" high. Steelconstruction. Bolt-on installation. Custom sizes available, contact factory.Model WL-CANOPY. $450.00Truck Actuated Docklevelers• The Fully Automatic Loading Ramp• 55,000 psi high strength checker plate deck• Toeguards on each side• (2) Molded Bumpers; 5"W x 16"H x 6"DMODELNUMBERKEY SWITCH LOCKOUT: To avoid unauthorized use of the lift, thisoption will lock out the controls at the power unit. Model WL-KL. $213.00TWO SPEED PUMP: Increase lifting speed by 55% when lift isunloaded. Ideal for unloading applications. Model WL-TSP. $506.002 HP SINGLE- OR THREE- PHASE ELECTRIC MOTOR: Consultfactory for lift speeds. Both internal and external power units available.Model WL-2HP. NO PRICE CHANGE3 HP SINGLE PHASE ELECTRIC MOTOR: Replace standard threephase power unit with 208/230V, 1 phase, 60Hz power unit (1½gallons per minute pump speed). Model WL-3HP. $1,055.007-1/2 HP POWER UNIT: Power unit is wired for three phase 208-230/460V60Hz, unit will pump 6 gallons per minute. Model WL-7HP. $599.0010 HP POWER UNIT: Power unit is wired for three phase 208-230/460V60Hz, unit will pump 8 gallons per minute. Model WL-10HP. $739.00GALVANIZED COATING: Cold galvanized coating designed forwash-down applications and wet environments.Model SPO-WL-LS-ZRC. $1,938.00STEEL-IT COATING: Designed for incidental food contact andwash-down environments. FDA approved.Model SPO-WL-LS-SSC. $2,044.00IMMERSION OIL HEATER: For cold weather applications. Built-inmetal reservoir thermostat for automatic heat control. 208-230V singleor three phase power. 250 watts. Model WL-H2. $389.00Use with 460V 3 phase power unit, 500 watts. Model WL-H4. $589.00UNIFORMCAPACITYNET WT.(LBS.)LIST PRICEEACHDESCRIPTIONRU-600-SCB 6'W x 6'L Recessed Unit, Standard 28" Deep Pit 20,000 2310 $4,018.00RU-800-SCB 6'W x 8'L Recessed Unit 20,000 2520 4,780.00RU-800-SCB-F 6'W x 8'6"L Recessed Unit 20,000 3045 5,374.00RU-1000-SCB 6'W x 10'L Recessed Unit 20,000 3150 6,058.00SU-600-SCB 6'W x 6'L Recessed Unit with Legs, Full 48" Deep Pit 20,000 2415 $4,261.00SU-800-SCB 6'W x 8'L Recessed Unit with Legs 20,000 2730 5,206.00SU-800-SCB-F 6'W x 8'6"L Recessed Unit with Legs 20,000 3255 5,663.00SU-1000-SCB 6'W x 10'L Recessed Unit with Legs 20,000 3360 6,494.00PU-600-SCB 6'W x 6'L (Dockleveler Unit with Legs for in Front of Dock Placement) 20,000 2730 $4,618.00PU-800-SCB 6'W x 8'L (Dockleveler Unit with Legs for in Front of Dock Placement) 20,000 3045 5,448.00PU-1000-SCB 6'W x 10'L (Dockleveler Unit with Legs for in Front of Dock Placement) 20,000 3675 6,883.00(Specify Dock Height When Ordering)TRUCK ACTUATED DOCKLEVELER OPTIONSMODELNUMBERNET WT.(POUNDS)DC-20/FC-60LIST PRICEEACHDESCRIPTIONWS-DV DUAL VINYL WEATHER STRIPPING (FACTORY INSTALLED) 6 $81.00CAS CURB ANGLE SET (FOR ANY SIZE DOCKLEVELER) 242 225.00TA-30K/6 30,000 POUND CAPACITY FOR 6 FOOT LENGTH 414 $617.00TA-30K/8 30,000 POUND CAPACITY FOR 8 FOOT LENGTH 552 811.00TA-30K/10 30,000 POUND CAPACITY FOR 10 FOOT LENGTH 840 1,328.007W/6 7 FOOT WIDTH FOR 6 FOOT LENGTH 230 $367.007W/8 7 FOOT WIDTH FOR 8 FOOT LENGTH 253 563.007W/10 7 FOOT WIDTH FOR 10 FOOT LENGTH 299 846.00FI FOAM INSULATION 6 $192.00TL NOTCH FOR TRAILER LOCK -- 111.00SPO SHALLOW PIT OPTION (minimum depth 24") -- 101.00BE BUMPER EXTENSION FOR LOW DOCKS 48 85.00CAPACITIES TO 100,000 POUNDS AVAILABLE - CONTACT FACTORY• No Dock Attendant Needed• 12" long lip (extends 6½" into truck)• Service range of 14" above through 8" below dock• Lift By-Pass for SafetyOperation: Truck backs against twin actuating arms (bumpers) pushing carriage back (dockand trailer door must be raised). As carriage goes back, deck goes up. When the carriagebumpers contact dock, the deck floats down to rest on trailer. When truck pulls out, deckreturns to level supported position automatically. Uniform capacities available up to 100,0000pounds.RECESSED DOCKLEVELERseries RUDOCKLEVELER WITH LEGS FORFRONT OF DOCK PLACEMENTseries PUHEAVY-DUTY SPRINGS HELP LIFT THEDECK WHEN A TRUCK COMES INTOCONTACT WITH THE DOCKLEVELERDOCKLEVELER SURVEY SHEETCAN BE FOUND ON PAGE 8www.vestil.com Phone (800) 348-0868LOADING DOCK EQUIPMENT
6Mechanical Docklevelers• Easy truck loading and unloading with this rugged dockleveler• Engineered and designed for minimum maintenance• Features a smooth pull chain operationDVD or VIDEOAVAILABLEAll heavy-duty construction features ¼" checkered plate deck (55,000 PSI) steel. 6" structuralsteel support understructure for long life. Lip is 16" long. Service range 12" above and belowdock. Includes (2) laminated bumpers. Uniform capacities available up to 50,000 pounds.RATCHET CONTROL ANDACTUATION SPRINGSEASY OPERATIONMODELNUMBEROVERALL SIZEWITH LIPUNIFORMCAPCITY (LBS.)NET WT.(POUNDS)LIST PRICEEACHOPERATIONRR-65 6'W x 5'4"L Pull Chain 20,000 1405 $2,174.00RR-66 6'W x 6'4"L Pull Chain 20,000 1600 2,398.00RR-68 6'W x 8'4"L Pull Chain 20,000 1900 2,781.00RR-610 6'W x 10'4"L Pull Chain 20,000 2310 3,571.00RR-76 7'W x 6'4"L Pull Chain 20,000 1850 $2,685.00RR-78 7'W x 8'4"L Pull Chain 20,000 2625 3,034.00RR-710 7'W x 10'4"L Pull Chain 20,000 2940 3,995.00CONTACT FACTORY FOR CUSTOM-BUILT APPLICATIONSDC-20/FC-60LOADING DOCK EQUIPMENTSTATE-OF-THE-ARTHYDRAULIC DESIGNDVD or VIDEOAVAILABLEElectric Hydraulic Docklevelers• State-of-the-Art Hydraulic DesignMODELNUMBEROVERALL SIZEWITH LIPUNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHOPERATIONEH-66 6'W x 6'4"L ELECTRIC HYDRAULIC 20,000 1575 $3,793.00EH-68 6'W x 8'4"L ELECTRIC HYDRAULIC 20,000 1890 4,078.00EH-610 6'W x 10'4"L ELECTRIC HYDRAULIC 20,000 2310 4,720.00EH-76 7'W x 6'4"L ELECTRIC HYDRAULIC 20,000 1785 $4,110.00EH-78 7'W x 8'4"L ELECTRIC HYDRAULIC 20,000 2625 4,405.00EH-710 7'W x 10'4"L ELECTRIC HYDRAULIC 20,000 2940 5,140.00CONTACT FACTORY FOR CUSTOM-BUILT APPLICATIONS460V 3-PHASE STD, OPTIONS ON PG. 43• Simple Operation with the Push of a ButtonElectric Hydraulic Dockleveler is ideal for high usage dock areas. Easy to operate unit. Operatorpushes and holds the "raise" button which activates the hydraulic pump and raises the deck.When the deck reaches the raised position the lip automatically extends. The operator releasesthe "raise" button and deck descends to rest on the trailer. Control box includes red emergencystop button standard. When the truck pulls away, the deck descends to full down position, tripsthe limit switch and returns automatically to the level cross traffic position. Includes telescopicsteel toe guards on both sides, flush with platform edge. 460V, 3 phase power standard.Includes (2) laminated bumpers and a service range of +/- 12". Uniform capacities available upto 80,000 pounds.DC-20/FC-60DOCKLEVELERSURVEY SHEETCAN BE FOUNDON PAGE 8Phone (800) 348-0868MECHANICAL & ELECTRIC HYDRAULIC DOCKLEVELER OPTIONSMODELNET WT. LIST PRICENUMBERDESCRIPTION(POUNDS) EACHWS-DV DUAL VINYL WEATHER STRIPPING PRE-INSTALLED - $81.00ES EMERGENCY STOP (RR-SERIES ONLY) 54 232.00CAS CURB ANGLE SET (FOR ANY SIZE DOCKLEVELER) 216 225.00SPO SHALLOW PIT OPTION (17½" MINIMUM DEPTH) - 101.00FI UNDER-DECK FOAM INSULATION - 192.0018"LIP/6 18" LONG LIP FOR 6' WIDE DOCKLEVELER 31 $130.0018"LIP/7 18" LONG LIP FOR 7' WIDE DOCKLEVELER 36 172.0030K/6 30,000 POUND UNIFORM CAPACITY FOR 6' LENGTH 118 $612.0030K/8 30,000 POUND UNIFORM CAPACITY FOR 8' LENGTH 158 805.0030K/10 30,000 POUND UNIFORM CAPACITY FOR 10' LENGTH 199 1,317.00FOD/6' LEG OPTION FOR IN FRONT OF DOCK PLACEMENT (6' LENGTH) 240 $513.00FOD/8' LEG OPTION FOR IN FRONT OF DOCK PLACEMENT (8' LENGTH) 240 537.00FOD/10' LEG OPTION FOR IN FRONT OF DOCK PLACEMENT (10' LENGTH) 240 591.00SS/65 STEEL SHELL FOR 6' x 5' POUR IN PLACE INSTALLATION 265 $411.00SS/66 STEEL SHELL FOR 6' x 6' POUR IN PLACE INSTALLATION 276 441.00SS/68 STEEL SHELL FOR 6' x 8' POUR IN PLACE INSTALLATION 288 491.00SS/610 STEEL SHELL FOR 6' x 10' POUR IN PLACE INSTALLATION 345 558.00SS/76 STEEL SHELL FOR 7' x 6' POUR IN PLACE INSTALLATION 299 453.00SS/78 STEEL SHELL FOR 7' x 8' POUR IN PLACE INSTALLATION 311 502.00CWO COLD WEATHER OIL - GOOD TO -10°F (ELECTRIC DOCKLEVELER) - $61.00EH-TL* ELECTRIC INTERLOCK (EH DOCKLEVELER & TRAILER RESTRAINT) - 565.00*TRAILER RESTRAINT SOLD SEPARATELY20" LIP RECOMMENDED FOR REFRIGERATED TRUCKS, CONSULT FACTORY FOR PRICINGwww.vestil.com
Edge-O-DocklevelersPermanently attaches to face of dock. Recommended for docks at least 48" high. Each unit provides a service range of 5" above dock and5" below dock height. When the trailer departs, the lip drops automatically behind the face of the bumpers. Concrete recess is not required.Complete with 2" x 8" x 18" bumpers and installation instructions. Standard ramping length is 27", *36" long ramping length also available.A steel dock edge, optional approach plate, or approach ramp is required for proper installation.The Mechanical Edge-O-Dock is operated by placing the actuation handle into the pocket of the inner lip and pulling down toward the floor. Theoperator then pushes the handle forward until the lip rests on the truck bed. As the trailer departs, the lip retracts behind the bumper face automatically.The Hydraulic Hand Pump system is used to lift the leveler and extend the lip. The operator rotates the relief valve allowing the deck to descenddown and rest upon the trailer. Unit comes complete with hand pump, wall-mount brackets, cylinder, 15 feet of hydraulic line and oil. Truckmust pull out for leveler to return to stored position.The Electric Hydraulic Edge-O-Dock is the easiest to operate. After the truck is backed against the dock, push and hold the control button. Theleveler raises and the lip will extend. 115V, 1 phase power standard. Unit comes complete with motor, pump, control box, cylinder, lines and oil.Truck must pull out for leveler to return to stored position.MODELNUMBER**USABLEWIDTHUNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHOPERATIONFM-0648+ MECHANICAL 48" 6,000 374 $685.00FM-2066+ MECHANICAL 66" 20,000 569 847.00FM-2072+ MECHANICAL 72" 20,000 572 969.00FM-2566+ MECHANICAL 66" 25,000 583 1,006.00FM-2572+ MECHANICAL 72" 25,000 616 1,092.00FM-3066 MECHANICAL 66" 30,000 943 1,349.00FM-3072 MECHANICAL 72" 30,000 1006 1,489.00PP-1572-36* HAND PUMP 72" 15,000 752 $1,517.00PP-2066 HAND PUMP 66" 20,000 583 1,241.00PP-2072 HAND PUMP 72" 20,000 627 1,331.00PP-2566 HAND PUMP 66" 25,000 622 1,494.00PP-2572 HAND PUMP 72" 25,000 671 1,537.00PP-2572-36* HAND PUMP 72" 25,000 1168 1,772.00PP-3066 HAND PUMP 66" 30,000 998 1,743.00PP-3072 HAND PUMP 72" 30,000 1061 1,861.00PE-1572-36* ELECTRIC 72" 15,000 805 $2,467.00PE-2066 ELECTRIC 66" 20,000 644 2,076.00PE-2072 ELECTRIC 72" 20,000 685 2,268.00PE-2566 ELECTRIC 66" 25,000 682 2,240.00PE-2572 ELECTRIC 72" 25,000 700 2,504.00PE-2572-36* ELECTRIC 72" 25,000 1120 2,686.00PE-3066 ELECTRIC 66" 30,000 1055 2,525.00PE-3072 ELECTRIC 72" 30,000 1118 2,632.00*DENOTES 36" RAMPING LENGTH FOR SMALLER GRADEDC-20/FC-60**OVERALL WIDTH IS USABLE WIDTH PLUS 26"+LIP TRIP OPTION - To remove lip from trailer with trailer still backed up to dock, suffix LT, $110.00 LISTOPTIONAL STEEL FACE FOR BUMPER, model EOD-SF, $53.80 LISTEDGE-O-DOCKLEVELER OPTIONSMODELNUMBERNET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONPP-HP-R REPLACEMENT HAND PUMP 17 $366.00FM-HOOK PULLING HOOK FOR MECHANICAL UNIT (OLD STYLE) 1 31.00FM-BAR ACTUATION HANDLE FOR MECHANICAL UNIT (NEW STYLE) 13 31.00BB STEEL BUMPER BOX 90 198.00RB RUBBER BUMPER (REPLACEMENT) 17 35.60FM-FM FM-SERIES (HOOK STYLE) TO FM-SERIES (HANDLE STYLE) CONVERSION KIT 12 $224.00FM-PP FM-SERIES TO PP-SERIES CONVERSION KIT 51 630.00FM-PE FM-SERIES TO PE-SERIES CONVERSION KIT 95 1,224.00PP-PE PP-SERIES TO PE-SERIES CONVERSION KIT 86 1,014.00CE CURB EDGE - 6" CHANNEL x 96" LONG 90 $143.00RAMP-2 APPROACH RAMP 96"W x 12"L x 2"H 120 249.00RAMP-4 APPROACH RAMP 96"W x 24"L x 4"H 215 483.00AP APPROACH PLATE ¼" THICK x 12"L x 96"W 132 147.00AP-BE APPROACH PLATE ¼" THICK x 12"L x 96"W WITH BEVELED EDGE 132 186.00MODELNUMBER115V 1-PHASE STD, OPTIONS ON PG. 43Tandem Traveler Locking Pin LocatorThe Locking Pin Locator is used to help the driver quickly line up the hole and pin when adjusting therear axle tandem. Powerful LED lights in the housing are easily visible from the driver's cab. Magnetsincorporated into the housing allow the unit to be mounted on the side or underneath the trailer. The unitcan also be set on the ground. The case is totally self contained and houses the sensor when not in use.NET WT.(LBS.)LIST PRICEEACHDESCRIPTIONTLP-2 TANDEM TRAVELER LOCKING PIN LOCATOR 2 $69.95DC-20/UPSMECHANICAL • series FMELECTRIC HYDRAULIC • series PEDVD or VIDEOAVAILABLENewDVD or VIDEOAVAILABLECONTROL BOXHAND PUMPseries PPwww.vestil.com Phone (800) 348-08687LOADING DOCK EQUIPMENT
8LOADING DOCK EQUIPMENTBACKDUAL VINYL • series WS-DVFRONTDVD or VIDEOAVAILABLEWPit Drawing for Mechanical and Electric Hydraulic DocklevelersQuoting a dockleveler installation for an existing pit can be difficult. We recommend that you completethe following survey sheet and fax it to us for a proper fit. Measure pit NOT existing dockleveler.LDUAL VINYLHMODELOVERALL SIZENET WT. LIST PRICENUMBER(W x L) DESCRIPTION(POUNDS) EACHDIB-96 90" x 96" INSULATION BLANKET 19 $82.00MODELNUMBERTYPE (circle)PIT WIDTH (W)PIT LENGTH (L)PIT HEIGHT (H)CAPACITYCOMPANY NAMECONTACT NAMEPHONE/FAXDockleveler Insulation BlanketWeather Stripping (for pit mounted docklevelers)LENGTH(PIT / STRIP)LIST PRICEPER KITWS-5-DV 50" / 41" $46.00WS-6-DV 62" / 53" 51.00WS-8-DV 85" / 77" 56.00WS-10-DV 110" / 101" 66.00Truck Actuated / Mechanical / Electric Dockleveler______________________________________________________________________________________________________________ (FRONT)_________________________________ (BACK)___________________________________ LBS._____________________________________________________________________________________________________________________Help improve heating efficiency and use less energy with our Dockleveler Insulation Blanket. Preventscold air from entering your warehouse from cracks surrounding your dock door and leveler. Measuring90"W x 96"L this blanket fits most standard doors. Aluminum extrusion, anchors, and hangers areincluded to attach to the door. Hangers allow you to secure the blanket in the raised position. Blanketswill pay for themselves many times over by controlling heat loss.REPLACEABLEVINYLNewMODELNUMBERvestilgreenLENGTH(PIT / STRIP)vestilgreenDC-25/UPSKeep out pests and rodents and maintain the proper working environment with dockleveler weatherstripping. Kit includes: (2) precut side strips, (1) precut foam insulator for the rear of the pit andinstallation hardware.Dual Vinyl - A white dual-seal vinyl attaches to the side of Dockleveler with self-tapping sheet metalscrews. The replacement vinyl slides into extruded channel that is attached with self-tapping screws.Brushes - Available 1" or 1½" wide. Installation is easy. Bolt aluminum extrusion to sides of levelerthen simply slide brushes into aluminum extrusion channel.LIST PRICEPER KITWS-5-RV 50" / 41" $61.00WS-6-RV 62" / 53" 66.00WS-8-RV 85" / 77" 72.00WS-10-RV 110" / 101" 81.00BRUSH • series WS-RBDVD or VIDEOAVAILABLE1" REPLACEABLEBRUSHMODELNUMBERLENGTH(PIT / STRIP)LIST PRICEPER KITWS-5-RB-1 50" / 41" $75.00WS-6-RB-1 62" / 53" 80.00WS-8-RB-1 85" / 77" 84.00WS-10-RB-1 110" / 101" 97.00Trailer Lock Systems1-1/2"REPLACEABLEBRUSHMODELNUMBER115V 1-PHASE STD, OPTIONS ON PG. 43LENGTH(PIT / STRIP)LIST PRICEPER KITWS-5-RB-1.5 50" / 41" $77.00WS-6-RB-1.5 62" / 53" 81.00WS-8-RB-1.5 85" / 77" 86.00WS-10-RB-1.5 110" / 101" 97.00DC-20/UPSDesigned for installation directly in front of the loading dock. The electric hydraulic system capturesthe ICC bar on the back of semi-trailers. To ensure maximum safety the unit comes standard withan accumulator that allows the lock to follow the trailer up and down as it is loaded/unloaded. Abeeper and flashing light warns the operator if the lock does not engage the trailer properly. A visualindication of the restraint's status is shown at all times by the traffic light outside and the control panelinside. Comes standard with light package, control panel and three large visual signs. Draw pull shearstrength is 32,000 lbs.Phone (800) 348-0868MODELNUMBERNET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONTL-100-F Electric Hydraulic, Aluminum Light Pkg. 115V, 1 PH 518 $3,935.00TL-100-F-S Electric Hydraulic, Polypropylene Light Pkg. 115V, 1 PH 518 3,689.00TL-200-HP-F Hand Pump Hydraulic, Aluminum Light Package 495 $3,537.00TL-200-HP-F-S Hand Pump Hydraulic, Polypropylene Light Pkg. 495 3,291.00DC-20/FC-70www.vestil.com
CAUTIONDEPARTONGREENLIGHTONLYDock Traffic Systems115V 1-PHASE STD, OPTIONS ON PG. 43Our Dock Traffic System feature flashing red and green lights. Prevent accidents and injuriesby providing clear communication between dock personnel and truck drivers. Built-in eyebrowtype sun visors increase light visibility. LED model never needs bulb replacements.Deluxe, model DTS-10, consists of one yellow aluminum traffic light with both a green and redlens (for outside), and an illuminated push-button control (for inside). Light measures 11"W x20"H and features an 8" hood over each lens (recommended for west and south exposure). 60Watt. 115V AC. Four procedure signs are included.Economy, model DTS-5, comes with two yellow polypropylene traffic lights, 6½"W x 11½"H, eachhaving a green and a red lens. The light containing a push button is placed inside the dock area forthe dock attendant, and the other is placed outside for the truck driver. Four signs are included.MODELNUMBER DESCRIPTION INCLUDESNET WT.(LBS.)LIST PRICEEACHDTS-10 Aluminum Housing Lights, (3) Signs, Control Panel 156 $1,002.00DTS-5 Polypropylene Housing Lights, (4) Signs, 115V, 1 Phase 18 215.00DTS-5-LED LED Lights Lights, (4) Signs, 115V, 1 Phase 18 326.00DC-20/FC-60ch ALUMINUM POLmodel DTS-10CAUTIONENTERONGREENLIGHTONLYPOLYPROPYLENELED LIGHTSmodel DTS-5 model DTS-5-LEDCAUTIONDEPARTONGREENLIGHTONLYInside Outside Outside9Dock Barricades - Designed to Prevent Loading Dock "Run Off's" (for 8 or 10 foot wide doors)The Dock Barricade represents the next generation of innovative Loading Dock Safety Systems.Electric/ hydraulic power unit provides quick and effortless operation. Stops a 4,000 lb. fork truck(loaded at 4k) at 4 mph. Electric operation features 115V single phase motor, 24V control, andelectrical bumper-style safety stop circuit to sense obstructions when lowering. Installation is simple,anchor the unit to the floor, mount the control on the wall and plug in. Mechanical unit, modelDJG-100-MW, features a manual hand crank winch to raise/lower barricade arm.MODELNUMBERDOORSIZEOVERHEADCLEARANCEARM HEIGHTLOWEREDOVERALL(W x L)NET WT.(POUNDS)LIST PRICEEACHDJG-100* 8' x 8' 150" 28½" 24" x 130" 550 $2,215.00DJG-100-10* 10' x 10' 180" 28½" 24" x 157" 650 2,441.00DJG-100MW 8' x 8' 149" 28" 24" x 133¼" 798 1,674.00*ELECTRIC HYDRAULIC POWERED UNITSDC-20/FC-100Dock Bug Screen DoorsImprove employee comfort while increasing productivity. Use at loading docks, garages, and food processingfacilities. Keeps birds, flies, moths, mosquitoes, wasps and other insects out while providing fresh airventilation, sunlight and increased security. Constructed of durable, all weather vinyl coated polyester thatis fire retardant as well as mildew and UV resistant. Easy to install. Operation involves a simple manualroller and track system that allows the screen to slide smoothly from side to side, or an easy roll up anddown system that is available spring loaded or motorized. Series DBS-XX-ITM-W is 115V, 1PH poweredwith a 6 foot cord to be hard wired in.Colors AvailableAdd color to suffix of model number.Color shown may differ from actual color.Consult factory for each color.115V 1-PHASE STANDARDYellow Black Blue Gray Beige Orange Green RedMANUAL ROLLER AND TRACK SYSTEMMODELNUMBER OPERATIONDOOR SIZE(W x H) MOUNTNET WT.(POUNDS)LIST PRICEEACHDBS-88-H SLIDING 8' x 8' IN JAMB 54 $950.00DBS-810-H SLIDING 8' x 10' IN JAMB 84 995.00DBS-1010-H SLIDING 10' x 10' IN JAMB 97 1,100.00DBS-88-W SLIDING 8' x 8' MOUNTS ON INSIDE WALL 96 $1,300.00DBS-810-W SLIDING 8' x 10' MOUNTS ON INSIDE WALL 114 1,375.00DBS-1010-W SLIDING 10' x 10' MOUNTS ON INSIDE WALL 132 1,450.00DVD or VIDEOAVAILABLENewMECHANICAL • DJG-100MW115V 1-PHASE STANDARDELECTRIC • DJG-100CURTAIN SLIDES SMOOTHLYFROM SIDE TO SIDELOADING DOCK EQUIPMENTROLL UP AND DOWN SYSTEMMODELNUMBERDOOR SIZE(W x H) MOUNTNET WT.(POUNDS)LIST PRICEEACHOPERATIONDBS-88-SL-H SPRING LOAD ROLL UP 8' x 8' IN JAMB 96 $1,285.00DBS-810-SL-H SPRING LOAD ROLL UP 8' x 10' IN JAMB 101 1,300.00DBS-1010-SL-H SPRING LOAD ROLL UP 10' x 10' IN JAMB 106 1,350.00DBS-88-ITM-H IN-TUBE MOTORIZED 8' x 8' IN JAMB 96 $1,525.00DBS-810-ITM-H IN-TUBE MOTORIZED 8' x 10' IN JAMB 101 1,540.00DBS-1010-ITM-H IN-TUBE MOTORIZED 10' x 10' IN JAMB 106 1,575.00DC-20/FC-100CURTAIN ROLLUP AND DOWNwww.vestil.com Phone (800) 348-0868
10series D-150 series D-350Dock SealsFor use with an 8'W x 8'H (D-150-XX) or 8'W x 9'H (D-350-XX) door. Superior 36 oz.nylon reinforced vinyl facing has a higher tear strength than equivalent weight hypalon.Chemically sealed ends prevent moisture infiltration. Full height air escape tunnel.Mounted and bonded on durable wolmanized wood. 2" nylon reinforced guide stripes.Through-the-wall installation kits included. Three piece construction: top - 12" high;sides - beveled sides with 9½" width at the wall and 12" width at the face. 5" maximumcompression is recommended. Applications with a flush dock to building in conjunctionwith an Edge-O-Dock use a 20" projection* Dock Seal. To ensure proper size completeand fax the survey sheet shown on page 11. Units are non-returnable.LOADING DOCK EQUIPMENTMODELNUMBEROVERALLHEIGHTOVERALLWIDTHNET WT.(POUNDS)LIST PRICEEACHPROJECTIONDOOR SIZE 8 FEET WIDE x 8 FEET HIGHD-150-10 10" 108" 120" 230 $585.00D-150-11 11" 108" 120" 242 603.00D-150-12 12" 108" 120" 253 620.00D-150-13 13" 108" 120" 265 638.00D-150-14 14" 108" 120" 276 $657.00D-150-15 15" 108" 120" 288 675.00D-150-16 16" 108" 120" 299 694.00D-150-17 17" 108" 120" 311 711.00D-150-18 18" 108" 120" 322 $730.00D-150-19 19" 108" 120" 334 746.00D-150-20* 20" 108" 120" 345 765.00• Effective sealing actionwith full height access.• This versatile unit utilizesseal sides and a shelter top.vestilgreenvestilgreenDOCK SEAL & SHELTEROPTIONS & SURVEY SHEETCAN BE FOUND ON PAGE 11Phone (800) 348-0868MODELNUMBERDC-25/FC-100/150*MODELNUMBEROVERALLHEIGHTOVERALLHEIGHTOVERALLWIDTHOVERALLWIDTHNET WT.(POUNDS)NET WT.(POUNDS)LIST PRICEEACHPROJECTIONDOOR SIZE 8 FEET WIDE x 9 FEET HIGHD-350-10 10" 120" 120" 259 $712.00D-350-11 11" 120" 120" 270 731.00D-350-12 12" 120" 120" 282 750.00D-350-13 13" 120" 120" 293 767.00D-350-14 14" 120" 120" 305 $787.00D-350-15 15" 120" 120" 316 806.00D-350-16 16" 120" 120" 328 825.00D-350-17 17" 120" 120" 351 843.00D-350-18 18" 120" 120" 362 $862.00D-350-19 19" 120" 120" 374 880.00D-350-20* 20" 120" 120" 399 898.00DC-25/FC-100/150*Dock Seal/Shelter CombinationsFor use with an 8'W x 10'H door. Top (header) is constructed of wolmanized lumber and is built with aslope to allow for water run-off. Header measures 114"W with a 30" drop curtain. Side (verticals) measure120" tall and contain high density foam mounted to treated lumber. Once mounted, the face of the verticalwill measure 12"W and will taper to 9½" at wall. Verticals are mounted on 2" x 12" wooden boardsallowing wall mounting down the length of the vertical pieces. Applications with a flush dock to building inconjunction with an Edge-O-Dock use a 20" projection* Dock Seal. To ensure proper size complete and faxthe survey sheet shown on page 11. Units are non-returnable.LIST PRICEEACHPROJECTIONDOOR SIZE 8 FEET WIDE x 10 FEET HIGHD-150/650-10 10" 126" 114" 240 $895.00D-150/650-11 11" 126" 114" 254 916.00D-150/650-12 12" 126" 114" 266 934.00D-150/650-13 13" 126" 114" 301 954.00D-150/650-14 14" 126" 114" 315 $970.00D-150/650-15 15" 126" 114" 327 990.00D-150/650-16 16" 126" 114" 340 1,008.00D-150/650-17 17" 126" 114" 352 1,027.00D-150/650-18 18" 126" 114" 365 $1,046.00D-150/650-19 19" 126" 114" 379 1,066.00D-150/650-20* 20" 126" 114" 395 1,082.00MODELNUMBEROVERALLHEIGHTOVERALLWIDTHNET WT.(POUNDS)DC-25/FC-100/150*Dock SheltersFor use with doors up to 10'W x 10'H. Reduces oversized doors to match truck opening. Long wear 40 oz.fabric is highly resistant to abrasion and tearing. Fiberglass staves are sewn into the flaps. Seal is formed alongthe sides and top of trailer when the vertical and top panels are pushed inward by the trailer. Recommendminimum 10" trailer penetration for a good seal. Supporting structure is made of 2" x 4" wolmanized lumber.Shelter is protected by safety yellow steel guide protectors. The top header piece measures 132"W and containsa drop curtain which measures 36"H. Two vertical pieces measure 126" tall with vertical flaps measuring21"W. When installed, the shelter will close the door opening down to 90"W x 90"H (between flaps). Includestwo yellow steel guide protectors and foam-filled corner pads for extra sealing action. To ensure proper sizecomplete and fax the survey sheet shown on page 11. Units are non-returnable.LIST PRICEEACHPROJECTIONDOOR SIZE 8 FEET WIDE x 8 FEET HIGH to 10 FEET WIDE x 10 FEET HIGHD-750-18 18" 126" 132" 338 $1,113.00D-750-24 24" 126" 132" 368 1,201.00D-750-30 30" 126" 132" 397 1,245.00D-750-36 36" 126" 132" 427 1,294.00DC-25/FC-100www.vestil.com
11Company Name __________________________________________Contact Name ___________________________________________Phone Number __________________________________________Fax Number _____________________________________________(W) Width of Opening ______________________________ (inches)(H) Height of Opening ______________________________ (inches)(LC) Left Clearance ________________________________ (inches)(RC) Right Clearance ______________________________ (inches)(TC) Top Clearance ________________________________ (inches)(E) Extension from Building __________________________ (inches)(DB) Dock Bumper Projection ________________________ (inches)(DH) Dock Height _________________________________ (inches)Is this door next to another door that requires a Dock Seal/Shelter? ________Will/Does this door have a face mounted Edge-O-Dockleveler? ____________Special Size TrailersHighest Trailer ____________________________________ (inches)Lowest Trailer ____________________________________ (inches)Widest Trailer _____________________________________ (inches)Narrowest Trailer __________________________________ (inches)Building with Sloped Dock Approach(A) Distance between trailer and building at point A _______ (inches)(B) Distance between trailer and building at point B _______ (inches)DOCK SEAL AND SHELTER OPTIONSMODELNUMBERLIST PRICEEACHDESCRIPTIOND-FHPFS Full Height Pleats, Full Height Guide Stripes $498.00D-FHPS Full Height Pleats, Standard Guide Stripes (24" High) 409.00D-AP Armor Pleats, Top 24" Only 136.00D-54OZ 54 Ounce <strong>Material</strong> - Face Only 71.00D-18H 18" Header $68.00D-SV Sloped Verticals 55.00D-BBF Bottom Bun 188.00D-BBFB Bottom Bun with Bumpers 590.00D-GS Full Height Guide Stripes $18.00D-12F 12" Flap 51.00D-SIDE Dock Seal Sides Between 97" & 120" 49.00D-KIT Repair Kit 68.00DC-25/FC-100Retractable Dock ShelterABDock Seal & Dock Shelter Survey SheetvestilgreenThe Retractable Dock Shelter fits up to a 120"W x 120"H door. Independent spring loaded scissors mechanismallows shelter to retract with the trailer keeping the shelter square. The design also eliminates the need for rigidsteel guide protectors. Overall size 132"W x 126"H x 24" projection. The 40 ounce reinforced vinyl flaps closethe opening down to 90" x 90". The 36" header curtain has armor pleats for extended wear. Shelter is blackwith aluminum edge trim.RCDBDHWTCHvestilgreenELCLOADING DOCK EQUIPMENTMODELOVERALLOVERALLNET WT. LIST PRICENUMBERPROJECTIONHEIGHTWIDTH(POUNDS) EACHD-520-24 24" 126" 132" 437 $1,438.00Scaffolding NetsDC-25/FC-100Contain and catch light debris falling from scaffolds, bridges, and buildings under construction. Polyester materialcan be cut to size without fraying. Disposable UV resistant black nylon quick-ties allow rapid installation. Installbands from top-to-bottom or left-to-right, according to your need. Other styles available, please contact factory.NewMODELNUMBER DESCRIPTION SIZENET WT.(POUNDS)LIST PRICEEACHSN-4165-RL-R RED NET ROLL 4'W x 165'L 20 $200.00SN-4165-RL-G GREEN NET ROLL 4'W x 165'L 20 200.00SN-4165-RL-O ORANGE NET ROLL 4'W x 165'L 20 200.00SN-TIES QUICK TIES (100 PER BAG) 3/16"W x 12"L 1 $15.00/BAGSN-DISC GALVANIZED METAL DISC 3½" DIA. 1 2.00SN-TAPCON TAPCON SCREWS -- 1 0.35DC-20/UPSwww.vestil.com Phone (800) 348-0868
12Vinyl Strip Doors• Helps to control noise, dust, fumes, and smoke• Reduces lost time opening and closing doors• Simple low cost design• Shipped ready to install - just unroll and attach• Easy to maintain• Visual clarity provides efficiency without sacrificing safety• Fire resistant material is self-extinguishing• Minimizes drafts, reduces illnesses and accidents• Provides two way simultaneous traffic in larger doors• Reduces heating and cooling costsMODEL FORMATTG - SERIES - OVERLAP - MOUNTING - WIDTH (") - HEIGHT (")SERIES"600" SERIES STRIPS ARE 6" WIDE x 0.06" THICK"800" SERIES STRIPS ARE 8" WIDE x 0.08" THICK"1200" SERIES STRIPS ARE 12" WIDE x 0.12" THICK"1600" SERIES STRIPS ARE 16" WIDE x 0.16" THICKDC-25 (partial)/DC-35 (full)/FC-100OVERLAP"S" FOR STANDARD 2/3 OVERLAP"F" FOR FULL OVERLAPMOUNTING "H" FOR HEADER MOUNT (STANDARD)"W" FOR WALL MOUNT (EXTRA COST)vestilgreenLOADING DOCK EQUIPMENTHEADER MOUNTBRACKETSTRIP DOORMATERIALPRE-ASSEMBLED STRIP DOORSALL DOORS ARE SHIPPEDPRE-ASSEMBLED AND READYFOR INSTALLATION. INSTALLATIONHARDWARE NOT INCLUDED.PRICE FORMULA (IN FEET)MOUNTINGSTRIPSTG-600-S ($10.19 x WIDTH') + ($2.52 x WIDTH' x HEIGHT')TG-600-F ($10.19 x WIDTH') + ($2.85 x WIDTH' x HEIGHT')TG-800-S ($10.19 x WIDTH') + ($2.91 x WIDTH' x HEIGHT')TG-800-F ($10.19 x WIDTH') + ($3.36 x WIDTH' x HEIGHT')TG-1200-S ($10.19 x WIDTH') + ($3.52 x WIDTH' x HEIGHT')TG-1200-F ($10.19 x WIDTH') + ($3.91 x WIDTH' x HEIGHT')TG-1600-S ($10.19 x WIDTH') + ($4.53 x WIDTH' x HEIGHT')TG-1600-F ($10.19 x WIDTH') + ($4.92 x WIDTH' x HEIGHT')NOTE: WIDTH AND HEIGHT IS SIZE OF DOOR OPENING IN FEETSTRIP DOOR OPTIONSH - HEADER MOUNTSTANDARDW - WALL MOUNT ADD 6%RIBBED MATERIAL (8" & 12") ADD 80%LOW TEMPERATURE MATERIAL (-50°F) (8" & 12") ADD 25%BRONZE WELD SCREEN MATERIAL (8" & 12") ADD 60%ORANGE OPAQUE MATERIAL (6", 8", 12" & 16") ADD 60%STANDARD 2/3 OVERLAPFULL OVERLAPSTANDARD MATERIALMEETS USDAREQUIREMENTSNOTE: STRIP DOORSARE CUT TO SIZE,THEREFORE THEY ARENON-RETURNABLESTRIP DOOR NET WEIGHT FORMULA (IN FEET)MOUNTINGSTRIPSTG-600-S (3.5 x WIDTH') + (0.75 x WIDTH' x HEIGHT')TG-600-F (3.5 x WIDTH') + (1.00 x WIDTH' x HEIGHT')TG-800-S (3.5 x WIDTH') + (1.00 x WIDTH' x HEIGHT')TG-800-F (3.5 x WIDTH') + (1.25 x WIDTH' x HEIGHT')TG-1200-S (3.5 x WIDTH') + (1.30 x WIDTH' x HEIGHT')TG-1200-F (3.5 x WIDTH') + (1.60 x WIDTH' x HEIGHT')TG-1600-S (3.5 x WIDTH') + (1.75 x WIDTH' x HEIGHT')TG-1600-F (3.5 x WIDTH') + (2.15 x WIDTH' x HEIGHT')NOTE: WIDTH AND HEIGHT IS SIZE OF DOOR OPENING IN FEETREPLACEMENT STRIPSTG - STRIP - WIDTH (6, 8, 12, 16 INCHES) - LENGTH IN FEET6 INCH x .06 INCH (300 FEET/ROLL) $.72/FOOT 76#/ROLL8 INCH x .08 INCH (300 FEET/ROLL) $1.06/FOOT 135#/ROLL12 INCH x .12 INCH (200 FEET/ROLL) $1.79/FOOT 172#/ROLL16 INCH x .16 INCH (100 FEET/ROLL) $2.97/FOOT 156#/ROLL8 INCH RIBBED (150 FEET/ROLL) $1.88/FOOT 55#/ROLL12 INCH RIBBED (150 FEET/ROLL) $3.83/FOOT 120#/ROLLPhone (800) 348-0868www.vestil.com
Steel Yard RampsQuickly load and unload trucks, trailers and rail cars from ground level when nofreight dock exists. Increase productivity while reducing material handling costs. Greatfor construction sites. A manual two-speed hand crank for easy one person heightadjustment offers a service range of 45" to 62". Available in 30 foot of straight ramp or36 foot overall length; 30 foot of straight ramp and 6 foot level off. Standard featuresinclude: 9" steel wheels, positive traction open steel grating, safety locking chains, 4"high steel safety curbs, rubber bumpers, 15" overlap lip, and welded steel construction.Painted neutral earth-tone brown.DVD or VIDEOAVAILABLE13model YR-16-7230PORTABLE STEEL YARD RAMPSMODELNUMBERUNIFORMCAPACITYOVERALL**RAMP WIDTHUSABLERAMP WIDTHLENGTH(FEET)NET WT.(LBS.)LIST PRICEEACHYR-16-7230 16,000 72" 67" 30 3780 $8,649.00YR-16-8430 16,000 84" 78" 30 4095 9,364.00YR-16-7236 16,000 72" 67" 36 4725 9,426.00YR-16-8436 16,000 84" 78" 36 5040 10,565.00YR-20-7330 20,000 73" 67" 30 4515 $9,358.00YR-20-8530 20,000 85" 78" 30 4830 10,499.00YR-20-7336 20,000 73" 67" 36 5565 10,561.00YR-20-8536 20,000 85" 78" 36 5985 11,920.00YR-25-7330 25,000 73" 67" 30 4725 $9,820.00YR-25-8530 25,000 85" 78" 30 5040 10,994.00YR-25-7336 25,000 73" 67" 36 5880 11,117.00YR-25-8536 25,000 85" 78" 36 6300 12,970.00YR-30-7330 30,000 73" 67" 30 4935 $10,561.00YR-30-8530 30,000 85" 78" 30 5250 12,291.00YR-30-7336 30,000 73" 67" 36 6300 12,537.00YR-30-8536 30,000 85" 78" 36 6720 14,081.00**ADD 19" TO OVERALL RAMPING WIDTH FOR MAXIMUM OVERALL WIDTH.INCLUDES LANDING GEAR AND CRANK MECHANISM.PORTABLE STEEL YARD RAMPS WITH HAND PUMP HYDRAULIC EDGE-O-DOCKMODELNUMBERUNIFORMCAPACITYOVERALLWIDTHUSABLEWIDTHLENGTH(FEET)NET WT.(POUNDS)DC-20/FC-FBLIST PRICEEACHYRD-16-7236-H 16,000 72" 66" 36 5670 $10,463.00YRD-16-8436-H 16,000 84" 78" 36 6090 11,619.00YRD-20-7336-H 20,000 73" 66" 36 5880 $11,877.00YRD-20-8536-H 20,000 85" 78" 36 6300 13,290.00YRD-25-7336-H 25,000 73" 66" 36 6090 $12,647.00YRD-25-8536-H 25,000 85" 78" 36 6510 14,639.00YRD-30-7336-H 30,000 73" 66" 36 6300 $13,693.00YRD-30-8536-H 30,000 85" 78" 36 6720 15,942.00LEVELER IS 64" WIDE ON 72" & 73" MODELS AND 75" WIDE ON 84" & 85" MODELSDC-20/FC-FBMANUAL HAND CRANK& 9" STEEL WHEELSFORK LIFT PICK-UP SLOTSmodel YR-FSSAFETY LOCKING CHAINSWITH 15" OVERLAP LIP27" PNEUMATIC TIRES HYDRAULIC HAND PUMP TOW BAR HITCHmodel YR-HL model YR-TB-HFORK POSITIONINGLOOPmodel YR-TBOPTIONSHANDRAIL (welded)model YR-HDRLLOADING DOCK EQUIPMENTSTATIONARY STEEL YARD RAMPS WITH EDGE-O-DOCKMODELNUMBERUNIFORMCAPACITYOVERALLWIDTHUSABLEWIDTHLENGTH(FEET)NET WT.(POUNDS)LIST PRICEEACHMECHANICAL EDGE-O-DOCK AT TRUCK ENDYRDS-16-7236-M 16,000 72" 66" 36 5905 $9,988.00YRDS-16-8536-M 16,000 85" 78" 36 6325 11,090.00YRDS-20-8536-M 20,000 85" 78" 36 6535 12,680.00HAND PUMP HYDRAULIC EDGE-O-DOCK AT TRUCK ENDYRDS-16-7236-H 16,000 72" 66" 36 5890 $10,201.00YRDS-16-8536-H 16,000 85" 78" 36 6310 11,301.00YRDS-20-8536-H 20,000 85" 78" 36 6520 12,892.00LEVELER IS 66" WIDE ON 72" & 73" MODELS AND 72" WIDE ON 84" & 85" MODELSDC-20/FC-FBStationary ramps, series YRDS, include an Edge-Of-Dock Leveler at the truck end. Ramp height is fixed at50". Leveler offers service range of +/- 5".STEEL YARD RAMP OPTIONSMODELNUMBERNET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONYR-HL PNEUMATIC TIRE & HAND PUMP HYDRAULIC LIFT (5 MPH MAX. TOW SPEED) (NOT AVAILABLE ON YRD MODELS) 230 $1,393.00YR-HL-DC* PNEUMATIC TIRE & 12V DC HYDRAULIC LIFT (5 MPH MAX. TOW SPEED) (NOT AVAILABLE ON YRD MODELS) 288 1,834.00YR-FS FORK LIFT PICKUP SLOTS (7½"W X 2½"H USABLE ON 24" CENTERS) 460 519.00YR-TB FORK POSITIONING LOOP 25 146.00YR-TB-H TOW BAR HITCH 145 197.00YR-HDRL 42" HIGH HANDRAILS WITH 21" MIDRAIL (WELDED) (NON-REMOVABLE) 12 per ft. 16.00YRD-MD MECHANICAL DOCKLEVELER IN LIEU OF HYDRAULIC (ON 16,000, 20,000, AND 25,000 LBS. CAPACITIES) -- N/CYR-DH HOLES IN LIP TO LAG RAMP TO TOP OF DOCK -- 154.00*INCLUDES ON-BOARD CHARGERwww.vestil.com Phone (800) 348-0868
14STEEL GRATINGseries SYALUMINUM GRATINGseries AYAluminum Yard RampsPortable Aluminum Yard Ramps have a unique designthat allows one person to position the ramp, adjust itsservice height, and load or unload trailers from groundlevel. Available with steel or rust resistant aluminumgrating. Standard features: Hand pump hydraulic lift,safety pressure relief valve, 18" x 5" mold-on-rubbertires, 4" high curbs, service range of 45" to 62",anchor chains, and fork tow bar loop.LOADING DOCK EQUIPMENT18" x 5" MOLD-ON-RUBBER TIRESARE STANDARDHAND PUMPHYDRAULIC LIFT STANDARD15" OVERLAP INTO TRAILER/BUILDINGSAFETY CHAINS STANDARDPNEUMATIC TIRES OPTIONService Range will be 40" to 66"model AYR-PNTRDVD or VIDEOAVAILABLEPhone (800) 348-0868ALUMINUM YARD RAMP OPTIONSMODELNUMBERALUMINUM YARD RAMPS WITH STEEL GRATINGMODELNUMBERUNIFORMCAPACITYOVERALLWIDTHUSABLEWIDTHLENGTH(FEET)NET WT.(POUNDS)LIST PRICEEACHSY-167230 16,000 74" 66" 30 3518 $10,507.00SY-168430 16,000 86" 78" 30 4043 11,189.00SY-169330 16,000 95" 87" 30 4515 12,686.00SY-167236-L 16,000 74" 66" 36 4305 $11,974.00SY-168436-L 16,000 86" 78" 36 4830 13,167.00SY-169336-L 16,000 95" 87" 36 5303 17,742.00SY-207230 20,000 74" 66" 30 3623 $11,381.00SY-208430 20,000 86" 78" 30 4148 12,379.00SY-209330 20,000 95" 87" 30 4620 14,897.00SY-207236-L 20,000 74" 66" 36 4410 $12,878.00SY-208436-L 20,000 86" 78" 36 4935 14,071.00SY-209336-L 20,000 95" 87" 36 5408 17,872.00SY-257230 25,000 74" 66" 30 3675 $12,112.00SY-258430 25,000 86" 78" 30 4200 13,013.00SY-259330 25,000 95" 87" 30 4725 16,906.00SY-257236-L 25,000 74" 66" 36 4463 $13,387.00SY-258436-L 25,000 86" 78" 36 4988 14,557.00SY-259336-L 25,000 95" 87" 36 5513 19,206.00SY-307230 30,000 74" 66" 30 3728 $13,190.00SY-308430 30,000 86" 78" 30 4253 14,597.00SY-307236-L 30,000 74" 66" 36 4515 $14,365.00SY-308436-L 30,000 86" 78" 36 5040 17,529.00ALUMINUM YARD RAMPS WITH ALUMINUM GRATINGAY-167230 16,000 74" 66" 30 2783 $11,480.00AY-168430 16,000 86" 78" 30 3150 12,506.00AY-169330 16,000 95" 87" 30 3465 14,024.00AY-167236-L 16,000 74" 66" 36 3360 $13,782.00AY-168436-L 16,000 86" 78" 36 3728 15,104.00AY-169336-L 16,000 95" 87" 36 3990 20,011.00AY-207230 20,000 74" 66" 30 2888 $12,366.00AY-208430 20,000 86" 78" 30 3255 14,026.00AY-209330 20,000 95" 87" 30 3570 16,881.00AY-207236-L 20,000 74" 66" 36 3465 $14,428.00AY-208436-L 20,000 86" 78" 36 3833 16,397.00AY-209336-L 20,000 95" 87" 36 4095 20,246.00AY-257230 25,000 74" 66" 30 2940 $13,125.00AY-258430 25,000 86" 78" 30 3308 14,532.00AY-259330 25,000 95" 87" 30 3675 17,962.00AY-257236-L 25,000 74" 66" 36 3578 $14,853.00AY-258436-L 25,000 86" 78" 36 3885 16,794.00AY-259336-L 25,000 95" 87" 36 4200 21,551.00AY-307230 30,000 74" 66" 30 3092 $14,312.00AY-308430 30,000 86" 78" 30 3360 16,465.00AY-307236-L 30,000 74" 66" 36 3570 $16,845.00AY-308436-L 30,000 86" 78" 36 3938 19,251.00NET WT.(POUNDS)DC-20/FC-FBLIST PRICEEACHDESCRIPTIONAYR-HL-DC 12V DC HYDRAULIC LIFT (INCLUDES ON-BOARD CHARGER) 50 $789.00AYR-TB FORK POSITIONING LOOP 25 150.00AYR-TB-H TOW BAR HITCH 145 203.00AYR-HDRL 42" HIGH HANDRAILS WITH 21" MIDRAIL (WELDED) (NON-REMOVABLE) 230 16.00AYR-CRB6 6" CURB HEIGHT -- 143.00AYR-YEL YELLOW SAFETY CURBS -- 176.00AY-PNTR PNEUMATIC TIRE OPTION (SERVICE RANGE 40" TO 66") -- 360.00AYR-DH HOLES IN LIP TO LAG RAMP TO TOP OF DOCK -- 159.00www.vestil.com
15Steel Railroad DockboardsModel Number Format:RS - CAPACITY - WIDTH - "A" DIMENSION - "B" DIMENSIONDIMENSION "A"BOARDLENGTH15,000 LBS.UNIFORM CAPACITY20,000 LBS.UNIFORM CAPACITY30,000 LBS.UNIFORM CAPACITY66 INCH USABLE / 72 INCH WIDE BOARD**40,000 LBS.UNIFORM CAPACITYCITYWeight Weight Weight Weight49-51" 33-35" $1,299.00 716 $1,436.00 791 $1,565.00 828 $1,699.00 89152-54" 36-38" 1,337.00 735 1,470.00 811 1,618.00 860 1,749.00 82655-57" 39-41" 1,376.00 759 1,547.00 800 1,718.00 918 1,867.00 99058-60" 42-44" 1,455.00 801 1,626.00 849 1,778.00 950 1,930.00 102561-63" 45-47" $1,529.00 817 $1,715.00 903 $1,880.00 1009 $1,999.00 108764-66" 48-50" 1,567.00 834 1,756.00 923 1,934.00 1041 2,043.00 112267-69" 51-53" 1,645.00 880 1,844.00 947 2,014.00 1084 2,211.00 118070-72" 54-56" 1,684.00 898 1,918.00 1010 2,070.00 1114 2,270.00 121473-75" 57-59" $1,759.00 949 $2,010.00 1069 $2,170.00 1171 $2,382.00 127876-78" 60-62" 1,796.00 972 2,050.00 1096 2,225.00 1199 2,445.00 130779-81" 63-65" 1,881.00 1013 2,144.00 1142 2,327.00 1262 2,556.00 137682-84" 66-68" 1,914.00 1030 2,183.00 1161 2,380.00 1293 2,611.00 141185-87" 69-71" $1,994.00 1076 $2,272.00 1214 $2,454.00 1331 $2,727.00 146888-90" 72-74" 2,032.00 1099 2,333.00 1251 2,510.00 1362 2,786.00 150391-93" 75-77" 2,109.00 1146 2,423.00 1305 2,609.00 1414 2,893.00 156194-96" 78-80" 2,148.00 1175 2,471.00 1338 2,714.00 1477 3,013.00 163078 INCH USABLE / 84 INCH WIDE BOARD**49-51" 33-35" $1,399.00 765 $1,579.00 812 $1,699.00 891 $1,849.00 96052-54" 36-38" 1,487.00 813 1,677.00 865 1,757.00 924 1,912.00 99555-57" 39-41" 1,527.00 830 1,726.00 904 1,879.00 987 2,038.00 106458-60" 42-44" 1,611.00 857 1,853.00 956 1,935.00 1019 2,103.00 109961-63" 45-47" $1,659.00 880 $1,870.00 982 $2,056.00 1094 $2,231.00 118064-66" 48-50" 1,743.00 926 1,968.00 1034 2,117.00 1125 2,299.00 121467-69" 51-53" 1,785.00 956 2,012.00 1066 2,223.00 1178 2,421.00 128470-72" 54-56" 1,868.00 1007 2,130.00 1143 2,268.00 1247 2,489.00 131873-75" 57-59" $1,914.00 1036 $2,183.00 1168 $2,382.00 1283 $2,618.00 139976-78" 60-62" 1,998.00 7076 2,281.00 1213 2,445.00 1314 2,682.00 143479-81" 63-65" 2,043.00 1111 2,331.00 1253 2,536.00 1377 2,811.00 150382-84" 66-68" 2,125.00 1157 2,424.00 1306 2,563.00 1403 2,877.00 153885-87" 69-71" $2,175.00 1180 $2,480.00 1332 $2,709.00 1456 $3,005.00 160788-90" 72-74" 2,260.00 1226 2,635.00 1396 2,764.00 1498 3,070.00 165391-93" 75-77" 2,302.00 1256 2,675.00 1430 2,883.00 1560 3,197.00 172394-96" 78-80" 2,348.00 1284 2,706.00 1468 3,004.00 1619 3,324.00 1803102 INCH USABLE / 108 INCH WIDE BOARD**49-51" 33-35" $1,560.00 855 $1,921.00 1004 $2,087.00 1109 $2,264.00 119152-54" 36-38" 1,719.00 909 1,980.00 1031 2,165.00 1146 2,349.00 123755-57" 39-41" 1,837.00 983 2,113.00 1118 2,320.00 1236 2,519.00 133658-60" 42-44" 1,894.00 1006 2,177.00 1144 2,395.00 1274 2,602.00 137661-63" 45-47" $2,000.00 1071 $2,300.00 1216 $2,556.00 1365 $2,774.00 147564-66" 48-50" 2,059.00 1110 2,379.00 1263 2,630.00 1413 2,854.00 152667-69" 51-53" 2,171.00 1168 2,497.00 1330 2,753.00 1482 3,027.00 161770-72" 54-56" 2,228.00 1203 2,585.00 1380 2,931.00 1542 3,221.00 166573-75" 57-59" $2,339.00 1261 $2,713.00 1447 $2,965.00 1645 $3,259.00 168876-78" 60-62" 2,407.00 1295 2,781.00 1488 3,145.00 1650 3,450.00 180379-81" 63-65" 2,509.00 1371 2,909.00 1575 3,216.00 1745 3,532.00 190782-84" 66-68" 2,567.00 1399 2,974.00 1608 3,293.00 1788 3,613.00 195485-87" 69-71" $2,679.00 1457 $3,105.00 1875 $3,405.00 1851 $3,783.00 204688-90" 72-74" 2,732.00 1503 3,181.00 1744 3,472.00 1903 3,873.00 210491-93" 75-77" 2,843.00 1549 3,325.00 1798 3,636.00 1986 4,003.00 219694-96" 78-80" 2,899.00 1590 3,391.00 1845 3,711.00 2027 4,121.00 2265Steel Container RampsMODELNUMBEROVERALLWIDTHOVERALLLENGTHUNIFORMCAPACITY (LBS.)NET WT.(POUNDS)DC-25/FC-60Heavy duty steel container ramp facilitates easy loading/unloading of shipping containers whenplaced on ground level. Hinged flip-over bridge allows for easy transportation and compact storage.Tapered lip provides smooth transition into container at various heights. Built in fork pockets inbase for convenient fork truck positioning.LIST PRICEEACHHEIGHTSCR-72 72" 98" 4-3/8" 15,000 950 $2,580.00SCR-84 84" 98" 4-3/8" 15,000 1110 2,713.00DC-25/FC-60NOTE: DIMENSIONS ARE IN INCHESSTANDARD FEATURES• Auto Drop Locks (add 13" to overall width)**• Pop-up Fork Lift Loops• Steel Rectangular Board• Overlap Style Plate (both ends)• Safety Curbs are 4" High• High Strength Cross Traffic• Tread plate for Better Traction• Structural Steel Support BeamsDROP LOCKS aredesigned to automaticallykeep the railboardtight against the car,accommodating forvarious railcar widths.These cast bars measure1" thick. (standard)PIN LOCKS provide aneconomical alternativeto the drop locks.(alternative design)SURVEY SHEET REQUIRED WITHALL REQUESTS FOR QUOTESPOP-UP-LOOPSautomatically pop up andstay when rail dockboardis sitting on dock.Operator pulls loop upand locks to take out ofcar. Loops measure 24"on center. (standard)ALTERNATIVE DESIGN OPTIONS• Replace pick-up loops with chains• Replace automatic-drop locks with pin locks• Flush Style Plate, replaces overlap style andminimizes board overlap into car• Flared Board offers greater flexibility for tight turningradius applications. Contact factory for pricing.• Specials: Different widths and configurations areavailable, contact factory for pricing.NewPICK UP CHAINSprovide an economicalalternative to pick uploops. (alternative)www.vestil.com Phone (800) 348-0868BCADOCKEDGELOADING DOCK EQUIPMENT
16Aluminum Hand Truck DockplatesDesigned for use with two wheel hand trucks. A convenient, safe and easy wayto access loading docks from trucks. Lightweight and easily transported by justone person. Tread plate surface ensures skid-resistant safe traction. Locking legssecure the plate for safe loading and unloading. Complete with bolt-on zinc platedcarrying handles and locking legs.DESIGNED FOR USEWITH TWO WHEELHAND TRUCKS(not included)HEIGHTDIFF.MODELNUMBER1/4" PLATE THICKNESS 5/16" PLATE THICKNESSNET WT. UNIFORM LIST PRICE MODEL NET WT. UNIFORM(LBS.) CAPACITY EACH NUMBER (LBS.) CAPACITYLIST PRICEEACHWIDTH LENGTH30" 24" 3" A-3024 35 500 $144.00 AH-3024 31 700 $167.0030" 30" 4" A-3030 40 500 159.00 AH-3030 37 700 192.0030" 36" 5" A-3036 46 500 183.00 AH-3036 45 700 216.0030" 48" 7" A-3048 55 500 227.00 AH-3048 58 700 271.0036" 24" 3" A-3624 39 500 $159.00 AH-3624 36 700 $185.0036" 30" 4" A-3630 46 500 183.00 AH-3630 44 700 216.0036" 36" 5" A-3636 52 500 210.00 AH-3636 53 700 249.0036" 48" 7" A-3648 63 500 257.00 AH-3648 69 700 312.00DC-30/UPS/FC-100LOADING DOCK EQUIPMENTDVD or VIDEOAVAILABLEHEIGHTDIFF.MODELNUMBER3/8" PLATE THICKNESS 1/2" PLATE THICKNESSNET WT. UNIFORM LIST PRICE MODEL SHIPS NET WT.(LBS.) CAPACITY EACH NUMBER VIA (LBS.)SHIPSVIAAluminum Economizer DockplatesEconomical way to speed up truck loading and unloading. Spans the openingbetween dock and trailer to allow pallet or hand trucks along with traffic to safelymove in and out of the trailer. Each unit is constructed of high strength, nonskidaluminum alloy tread plate. The lightweight design with bolt on zinc platedlegs and handles on each side makes portability easy. Locking legs for OSHACompliance. The bend or crown is 11° and located 9" from edge of dockplate.Not for use with fork trucks.UNIFORMCAPACITYLIST PRICEEACHWIDTH LENGTH30" 24" 3" E-3024 UPS 35 3,000 $210.00 EH-3024 UPS 53 5,200 $255.0030" 30" 4" E-3030 UPS 43 2,300 246.00 EH-3030 UPS 63 4,100 299.0030" 36" 5" E-3036 UPS 50 1,800 282.00 EH-3036 UPS 74 3,500 348.0030" 48" 7" E-3048 UPS 66 1,400 349.00 EH-3048 UPS 95 2,600 455.0036" 24" 3" E-3624 UPS 41 3,600 $238.00 EH-3624 UPS 62 6,200 $299.0036" 30" 4" E-3630 UPS 51 3,000 281.00 EH-3630 UPS 74 5,100 354.0036" 36" 5" E-3636 UPS 60 2,500 323.00 EH-3636 UPS 87 4,300 405.0036" 48" 7" E-3648 UPS 78 1,900 407.00 EH-3648 UPS 111 3,000 517.0042" 24" 3" E-4224 UPS 47 4,300 $271.00 EH-4224 UPS 70 7,200 $340.0042" 30" 4" E-4230 UPS 58 3,300 306.00 EH-4230 UPS 84 5,900 402.0042" 48" 7" E-4248 LTL 90 2,100 474.00 EH-4248 LTL 99 3,500 595.0048" 24" 3" E-4824 UPS 53 5,200 $290.00 EH-4824 UPS 78 8,200 $365.0048" 30" 4" E-4830 UPS 65 4,100 350.00 EH-4830 UPS 93 6,300 447.0048" 36" 5" E-4836 UPS 78 3,500 405.00 EH-4836 UPS 111 5,300 516.0048" 42" 6" E-4842 LTL 90 3,000 470.00 EH-4842 LTL 127 4,300 597.0048" 48" 7" E-4848 LTL 102 2,600 523.00 EH-4848 LTL 142 3,800 676.0048" 54" 8" E-4854 LTL 116 2,200 592.00 EH-4854 LTL 160 3,300 748.0048" 60" 9" E-4860 LTL 128 1,800 643.00 EH-4860 LTL 175 2,900 831.0060" 24" 3" E-6024 UPS 65 5,700 $349.00 EH-6024 UPS 93 10,000 $427.0060" 30" 4" E-6030 UPS 80 4,600 424.00 EH-6030 UPS 113 7,800 545.0060" 36" 5" E-6036 LTL 96 4,100 494.00 EH-6036 LTL 134 6,600 628.0060" 42" 6" E-6042 LTL 111 3,500 571.00 EH-6042 LTL 154 5,500 730.0060" 48" 7" E-6048 LTL 126 2,900 638.00 EH-6048 LTL 173 4,800 819.0060" 54" 8" E-6054 LTL 143 2,400 709.00 EH-6054 LTL 195 4,100 916.0060" 60" 9" E-6060 LTL 158 2,000 782.00 EH-6060 LTL 214 3,700 1,007.0072" 24" 3" E-7224 UPS 77 6,500 $413.00 EH-7224 UPS 109 11,900 $521.0072" 30" 4" E-7230 LTL 95 5,400 497.00 EH-7230 LTL 132 9,500 630.0072" 36" 5" E-7236 LTL 114 4,300 580.00 EH-7236 LTL 158 7,800 737.0072" 48" 7" E-7248 LTL 150 3,400 753.00 EH-7248 LTL 205 5,900 965.00DC-30/UPS/FC-100ALUMINUM ECONOMIZER DOCKPLATE OPTIONSMODELLIST PRICE MODELLIST PRICENUMBER DESCRIPTIONEACH NUMBER DESCRIPTIONEACHOHDL No Handles $13.00 SLL Special Location of Legs $22.001HDL One Handle $6.00 ATC Anti-Theft Chain (PER LINEAR FOOT) $2.40SDP Smooth Deck Plate N/C LHDL Extra Pair of Legs with $32.00(Checker Side Down)Handles & HardwareSB Special Bend or Location of Bend $35.00 TRADE Trade in Allowance (F.O.B. IN) $0.20/LB.Phone (800) 348-0868www.vestil.com
17Aluminum Truck Dockboards (Welded Aluminum Curbs)• Beveled Edges for Smooth Entry & Exit• Designed for Low/Medium Traffic ApplicationsEngineered and built to maximize safety while handling heavy fork trucks and loads.Locking legs prevent movement during loading and unloading operations. Weldedaluminum safety curbs prevent accidental runoffs and provide visible driving lane. Lockinglegs are uneven to allow the dockboard to sit canted, while not in use, for easier pickupby fork trucks. Bend is 11° and 9" from the edge and the legs are 12" from the edge.Manufactured in compliance with OSHA. When using three-wheeled fork trucks orderdockboard with capacity at least four-times the lifting capacity of fork truck.A. CAPACITY is based upon the heaviest type of equipment used plus the maximum load carriedtimes the single axle rating of total load. Dynamic loading, driver tendencies, speed and frequencyof use must be considered. Steel (TS-series) dockboards recommended for high use docks.EQUIPMENTSINGLE AXLE RATING OF TOTAL LOADTWO-WHEEL HAND TRUCKS 100%FOUR-WHEEL PLATFORM TRUCK - (NON-TILT) 50%PALLET TRUCKS - HAND 75%PALLET TRUCKS - ELECTRIC 66%PLATFORM (SKID) TRUCKS - HAND - WALKIE 75%PLATFORM (SKID) TRUCKS - ELECTRIC - WALKIE 66%FORK TRUCKS - ELECTRIC WALKIE 90%FORK TRUCKS - ELECTRIC RIDER 90%FORK TRUCKS - GAS RIDER 90%B. Width of Dockboard should be at least 15" wider than the load or equipment passing between thecurbs. If the load does not pass between curbs but is elevated above, add 15" to the overall width ofequipment. (Good rule of thumb is to subtract 5-6" from dockboard width to achieve actual usable width)C. Use this guide for truck floor heights to determine the Height Differential from the truck bed todock. (Numbers listed reference an empty truck.)REFRIGERATED 54" TO 61"HEAVY TRAILERS 51" TO 56"HEAVY SEMI-TRAILERS 48" TO 54"LIGHT SEMI-TRAILERS 45" TO 49"LARGE SINGLE BED 42" TO 50"SMALL SINGLE BED 30"D. Use first & second column of chart below to determine length of board. Rise/Run (x 100) = % of Grade.UNIFORM CAPACITY 5,000 LBS. 6,000 LBS. 8,000 LBS. 10,000 LBS.SizeWidth-LengthInches546066727836 4 5 BTA-05008436 193 $965.00 BTA-06008436 193 $965.00 BTA-08008436 200 $998.00 BTA-10008436 232 $1,142.0084 48 5½ 7 BTA-05008448 242 1,237.00 BTA-06008448 242 1,237.00 BTA-08008448 273 1,396.00 BTA-10008448 281 1,439.0060 7 10 BTA-05008460 288 1,454.00 BTA-06008460 288 1,454.00 BTA-08008460 332 1,680.00 BTA-10008460 340 1,720.00UNIFORM CAPACITY 12,000 LBS. 15,000 LBS. 20,000 LBS.SizeWidth-LengthInches60Ht. Difference8°/17%InchesHt. Difference11°/19%InchesHt. Difference11°/19%InchesHt. Difference11°/19%InchesNet Wt.(lbs.)Net Wt.(lbs.)ListPrice EachListPrice EachNet Wt.(lbs.)ListPrice EachNet Wt.(lbs.)ListPrice EachModel NumberModel NumberModel Number30 3 4 BTA-12006030 106 $721.00 BTA-15006030 124 $855.00 BTA-20006030 124 $855.0036 4 5 BTA-12006036 124 847.00 BTA-15006036 134 941.00 BTA-20006036 145 1,021.0048 5½ 7 BTA-12006048 180 1,112.00 BTA-15006048 186 1,241.00 BTA-20006048 197 1,370.0054 6 8-1/2 BTA-12006054 200 1,278.00 BTA-15006054 206 1,355.00 BTA-20006054 222 1,561.0060 7 10 BTA-12006060 212 1,424.00 BTA-15006060 232 1,482.00 BTA-20006060 247 1,702.0072 8½ 12 BTA-12006072 252 1,611.00 BTA-15006072 264 1,799.00 BTA-20006072 292 2,004.0084 10 14 BTA-12006084 292 1,922.00Net Wt.(lbs.)ListPrice EachNet Wt.(lbs.)ListPrice EachModel NumberModel NumberModel Number36 4 5 BTA-05005436 114 $634.00 BTA-06005436 127 $707.00 BTA-08005436 127 $707.0048 5½ 7 BTA-05005448 155 816.00 BTA-06005448 166 827.00 BTA-08005448 170 850.0060 7 10 BTA-05005460 197 1,027.00 BTA-06005460 203 1,043.00 BTA-08005460 226 1072.00Model NumberNet Wt.(lbs.)ListPrice Each30 3 4 BTA-05006030 106 $563.00 BTA-06006030 124 $656.00 BTA-08006030 124 $656.00 BTA-10006030 134 $696.0036 4 5 BTA-05006036 124 657.00 BTA-06006036 134 701.00 BTA-08006036 145 757.00 BTA-10006036 156 802.0042 5 6 BTA-05006042 160 817.00 BTA-06006042 160 817.00 BTA-08006042 170 877.00 BTA-10006042 180 928.0048 5½ 7 BTA-05006048 180 935.00 BTA-06006048 186 941.00 BTA-08006048 197 1,025.00 BTA-10006048 216 1,091.0054 6 8½ BTA-05006054 200 1,013.00 BTA-06006054 206 1,044.00 BTA-08006054 222 1,143.00 BTA-10006054 239 1,258.0060 7 10 BTA-05006060 212 1,120.00 BTA-06006060 232 1,172.00 BTA-08006060 247 1,315.00 BTA-10006060 269 1,397.0066 8 11 BTA-05006066 222 1,220.00 BTA-06006066 238 1,241.00 BTA-08006066 270 1,406.00 BTA-10006066 286 1,488.0072 8½ 12 BTA-05006072 252 1,306.00 BTA-06006072 264 1,397.00 BTA-08006072 292 1,497.00 BTA-10006072 311 1,588.0078 9 13 BTA-05006078 271 1,371.00 BTA-06006078 279 1,424.00 BTA-08006078 323 1,622.00 BTA-10006078 335 1,691.0084 10 14 BTA-05006084 292 1,456.00 BTA-06006084 309 1,541.00 BTA-08006084 332 1,655.00 BTA-10006084 369 1,862.0036 4 5 BTA-05006636 162 $740.00 BTA-06006636 150 $781.00 BTA-08006636 162 $841.00 BTA-10006636 180 $921.0048 5½ 7 BTA-05006648 204 987.00 BTA-06006648 208 1,049.00 BTA-08006648 214 1,093.00 BTA-10006648 230 1,162.0060 7 10 BTA-05006660 254 1,243.00 BTA-06006660 242 1,271.00 BTA-08006660 269 1,398.00 BTA-10006660 284 1,473.0030 3 4 BTA-05007230 139 $722.00 BTA-06007230 139 $722.00 BTA-08007230 145 $754.00 BTA-10007230 158 $799.0036 4 5 BTA-05007236 162 819.00 BTA-06007236 162 819.00 BTA-08007236 175 886.00 BTA-10007236 202 992.0048 5½ 7 BTA-05007248 204 1,017.00 BTA-06007248 217 1,083.00 BTA-08007248 238 1,221.00 BTA-10007248 245 1,257.0060 7 10 BTA-05007260 254 1,304.00 BTA-06007260 254 1,304.00 BTA-08007260 290 1,464.00 BTA-10007260 297 1,499.0036 4 5 BTA-05007836 151 $908.00 BTA-06007836 188 $951.00 BTA-08007836 188 $951.00 BTA-10007836 216 $1,062.0048 5½ 7 BTA-05007848 233 1,104.00 BTA-06007848 239 1,176.00 BTA-08007848 255 1,198.00 BTA-10007848 262 1,350.0060 7 10 BTA-05007860 273 1,397.00 BTA-06007860 278 1,424.00 BTA-08007860 312 1,575.00 BTA-10007860 319 1,611.00DVD or VIDEOAVAILABLELOADING DOCK EQUIPMENT6672788436 4 5 BTA-12006636 162 $984.00 BTA-15006636 150 $1,017.00 BTA-20006636 162 $1,184.0048 5½ 7 BTA-12006648 204 1,213.00 BTA-15006648 208 1,340.00 BTA-20006648 214 1,487.0060 7 10 BTA-12006660 254 1,603.00 BTA-15006660 242 1,645.00 BTA-20006660 269 1,843.0030 3 4 BTA-12007230 139 $866.00 BTA-15007230 139 $914.00 BTA-20007230 145 $992.0036 4 5 BTA-12007236 162 998.00 BTA-15007236 162 1,126.00 BTA-20007236 175 1,264.0048 5½ 7 BTA-12007248 204 1,383.00 BTA-15007248 217 1,464.00 BTA-20007248 309 1,586.0060 7 10 BTA-12007260 254 1,700.00 BTA-15007260 254 1,750.00 BTA-20007260 290 1,973.0072 8½ 12 BTA-15007272 300 2,233.0036 4 5 BTA-12007836 151 $1,062.00 BTA-15007836 188 $1,215.00 BTA-20007836 188 $1,349.0048 5½ 7 BTA-12007848 233 1,456.00 BTA-15007848 239 1,568.00 BTA-20007848 255 1,697.0060 7 10 BTA-12007860 273 1,820.00 BTA-15007860 278 1,873.00 BTA-20007860 312 2,086.0072 8½ 12 BTA-15007872 328 2,389.0036 4 5 BTA-12008436 193 $1,142.00 BTA-15008436 193 $1,296.00 BTA-20008436 200 $1,446.0048 5½ 7 BTA-12008448 242 1,557.00 BTA-15008448 242 1,682.00 BTA-20008448 273 1,818.0060 7 10 BTA-12008460 288 1,944.00 BTA-15008460 288 2,001.00 BTA-20008460 332 2,223.0072 8½ 12 BTA-15008472 350 2,543.00GAS RIDER TRUCKDC-25/FC-100ELECTRIC RIDER TRUCKwww.vestil.com Phone (800) 348-0868
18DVD or VIDEOAVAILABLEAluminum Truck Dockboards with Steel Safety CurbsThis dockboard is designed for portability and safety. Deck is made of tough highstrength aluminum tread plate. The edges are beveled for smooth entry and exit. Safetycurbs are coated yellow and are constructed of steel with cast tapered ends. Steel legs arebolted on for increased durability. Legs are located 12" from the beveled edge. Cantedlocking legs for easier fork truck portability. The bend is 11° and 9" from the bevelededge. Manufactured in compliance with OSHA. When using three-wheeled fork trucksorder dockboard with capacity at least four-times the lifting capacity of fork truck.UNIFORM CAPACITY 10,000 LBS. 15,000 LBS. 20,000 LBS.Size(Inches)Width x LengthHt. Difference11° / 19%InchesMODELNUMBERNET WT.(LBS.)LIST PRICEEACHMODELNUMBERNET WT.(LBS.)LIST PRICEEACHMODELNUMBERNET WT.(LBS.)LIST PRICEEACH60 36 5 TAS-10-6036 103 $640.00 TAS-15-6036 121 $694.00 TAS-20-6036 125 $751.0060 48 7 TAS-10-6048 145 811.00 TAS-15-6048 161 1,010.00 TAS-20-6048 178 1,025.0060 60 10 TAS-10-6060 169 1,003.00 TAS-15-6060 219 1,235.00 TAS-20-6060 250 1,494.0060 72 12 TAS-10-6072 227 1,219.00 TAS-15-6072 300 1,493.00 TAS-20-6072 324 1,778.0072 36 5 TAS-10-7236 127 $723.00 TAS-15-7236 137 $785.00 TAS-20-7236 147 $843.0072 48 7 TAS-10-7248 175 934.00 TAS-15-7248 195 1,083.00 TAS-20-7248 210 1,171.0072 60 10 TAS-10-7260 230 1,144.00 TAS-15-7260 260 1,405.00 TAS-20-7260 301 1,703.00DC-30/FC-100Dockboard AccessoriesLOADING DOCK EQUIPMENTLEVERLIFTmodel ALLALUMINUM DOCKBOARD ACCESSORIESMODELLIST PRICE MODELLIST PRICENUMBER DESCRIPTIONEACH NUMBER DESCRIPTIONEACHLC48-66 Lifting Chains 48"W - 66"W $63.00 / Pair HOLE Extra Span Holes $6.00 / HoleLC72-84 Lifting Chains 72"W - 84"W 70.00 / Pair PIN Extra Span Pins 5.00 / EachSSL Sliding Span Locks (BTA only) 65.00 / Pair ALL Leverlift 63.00WH Dockboard Wheels Kit (125 lb. capacity) 42.00 / Pair CED Canted Edge 13.00HDL Dockboard Handle Kit 17.00 / Pair RPL Removable Pickup Loops (TS series only) 77.20WHHDL Wheels & Handle Kit (125 lb. capacity) 78.00 / Set ATC Anti-Theft Chain 2.40 / FootSP Span Pins & Holes (4 holes per side) 78.00 / Board SB Second Bend 35.00DC-25DESIGNED FOR USEWITH TWO WHEELHAND TRUCKS(not included)Phone (800) 348-0868series AHTDDVD or VIDEOAVAILABLEseries AMDDVD or VIDEOAVAILABLELIFTING CHAINSseries LCTheanbeflualDewith OSHA.MODELNUMBEROVERALLWIDTHOVERALLLENGTHHEIGHTDIFFERENTIALNET WT.(POUNDS)LIST PRICEEACHAHTD-3036 30" 36" 5" 38/UPS $335.00AHTD-3048 30" 48" 7" 50/UPS 438.00AHTD-3648 36" 48" 7" 59 $495.00AHTD-3660 36" 60" 10" 72 600.00AHTD-3672 36" 72" 13" 86 702.00AHTD-3696 36" 96" 19 1140 1,054.00DC-25/UPS/FC-100MODELNUMBERSLIDING SPAN LOCKSmodel SSLAluminum Hand Truck DockboardsOVERALLWIDTHOVERALLLENGTHWHEEL & HANDLE KITmodel WHHDLThese dockboards are lightweight and can be carried and positioned by one person. Provides a safeand convenient bridge between dock and truck. Welded aluminum diamond tread surface andbeveled edges provide safe and smooth entry and exit. The bend is designed to keep ramp edgesflush with the dock surface and the truck floor. Equipped with welded on locking legs. Full lengthaluminum curbs provide hand holds and reduce chance of roll off. 800 pound uniform capacity.Designed for use with two wheel hand trucks. 3/16" plate thickness. Manufactured in complianceAluminum Mini DockplatesScale 3" to 6" curbs and high door thresholds. Ideal for use with two wheel hand trucks fordeliveries. Aluminum construction is lightweight yet durable, ⅛" thick plate. Features carryinghandles and diamond tread plate surface for better traction.UNIFORM CAPACITY(POUNDS)NET WT.(POUNDS)LIST PRICEEACHAMD-2418 24" 18" 500 10 $125.00AMD-3018 30" 18" 600 12 139.00AMD-3618 36" 18" 700 14 174.00DC-25/UPS/FC-100www.vestil.com
Steel Truck Dockboards• Bend is 11° and 9" from Beveled Edge / Legs are 12" from Edge• Tread plate Design Ensures Positive TractionConstructed of high strength (55,000 psi) steel for long life. Beveled edges on both ends permitsmooth entry and exit. Deck is diamond plated for safe, efficient use. Welded safety curbsfor maximum strength. Locking legs minimize ramp movement and are uneven to allow thedockboard to sit canted for easier floor pickup by fork trucks when not in use. Standard withleverlift for quick portability with fork truck. Optional accessories: lifting chains, span locks, spanpins/holes and removable pickup loops. Manufactured in compliance with OSHA. When usingthree wheeled fork trucks, select capacity +20% due to concentrated load on center of board.DVD or VIDEOAVAILABLE19LEVERLIFTSTANDARDUNIFORM CAPACITY 10,000 LBS. 15,000 LBS. 20,000 LBS.Size(Inches)Width x LengthHt. Difference11° / 19%InchesMODELNUMBERNET WT.(LBS.)LIST PRICEEACHMODELNUMBERNET WT.(LBS.)LIST PRICEEACHMODELNUMBERNET WT.(LBS.)LIST PRICEEACH60 36 5 TS-10-6036 261 $610.00 TS-15-6036 326 $707.00 TS-20-6036 333 $722.0060 48 7 TS-10-6048 368 787.00 TS-15-6048 426 921.00 TS-20-6048 435 941.0060 60 10 TS-10-6060 525 1,136.00 TS-15-6060 537 1,161.00 TS-20-6060 695 1,571.0060 72 12 TS-10-6072 597 1,347.00 TS-15-6072 635 1,435.00 TS-20-6072 791 1,870.0066 36 5 TS-10-6636 318 $660.00 TS-15-6636 353 $764.00 TS-20-6636 359 $779.0066 48 7 TS-10-6648 396 858.00 TS-15-6648 461 998.00 TS-20-6648 470 1,016.0066 72 12 TS-10-6672 647 1,463.00 TS-15-6672 686 1,548.00 TS-20-6672 855 2,020.0072 36 5 TS-10-7236 326 $707.00 TS-15-7236 347 $820.00 TS-20-7236 417 $948.0072 48 7 TS-10-7248 426 921.00 TS-15-7248 496 1,072.00 TS-20-7248 551 1,245.0072 54 8-1/2 TS-10-7254 556 1,200.00 TS-15-7254 575 1,203.00 TS-20-7254 654 1,475.0072 60 10 TS-10-7260 678 1,332.00 TS-15-7260 698 1,355.00 TS-20-7260 723 1,633.0072 72 12 TS-10-7272 721 1,579.00 TS-15-7272 742 1,664.00 TS-20-7272 919 2,171.0084 36 5 TS-10-8436 432 $934.00 TS-15-8436 452 $977.00 TS-20-8436 563 $1,270.0084 48 7 TS-10-8448 567 1,226.00 TS-15-8448 567 1,281.00 TS-20-8448 741 1,673.0084 60 10 TS-10-8460 671 1,515.00 TS-15-8460 702 1,586.00 TS-20-8460 878 2,072.00Size (inches)Width x LengthHt. Difference11° / 19% (In) 25,000 LBS. 30,000 LBS.60 36 5 TS-25-6036 447 $966.00 TS-30-6036 467 $968.0060 48 7 TS-25-6048 562 1,269.00 TS-30-6048 582 1,270.0060 60 10 TS-25-6060 695 1,571.00 TS-30-6060 798 1,884.0060 72 12 TS-25-6072 791 1,870.00 TS-30-6072 952 2,250.0066 36 5 TS-25-6636 483 $1,044.00 TS-30-6636 554 $1,250.0066 48 7 TS-25-6648 607 1,369.00 TS-30-6648 730 1,649.0066 72 12 TS-25-6672 855 2,020.00 TS-30-6672 1032 2,437.0072 36 5 TS-25-7236 518 $1,119.00 TS-30-7236 596 $1,345.0072 48 7 TS-25-7248 651 1,472.00 TS-30-7248 786 1,775.0072 54 8-1/2 TS-25-7254 729 1,647.00 TS-30-7254 841 1,987.0072 60 10 TS-25-7260 807 1,823.00 TS-30-7260 931 2,199.0072 72 12 TS-25-7272 919 2,171.00 TS-30-7272 1111 2,625.0084 36 5 TS-25-8436 563 $1,270.00 TS-30-8436 681 $1,537.0084 48 7 TS-25-8448 741 1,673.00 TS-30-8448 858 2,026.0084 60 10 TS-25-8460 878 2,072.00 TS-30-8460 1065 2,515.00DC-25/FC-60Steel Truck DockplatesConstructed of high strength INX-55 (55,000 psi) steel. Safety locking legs prevent slippagebetween truck and dock. Raised pattern safety tread plate helps provide positive traction.Beveled edges for smooth entry and exit. Chain pickup comes standard on all units. Designedwith an 11° bend located 9" from the beveled edge. The legs are 12" from the beveled edge.Manufactured in compliance with OSHA. When using three wheeled fork trucks, selectcapacity +20% due to concentrated load on center of board.DVD or VIDEOAVAILABLE• Standard with Leverlift• Add $35.00 for Chain Pickupand Use Suffix (-C) (no leverlift)• Add $183.00 for Span Locksand Use Suffix (-SL)• Call Us for Special Sizes andConfigurations.LOADING DOCK EQUIPMENTOVERALLWIDTHOVERALLLENGTHHEIGHTDIFF.MODELNUMBER3/8" PLATE THICKNESS 1/2" PLATE THICKNESSUNIFORM CAPACITY NET WT. LIST PRICE MODEL UNIFORM CAPACITY NET WT.(POUNDS) (LBS.) EACH NUMBER(POUNDS) (LBS.)LIST PRICEEACH48" 30" 4" SE-4830 5,000 221 $324.00 SEH-4830 8,800 282 $430.0048" 36" 5" SE-4836 4,125 250 380.00 SEH-4836 7,300 330 504.0048" 48" 7" SE-4848 3,090 324 496.00 SEH-4848 5,500 429 656.0048" 60" 9" SE-4860 2,475 399 610.00 SEH-4860 4,400 528 808.0054" 30" 4" SE-5430 5,500 235 $358.00 SEH-5430 9,900 314 $481.0054" 36" 5" SE-5436 4,600 277 424.00 SEH-5436 8,250 371 568.0054" 48" 7" SE-5448 3,450 361 552.00 SEH-5448 6,185 486 744.0054" 60" 9" SE-5460 2,760 444 679.00 SEH-5460 4,950 575 917.0060" 36" 5" SE-6036 5,150 306 $468.00 SEH-6036 9,160 404 $616.0060" 48" 7" SE-6048 3,860 400 611.00 SEH-6048 6,875 526 803.0060" 60" 9" SE-6060 3,090 498 756.00 SEH-6060 5,500 619 988.00DC-25/FC-60www.vestil.com Phone (800) 348-0868
20Aluminum Walk RampsEnables delivery men, shippers, and receivers to load and unload trucks when docks areunavailable. Ramps feature a 1½" high safety curb on each side. Heavy-duty steel chainswith steel grab hooks are attached to each side of ramp for safely securing ramp to truck.Constructed of strong aluminum alloy with non-skid tread surface. The ramp is lightweightand easy to handle. Available in either an overlapping style that rests on the truck bed,suffix "A", or steel hook style that mounts onto the truck extensions, suffix "B".TYPE A - OVERLAPTYPE B - STEEL HOOKSDECK CROSS-SECTIONLOADING DOCK EQUIPMENTHEIGHTRANGEUNIFORM CAPACITY (LBS.) 28" WIDE / 26" USABLE 38" WIDE / 36" USABLE4-WHEEL 2-WHEEL MODEL NET WT. LIST PRICE MODEL NET WT. LIST PRICECART CART NUMBER (LBS.) EACH NUMBER (LBS.) EACHTYPELENGTHA 6" - 21" 6' 2,800 2,000 AWR-28-6A 76 $384.00 AWR-38-6A 97 $469.00A 6" - 25" 7' 2,800 1,800 AWR-28-7A 88 438.00 AWR-38-7A 112 512.00A 6" - 29" 8' 2,500 1,650 AWR-28-8A 100 483.00 AWR-38-8A 125 564.00A 6" - 33" 9' 2,500 1,600 AWR-28-9A 112 516.00 AWR-38-9A 142 606.00A 6" - 38" 10' 2,200 1,500 AWR-28-10A 124 $561.00 AWR-38-10A 157 $700.00A 6" - 46" 12' 1,900 1,400 AWR-28-12A 148 677.00 AWR-38-12A 187 782.00A 6" - 54" 14' 1,600 1,200 AWR-28-14A 172 736.00 AWR-38-14A 217 928.00A 6" - 62" 16' 1,000 1,000 AWR-28-16A 196 847.00 AWR-38-16A 227 1,016.00B 6" - 23" 6' 2,800 2,000 AWR-28-6B 76 $362.00 AWR-38-6B 97 $438.00B 6" - 27" 7' 2,800 1,800 AWR-28-7B 88 417.00 AWR-38-7B 112 521.00B 6" - 31" 8' 2,500 1,650 AWR-28-8B 100 469.00 AWR-38-8B 125 545.00B 6" - 35" 9' 2,500 1,600 AWR-28-9B 112 494.00 AWR-38-9B 142 594.00B 6" - 40" 10' 2,200 1,500 AWR-28-10B 124 $541.00 AWR-38-10B 157 $680.00B 6" - 48" 12' 1,900 1,400 AWR-28-12B 148 664.00 AWR-38-12B 187 765.00B 6" - 54" 14' 1,600 1,200 AWR-28-14B 172 717.00 AWR-38-14B 217 908.00B 6" - 64" 16' 1,000 1,000 AWR-28-16B 196 828.00 AWR-38-16B 227 1,010.00DC-25/FC-100Aluminum Grip-Strut Walk RampsLoad and unload trucks when docks are unavailable. The open deck design allows snow,ice and water to fall through ramp providing a positive grip for delivery men, shippers andreceivers. 100% welded aluminum construction is lightweight and will not rust. Rampsfeature a 2" high safety curb on each side. Overlap style end lip rests on the trailer bed toprovide a smooth transition. Each unit includes two safety chains to connect the ramp to thetrailer for safety. Not for pallet trucks or three wheel carts.HEIGHTRANGEUNIFORM CAPACITY (LBS.) 28" WIDE / 26" USABLE 38" WIDE / 36" USABLE4-WHEEL 2-WHEEL MODELNET WT. LIST PRICE MODELNET WT.CART CARTNUMBER(LBS.) EACHNUMBER(LBS.)LIST PRICEEACHLENGTH6" - 21" 6' 2,800 2,000 AWR-G-28-6A 43 $410.00 AWR-G-38-6A 49 $502.006" - 25" 7' 2,800 1,800 AWR-G-28-7A 45 469.00 AWR-G-38-7A 53 548.006" - 29" 8' 2,500 1,650 AWR-G-28-8A 48 517.00 AWR-G-38-8A 57 604.006" - 33" 9' 2,500 1,600 AWR-G-28-9A 51 552.00 AWR-G-38-9A 61 649.006" - 38" 10' 2,200 1,500 AWR-G-28-10A 53 $601.00 AWR-G-38-10A 65 $749.006" - 46" 12' 1,900 1,400 AWR-G-28-12A 58 724.00 AWR-G-38-12A 72 837.006" - 54" 14' 1,600 1,200 AWR-G-28-14A 64 788.00 AWR-G-38-14A 80 993.006" - 62" 16' 1,000 1,000 AWR-G-28-16A 69 906.00 AWR-G-38-16A 88 1,088.00Aluminum Walk Ramp OptionsPhone (800) 348-0868Adjustable Height Wheel Option, is ideal for use withaluminum ramps 8 feet or longer. Height is adjustedwith a manual hand crank mechanism. Wheelsare10" x 3½" pneumatic and are locatedat balance points on the ramp. Simplebolt-on installation. Minimum ramplowered height with this option is 12".Walk ramp sold separately.model AWR-WHL, $380.00Ramp Cart Option, provides for easy one-person ramppositioning and transporting. Pull handle up to verticalposition to rotate and lock wheels indown position. Push handle downto unlock and lift wheels so rampcan be used to service lower trailers.Hard rubber wheels measure 10" x 2½".Minimum ramp service height is 14" withthis option. Easy bolt-on installation. Walkramp sold separately.model AWR-R-CART, $114.00DC-25/FC-100www.vestil.com
21Aluminum Walk Ramp Handrail OptionEasy to install bolt-on handrailing option gives ramp users more stability and security. Railingsections are 42" high with a 21" mid-rail. Units install onto both A-style and B-style aluminum walkramps. Handrailing may be attached to one side or both sides of ramp. Aluminum construction withunpainted finish. Installation brackets and hardware included. Railing priced each.NewMODELNUMBERHANDRAILLENGTHNET WT.(LBS.)LIST PRICEEACHSTYLEAWR-HR-2A ALUMINUM BOLT-ON HANDRAIL KIT 2 FT. 15 $184.00AWR-HR-3A ALUMINUM BOLT-ON HANDRAIL KIT 3 FT. 16 204.00DC-25/FC-100Suitcase RampMeet ADA requirements with these handy lightweight compact ramps. Assembly required.Single fold ramp measures 14"W x 72"L x 3"H when folded. It has a 1¼" curb and 2½" lip.The ramp is serrated and has debris slots.SINGLE FOLDmodel RAMP-SFMODELNUMBERUNFOLDED(W x L x H)FOLDED(W x L x H)UNIFORM CAPACITY(POUNDS)NET WT.(POUNDS)LIST PRICEEACHRAMP-SF 28" x 72" x 1½" 14" x 72" x 3" 500 33 $230.00DC-25/UPS/FC-100Wooden Ramp KitsKits allow for building wooden ramps using common lumber. Each kit includes two steelend plates and rubber bottom tips. Installation hardware is included. Drilling required forinstallation. Lumber/boards are not included.MODELNUMBERMODELNUMBEROVERALLWIDTHOVERALLLENGTHUNIFORMCAPACITYMAXIMUMWORKING HEIGHTNET WT.(POUNDS)LIST PRICEEACHFWR-3010-50 30" 10' 3,000 30" 124 $936.00FWR-3012-50 30" 12' 3,000 35" 161 1,105.00FWR-3610-50 36" 10' 3,000 30" 156 $1,110.00FWR-3612-50 36" 12' 3,000 35" 180 1,220.00FWR-3614-50 36" 14' 3,000 45" 204 1,430.00DC-25/FC-85MODELNUMBEROVERALLWIDTHOVERALLLENGTHUNIFORMCAPACITYUSABLELUMBER SIZEMAXIMUMWORKING HEIGHTNET WT.(POUNDS)NET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONRK-8 WOODEN RAMP KIT 8" x 2" 8 $36.00RK-12 WOODEN RAMP KIT 12" x 2" 14 57.00DC-25/UPSHeavy-Duty Fiberglass Walk RampsLoad and unload equipment from trucks using these Heavy-duty Fiberglass WalkRamps. Reinforced fiberglass construction provides up to 3,000 pounds capacity.Abrasive surface provides good traction in wet or dry conditions. 1" high curb oneach side of ramp. Not for use with fork trucks or pallet trucks.Fiberglass Autoloader RampsThe Autoloader Ramp can be separated in half to provide two ramps that may be used to loadautomobiles and other vehicles. Each half is 18" wide and handles 2,500 pounds. To separatesimply remove center hinge pins.LIST PRICEPER PAIRFAL-3610-50 36" 10' 5,000 30" 162 $1,182.00FAL-3612-50 36" 12' 5,000 35" 186 1,372.00FAL-3614-50 36" 14' 5,000 45" 210 1,549.00FAL-3616-50 36" 16' 5,000 50" 264 1,804.00DC-25/FC-85Industrial Acrylic Convex MirrorsLightweight design made from the finest quality materials, using Grade A Optical Acrylic.Comes standard with hanging hardware.MODELNUMBEROVERALLDIAMETERDISTANCECOVEREDNET WT.(LBS.)ROUGH TEXTURELIST PRICEEACHDESCRIPTIONCNVX-12 ROUND CONVEX 12" 12' 5 $26.00CNVX-18 ROUND CONVEX 18" 20' 9 33.00CNVX-26 ROUND CONVEX 26" 26' 14 59.00CNVX-30 ROUND CONVEX 30" 30' 20 87.00CNVX-2616 RECTANGULAR 26"W x 16"H 24' 12 $64.00DOME-26 DOME 360° 26" 26' 15 $72.00DOME-32 DOME 360° 32" 32' 20 105.00DC-25/UPS/FC-125model RK-8CNVX-2616www.vestil.com Phone (800) 348-0868NewNewDOME-32LOADING DOCK EQUIPMENT
LOADING DOCK EQUIPMENT22Shown with optional fork pocketsWHEEL RISERS AREPRICED AND SOLD EACHPORTABILITY KIT, modelATWR-WL, allows oneperson to transport and placewheel riser. Features 5" x 2"mold-on-rubber wheels. Foruse with aluminum wheelrisers only.Phone (800) 348-0868HEIGHTmodel R-CAD-KITPORTABLE WHEEL RISER CADDY,series R-CAD, move steel oraluminum risers out of the way withthis easy to use mover. Snap rollerinto riser and away you go.CENTRAL PICK-UP LOOP, modelSWR-CPL is used to connect twowheel risers (wheel risers pricedseparately). Allows fork trucks toeasily position and move risers asone. Overall width is 102".OVERALLLENGTHHEIGHTOVERALLLENGTHLEVELLENGTHAluminum Wheel RisersElevate semi-trailers to loading docks for maximum serviceability during loading andunloading operations. Manufactured from heavy-duty aluminum tread plate forpositive traction. All welded aluminum construction. 30,000 lbs. uniform capacity perpair (¼" thick material). Wheel Risers are designed to raise the trailer for loading andunloading to facilitate compliance with OSHA/ANSI B56.1 part 3 sec 7 requirementsfor maximum grade of ascending or descending loaded fork trucks.LEVELLENGTHMODELNUMBER18" WIDE 24" WIDENET WT. LIST PRICE MODEL NET WT.(EACH) EACHNUMBER (EACH)MODELNUMBER18" WIDE 24" WIDENET WT. LIST PRICE MODEL(EACH) EACHNUMBERNET WT.(EACH)LIST PRICEEACH48" 30" ATWR-18-6-48 70/UPS $433.00 ATWR-24-6-48 87/UPS $504.006"54" 36" ATWR-18-6-54 80/UPS 476.00 ATWR-24-6-54 100/UPS 551.0060" 42" ATWR-18-6-60 87/UPS 523.00 ATWR-24-6-60 108 625.00102" 84" ATWR-18-6-102 155 797.00 ATWR-24-6-102 194 919.0054" 30" ATWR-18-8-54 90/UPS $494.00 ATWR-24-8-54 112 $607.008"60" 36" ATWR-18-8-60 98 551.00 ATWR-24-8-60 121 689.0066" 42" ATWR-18-8-66 109 607.00 ATWR-24-8-66 135 767.00108" 84" ATWR-18-8-108 187 945.00 ATWR-24-8-108 233 1,095.0060" 30" ATWR-18-10-60 108 $596.00 ATWR-24-10-60 133 $700.0010"66" 36" ATWR-18-10-66 121 715.00 ATWR-24-10-66 151 766.0072" 42" ATWR-18-10-72 130 766.00 ATWR-24-10-72 160 825.00114" 84" ATWR-18-10-114 227 1,077.00 ATWR-24-10-114 279 1,242.0066" 30" ATWR-18-12-66 133 $704.00 ATWR-24-12-66 164 $806.0012"72" 36" ATWR-18-12-72 142 754.00 ATWR-24-12-72 174 890.0078" 42" ATWR-18-12-78 179 802.00 ATWR-24-12-78 223 932.00120" 84" ATWR-18-12-120 261 1,239.00 ATWR-24-12-120 321 1,381.00ADD A WHEEL TO A SINGLE ALUMINUM WHEEL RISER FOR PORTABILITY. MODEL ATWR-WL, $53.00 EACHDC-25/UPS/FC-100OPTIONAL WELDED FORK POCKETS, 7½"W x 2½"H, MODEL ATWR-FP, $51.00 LIST EACHPORTABLE WHEEL RISER CADDY, MODEL R-CAD-18, for 18" wide units, $129.00 LISTPORTABLE WHEEL RISER CADDY, MODEL R-CAD-24, for 24" wide units, $129.00 LISTPAIR OF BOLT-ON BRACKETS AND HARDWARE, MODEL R-CAD-KIT, $58.00 LIST PAIRANCHOR BRACKETS (4 PER RISER) TO BOLT RISER TO GROUND, MODEL ATWR-ABRK, $45.00 EACH RISER FACTORY INSTALLEDSteel Wheel RisersHEIGHTLEVEL LENGTHOVERALL LENGTHNOTE: DUAL WHEELS ONSEMI-TRAILERS ARE 18" WIDE.THE 24" WHEEL RISERS WORKBEST FOR THIS APPLICATION.WHEEL RISERS AREPRICED AND SOLD EACHEquipped with fork slots for ease in fork truck transporting. Ramps may be stacked for compact storage whennot in use. Fork pockets are 7½" wide by 2½" high usable. These fork pockets add approximately 15" to theoverall width of the riser. Wheel Risers are designed to raise the trailer for loading and unloading to facilitatecompliance with OSHA/ANSI B56.1 part 3 sec 7 requirements for maximum grade of ascending or descendingloaded fork trucks. Heavy-duty welded steel construction. Uniform capacity per pair is 40,000 lbs. (¼" thickmaterial).LIST PRICEEACH48" 24" SWR-18-6-48 183 $239.00 SWR-24-6-48 222 $289.006¼"60" 36" SWR-18-6-60 221 289.00 SWR-24-6-60 272 351.0072" 48" SWR-18-6-72 261 356.00 SWR-24-6-72 320 431.0084" 60" SWR-18-6-84 299 404.00 SWR-24-6-84 369 493.0060" 28" SWR-18-8-60 246 $332.00 SWR-24-8-60 301 $398.008¼"72" 40" SWR-18-8-72 293 393.00 SWR-24-8-72 359 467.0084" 52" SWR-18-8-84 339 468.00 SWR-24-8-84 415 560.0096" 64" SWR-18-8-96 385 529.00 SWR-24-8-96 471 631.0060" 20" SWR-18-10-60 268 $378.00 SWR-24-10-60 329 $447.0010¼"72" 32" SWR-18-10-72 322 443.00 SWR-24-10-72 394 521.0084" 44" SWR-18-10-84 375 532.00 SWR-24-10-84 458 629.0096" 56" SWR-18-10-96 428 596.00 SWR-24-10-96 523 707.0072" 24" SWR-18-12-72 349 $537.00 SWR-24-12-72 427 $579.0012¼"84" 36" SWR-18-12-84 408 564.00 SWR-24-12-84 498 661.0096" 48" SWR-18-12-96 469 667.00 SWR-24-12-96 571 781.00108" 60" SWR-18-12-108 528 737.00 SWR-24-12-108 644 862.00PORTABLE WHEEL RISER CADDY, MODEL R-CAD-18, for 18" wide units, (2 pair of brackets) $129.00 LISTDC-25/FC-60PORTABLE WHEEL RISER CADDY, MODEL R-CAD-24, for 24" wide units, (2 pair of brackets) $129.00 LISTTWO PAIR OF BOLT-ON BRACKETS AND HARDWARE, MODEL R-CAD-KIT, $58.00 LIST PAIRANCHOR BRACKETS (4 PER RISER) TO BOLT RISER TO GROUND, MODEL SWR-ABRK, $43.00 EACH RISER FACTORY INSTALLEDCENTRAL PICKUP LOOP, MODEL SWR-CPL, $332.00 LIST EACH, ADDITIONAL NET WT. 186 LBS.www.vestil.com
Wheel Chair RampsThe Americans with Disabilities Act requires that all buildings must be accessible to disabled persons. Failure to comply may result in monetarydamages and civil penalties. According to ADA rules and regulations, for every inch of rise you must have a foot of ramp in length.23A) TELESCOPIC RAMP is constructed oflightweight aluminum extrusion. Topsurface is serrated for positive traction.MODELNUMBERMODELNUMBERPLATFORM SIZE(W x L)DIMENSIONS(WIDTH x LENGTH)RAMP(W x L)UNIFORM CAPACITY(POUNDS)UNIFORM CAPACITY(POUNDS)MODELNUMBER HEIGHT LENGTH DIAMETERNET WT.(POUNDS)NET WT.(LBS.)NET WT.(POUNDS)LIST PRICEEACHTYPEA D-TR-88 7 7 /8" x 88" 550 65/pr. $400.00B D-FAR-120 7 7 /8" x 120" 550 77/pr. 360.00C D-AW-88 36" x 88" 500 118 862.00C D-AW-132 36" x 132" 500 177 1,278.00C D-AW-168 36" x 168" 500 227 1,739.00D D-ROL-48 36" x 48" 500 97 477.00E RAMP-SF 28" x 72" 500 33 230.00DC-25/UPS/FC-100Aluminum Pick-Up/Van RampMODELNUMBERMODELNUMBERLENGTHLENGTHFOLDEDWIDTHWIDTHPER RAMPUNFOLDEDWIDTHGROSS UNIFORMCAPACITYGROSSUNIFORM CAPACITYSINGLE WHEELUNIFORM CAPACITYSINGLE WHEELUNIFORM CAPACITYNET WT.(POUNDS)NET WT.(POUNDS)LIST PRICEEACHRAMP-5077 78" 16½" 50" 1,500 lbs. 250 lbs. 40 $243.00DC-25/UPS/FC-100LIST PRICEPER PAIRRAMP-72 72" 9" 1,000 lbs. 500 lbs. 50/pr./UPS $109.00RAMP-96 96" 9" 1,000 lbs. 500 lbs. 60/pr./LTL 133.00DC-25/UPS/FC-60Hitch LiftHeavy-duty 12 volt DC motorized hitch lift. Standard 2" receiver bar has multiple pin positionsfor different tailgate depths (extends out 52" when lowered and 47" when raised). Built-inadjustable limiting device to allow the matching up of the deck plate to the truck bed level or toground level. 21 foot long cable set for battery connection. Two stage outrigger assemblies foradded stability. Be sure to fold the deck plate up before driving away. Tie down straps should beused to secure load. Steel construction.LIST PRICEEACHHL-55 28" x 25" 28" x 7" 550 136 $489.00DC-25/FC-50Wheel Alignment CurbsB) FOLD-A-WAY RAMP easy, one personstorage and handling. Slip-resistant surfaceprovides extra traction. Each ramp comeswith 2 handles for easy positioning.Lightweight aluminum ramp works great for large andsmall wheeled equipment. When using with small wheeledequipment add ¼" plywood (not included) to ramp surface. Folds upto 16½" wide for storing between ATV wheels in truck. Includes adjustable safetystraps to hook ramp safely to trailer. Height unfolded is 1½". Folded height is 5½".Steel Pick-Up/Van RampsThese economical serrated ramps provide minimum slippage.Overlapping lip provides smooth transition into cargo area.Single piece construction with bolt-on lip.C) GRATE RAMP is a semi-permanentramp that is ideal for high trafficareas. Handrails are available.Ideal for properly aligning trailers at loading docks. All welded steel construction suitable forindoor or outdoor use. Units must be secured to surface. Heavy-duty welded-steel constructionwith yellow powder-coat finish. 8" x 8" base plates with pre-drilled holes standard.LIST PRICEEACHSWAC-92 8 15 /16" 92" 4½" 133 $264.00SWAC-144 8 15 /16" 144" 4½" 193 297.00SWAC-ABK (8) ¾" x 4" CONCRETE ANCHOR BOLTS 4 $24.00DC-20/FC-50D) ROLL-O-RAMP provides access overcurbs. Wheels installed on curb oframp for portability. Beveled edgescreate smooth transition betweenramp and ground.E) SUITCASE RAMP has serrated grip withdebris slots. Folds up for transportation.www.vestil.com Phone (800) 348-0868LOADING DOCK EQUIPMENT
24LOADING DOCK EQUIPMENTSPANLENGTHseries HCRmodel C-75-24NewPhone (800) 348-0868CONNECTORSNewWIDTHNewseries XHCRSeries LHCRSeries HCRSeries WR1-1/4"3/4"5/16"1.25"2.50"2.614"model MRBR-24model RHCB-12model RHCB-12AFabricated Aluminum Hose & Cable BridgesProtect hoses and cables from carts and other traffic. Constructed of lightweight durable aluminumtread plate. All welded. The opening is available in spans of 4" to 16". (⅜" thick plate)MODELNUMBEROVERALL SIZE(W x L)USABLE SPAN(W x H)UNIFORMCAPACITY (POUNDS)NET WT.(POUNDS)LIST PRICEEACHFHCR-24-36-4 24" x 36" 4" x 3" 2,000 55 $293.00FHCR-24-40-8 24" x 40" 8" x 3" 2,000 58 318.00FHCR-24-44-12 24" x 44" 12" x 3" 2,000 62 339.00FHCR-24-48-16 24" x 48" 16" x 3" 2,000 66 347.00FHCR-24-36-4-4H 24" x 36" 4" x 4" 2,000 55 $293.00FHCR-24-40-8-4H 24" x 40" 8" x 4" 2,000 58 317.00FHCR-24-44-12-4H 24" x 44" 12" x 4" 2,000 62 339.00FHCR-24-48-16-4H 24" x 48" 16" x 4" 2,000 66 347.00FHCR-48-36-4 48" x 36" 4" x 3" 2,000 85 $572.00FHCR-48-40-8 48" x 40" 8" x 3" 2,000 92 616.00FHCR-48-44-12 48" x 44" 12" x 3" 2,000 102 654.00FHCR-48-48-16 48" x 48" 16" x 3" 2,000 108 695.00FHCR-48-36-4-4H 48" x 36" 4" x 4" 2,000 85 $568.00FHCR-48-40-8-4H 48" x 40" 8" x 4" 2,000 92 611.00FHCR-48-44-12-4H 48" x 44" 12" x 4" 2,000 102 651.00FHCR-48-48-16-4H 48" x 48" 16" x 4" 2,000 108 691.00DC-25/UPS/FC-100Extruded Aluminum Hose & Cable BridgesDesigned to protect air lines, electrical cords and computer cables from damage by fork trucks, carts,and personnel. These ramps have serrated edges for maximum traction and are lightweight for easyportability. Contact factory for special lengths up to 25 feet.MODELNUMBEROVERALL(W x H) LENGTHUSABLE SPAN(W x H)SINGLE-WHEELUNIFORM CAPACITYNET WT.(LBS.)LIST PRICEEACHWR-24 2 7 /8" x 7 /16" 24" 1¼" x 5 /16" 2,500 2 $29.00WR-36 2 7 /8" x 7 /16" 36" 1¼" x 5 /16" 2,500 4 49.00WR-48 2 7 /8" x 7 /16" 48" 1¼" x 5 /16" 2,500 5 57.00HCR-24 7" x 1 /8" 24" 2½" x ¾" 10,000 7 $98.00HCR-36 7" x 1 /8" 36" 2½" x ¾" 10,000 11 124.00HCR-48 7" x 1 /8" 48" 2½" x ¾" 10,000 14 174.00LHCR-36 9 1 /8" x 1½" 36" 2½" x 1¼" 10,000 14 $168.00LHCR-48 9 1 /8" x 1½" 48" 2½" x 1¼" 10,000 19 225.00LHCR-60 9 1 /8" x 1½" 60" 2½" x 1¼" 10,000 24 279.00LHCR-72 9 1 /8" x 1½" 72" 2½" x 1¼" 10,000 29 336.00XHCR-36 21 1 /6" x 3½" 36" 4½" x 3" 10,000 53 $252.00XHCR-48 21 1 /6" x 3½" 48" 4½" x 3" 10,000 71 336.00XHCR-60 21 1 /6" x 3½" 60" 4½" x 3" 10,000 88 420.00XHCR-72 21 1 /6" x 3½" 72" 4½" x 3" 10,000 105 504.00DC-25/UPS/FC-100Molded Rubber Hose & Cable BridgesDesigned to protect cables and hoses from pedestrian and rolling traffic. The top surface ofeach bridge includes serrations for extra traction. Optional connectors may be used to interlockindividual units together to form wider bridges. Simply lock together as many units as required.Model MRBR-24 has carrying handles molded into the ramp. Fits over cables to protect hoses frompunctures and kinks.Series RHCB is ideal for people who are always switching out cables but do not want to move theramp. The model RHCB-A features an aluminum tread plate insert to protect hoses and cables (forlight traffic and slow applications only).MODELNUMBEROVERALL SIZE(W x L)USABLE SPAN(W x H)UNIFORM CAPACITY(POUNDS)NET WT.(POUNDS)LIST PRICEEACHMRBR-24 24" x 24" 2¾" x 1½" 2,400 40 $67.00MRBR-CON CONNECTOR PER PAIR 2 10.00RHCB-12 12" x 32½" 3½" x 2 7 /8" 2,400 32 $81.00RHCB-12A 12" x 32¾" 3½" x 3" 2,400 42 111.00RHCB-CON CONNECTOR PER PAIR 1 10.00DC-25/UPS/FC-55Long Extruded Rubber Cable ProtectorsThis product works well for temporary wire/cable protection from vehicles. Bottom openings are ½".MODELNUMBERWIDTH(INCHES)LENGTH(FEET)HEIGHT(INCHES)TOPOPENINGUNIFORMCAPACITYNET WT.(LBS.)LIST PRICEEACHC-75-12 4" 12 1 /8" ¾" 6,600 LBS. 20 $61.00C-75-24 4" 24 1" 5 /8" 6,600 LBS. 40 109.00C-150-12 6½" 12 2 1 /8" 1½" 4,400 LBS. 50 121.00DC-25/UPS/FC-55www.vestil.com
25Multi-Channel Cable ProtectorsThe fast and easy way to guard and protect valuable electrical cables and hose lines from damageand abuse while providing a method of safe crossing for vehicle and pedestrian traffic. Three channeldesign is ideal for construction sites, sporting events, and warehouses. Constructed of syntheticrubber with a yellow plastic lid. Features interlocking tabs to easily connect units.MODELNUMBER WIDTH LENGTH HEIGHTMODELNUMBEROVERALL SIZE(W x L)USABLE SPAN(W x H)UNIFORMCAPACITY (LBS.)UNIFORM CAPACITY(POUNDS)NET WT.(LBS.)NET WT.(POUNDS)LIST PRICEEACHMCHC-55 23½" 35½" 2¾" 20,000 55 $119.00DC-25/UPS/FC-55Rubber RampsModular rubber ramps are versatile for use in many applications. Two ramp lengths to choose from.Add round corner pieces for a finished look. Tread surface pattern for better traction. Includeshardware for connecting ramps together. Uniform capacity is 4,000 lbs. per ramp. Heavy-dutymolded rubber construction.MODELNUMBER DESCRIPTION WIDTH DEPTH HEIGHTNET WT.(LBS.)LIST PRICEEACHRCR-23 RECTANGULAR RAMP 23" 10" 3¾" 16 $36.00RCR-35 RECTANGULAR RAMP 35" 10" 3¾" 24 53.00RCR-C CORNER RAMP 10" 10" 3¾" 5 16.00DC-25/UPS/FC-55Cable GuardDesigned to protect hose and cable from roll-over damage. Ideal for office and pedestrianapplications. Interlocking design connects units for longer lengths. Top surface of ramp featuresanti-slip traction design. Manufactured from black molded rubber.MODELNUMBEROVERALL SIZE(W x L x H)USABLE SPAN(W x H)UNIFORM CAPACITY(POUNDS)NET WT.(LBS.)LIST PRICEEACHMRHR-39 5" x 39" x 3/4" 1 7 /16" x ½" 2,200 3 $39.00DC-25/UPS/FC-55Urethane Hose & Cable BridgesProtect hoses and cables from everyday foot traffic. Handles loads up to 100 PSI (2,400 pounds)with less than 10% deflection. Constructed of durable urethane material. Designed with tractioncleats on ramp surface to prevent slippage (for light traffic and slow applications only).LIST PRICEEACHURTH-24 24" x 24" 3" x 3" 2,400 20 $153.00URTH-36 24" x 36" 3" x 3" 2,400 30 210.00URTH-48 24" x 48" 3" x 3" 2,400 40 255.00DC-25/UPS/FC-55Multi-Purpose RampsHigh impact ramps are perfect for a variety of work environments; postal routes, schools, hospitals,warehouses and delivery routes. These ramps make it simple to move loads onto a curb or over hosesand cables. The textured non-skid surface allows for sure footing on the incline and decline. Thelightweight and completely portable unit handles hand trucks and other wheeled equipment with ease.NewNewmodel RCR-35LENGTHLENGTHPLASTICmodel MPR-2310-Gmodel RCR-CNewWIDTHWIDTHLOADING DOCK EQUIPMENTMODELNUMBER MATERIAL WIDTH LENGTH HEIGHTUNIFORMCAPACITYNET WT.(LBS.)LIST PRICEEACHMPR-2310-G PLASTIC 23½" 10½" 4" 5,000 5 $45.00MPR-2313-G PLASTIC 23½" 13½" 5½" 5,000 9 53.00MPR-2410 PLASTIC 24" 10½" 4" 5,000 18 43.30MRR-2310 RUBBER 23¼" 9¾" 3¾" 5,000 7 34.00MPR-10-KIT OPTIONAL BRIDGE KIT FOR MPR-2310-G, MPR-2410 or MRR-2310 5 $20.00MPR-13-KIT OPTIONAL BRIDGE KIT FOR MPR-2313-G 6 22.00DC-25/UPS/FC-70Roll-Up Speed BumpsUnique design allows product to roll-up for transportation and storage. Designed for use intemporary applications requiring speed control. Great for use at special events. Rolled diameter isonly 21". High-strength molded plastic construction with anti-slip rubber bottom. Ends allow forconnecting multiple units together for extra length. High-visibility yellow to draw attention. Nohardware needed.BRIDGE KITSOLID RUBBER, model MRR-2310NewMODELNUMBEROVERALL SIZE(W x H x L)ROLLDIAMETERNET WT.(LBS.)LIST PRICEEACHCOLORSBR-120 8½" x 1½" x 120" 21" BLACK/YELLOW 30 $479.00DC-25/UPS/FC-70www.vestil.com Phone (800) 348-0868
LOADING DOCK EQUIPMENT26vestilgreenmodel SBA-72vestilgreenvestilgreenvestilgreenPhone (800) 348-0868NewFeature dual 1" x 1"cable channelsREFLECTIVESPEED BUMP SIGNmodel SBS-1012NewNewseries TCSCNewSpeed BumpsHelp control drivers in dangerous areas while protecting people and property. One personinstallation. Holds up under truck and semi-trailer traffic. Can be removed for seal coating, snowremoval, or change of location. Resists marring by oil, road salt, sunlight and chemicals. Asphaltkit includes spikes and butyl tape. Feature dual 1"W x ¾"H cable channels and includes hardware.Constructed of lightweight recycled plastic. Compression strength is 3,200 lbs. per square inch. Theconcrete hardware kit includes bolts, anchors and washers. The glue down anchor plate kit includesanchor plates, T-nuts, bolts and washers. Requires two part epoxy which is not included.MODELNUMBEROVERALL SIZE(W x H x L)TYPE OF HARDWAREKIT INCLUDEDNUMBER OFMOUNTING HOLESNET WT.(LBS.)LIST PRICEEACHSB-48 10" x 2" x 48" CONCRETE 3 29 $90.00SBA-48 10" x 2" x 48" ASPHALT 3 29 106.00SBG-48 10" x 2" x 48" GLUE-DOWN 3 31 116.00SBD-48 12" x 2¼" x 48" CONCRETE 3 32 $100.00SBDA-48 12" x 2¼" x 48" ASPHALT 3 32 116.00SBDG-48 12" x 2¼" x 48" GLUE-DOWN 3 34 126.00SB-36 10" x 2" x 72" CONCRETE 4 43 $117.00SBA-36 10" x 2" x 72" ASPHALT 4 43 130.00SBG-36 10" x 2 " x 72" GLUE-DOWN 4 45 144.00SB-72 10¼" x 2" x 72" CONCRETE 6 13 $94.00SBA-72 10¼" x 2" x 72" ASPHALT 6 13 110.00SBG-72 10¼" x 2" x 72" GLUE-DOWN 6 15 120.00SBD-72 12" x 2¼" x 72" CONCRETE 4 47 $153.00SBDA-72 12" x 2¼" x 72" ASPHALT 4 47 169.00SBDG-72 12" x 2¼" x 72" GLUE-DOWN 4 49 183.00SB-108 10" x 3" x 106" CONCRETE 5 62 $187.00SBA-108 10" x 3" x 106" ASPHALT 5 62 208.00SBG-108 10¼" x 2" x 72" GLUE-DOWN 5 64 225.00SBS-1012 REFLECTIVE SPEED BUMP SIGN 1 $20.00DC-25/UPS/FC-70Speed BumpsIncrease pedestrian safety and control traffic reducing vehicle speeds to 10 mph. Made from 100%recycled rubber tires. Our high-visibility black and yellow Speed Bumps effectively slow trafficwithout vehicle or tire damage. Install easily with lag bolts simply drill a hole with a masonry bit, andpenetrate the asphalt or concrete surface below. Embedded reflective material increases visibility andsafety, day or night. Hardware included. Made in USA.MODELNUMBEROVERALL SIZE(W x H x L) DESCRIPTION COLORNET WT.(LBS.)LIST PRICEEACHRSB-10C-GRN 10" x 2 1 /8" x 24" CENTER MODULE BLACK/YELLOW 14 $72.00RSB-10E-GRN 10" x 2 1 /8" x 24" END MODULE BLACK/YELLOW 14 72.00DC-25/UPS/FC-70Speed CushionsSafely control traffic and reduce vehicle speeds to 20-30 mph with these speed cushions. Made from100% recycled rubber tires, our high traction speed cushions are highly visible and extremely durable.Designed to slow traffic while having a minimal effect on emergency response time. Easy to installwith modular sections. Both concrete and asphalt hardware are included. Speed cushions are flexibleand conform to road curvature on any asphalt or concrete surface. Made in USA.MODELNUMBERMODELNUMBEROVERALL SIZE(W x H x L) COLOROVERALL SIZE(W x H x L)REFLECTIVESTRIPE COLORNUMBEROF HOLESNET WT.(LBS.)NET WT.(LBS.)LIST PRICEEACHTCSC-6-GRN 6'6" x 3" x 6'8" BLACK TWO ARROWS 520 $1,575.00TCSC-10-GRN 6'6" x 3" x 10' BLACK TWO ARROWS 870 2,466.00DC-25/FC-70Rubber Car StopsCar Stops prevent vehicles from damaging buildings, sidewalks, curbs, and delicate landscape. Indoorsthey function as bumper cushions and protectors for motorized carts, fork-lift trucks, and vehiclesin factories and warehouses. 100% recycled rubber car stops are a durable, reliable, long-lastingalternative to traditional concrete stops. Stops are resistant to extreme temperature variations, UVlight, oil, and moisture. Easy to maintain. Will not crack, break, rot, or disintegrate. Made in USA.LIST PRICEEACHCS-33-BL-GRN 6" x 4" x 72" NONE 5 38 $70.00CS-33-Y-GRN 6" x 4" x 72" YELLOW 5 38 71.00CS-33-W-GRN 6" x 4" x 72" WHITE 5 38 71.00CS-33-B-GRN 6" x 4" x 72" BLUE 5 38 71.00CS-14AK-GRN ASPHALT HARDWARE (5 NEEDED PER BUMPER) 1 $3.50CS-KIT-GRN CONCRETE HARDWARE (5 NEEDED PER BUMPER) 1 3.75DC-25/UPS/FC-70www.vestil.com
27Car StopsProtecting people and property from drivers in dangerous areas. Constructed of lightweightrecycled plastic. One person installation. Can be removed for seal coating, snow removal, orchange of location. Resists marring by oil, road salt, sunlight and chemicals. Resists rotting,termite damage and corrosion. No costly painting or maintenance. Asphalt kit includes spikesand butyl tape. The concrete hardware kit includes bolts, anchors and washers. The glue downanchor plate kit includes anchor plates, T-nuts, bolts and washers. Requires two part epoxywhich is not included. Hardware kits sold separately.vestilgreenseries CS-33NewMODELNUMBEROVERALL SIZE(W x H x L) COLORNUMBER OFMOUNTING HOLESNET WT.(LBS.)LIST PRICEEACHCS-33-G 6" x 3¼" x 72" GRAY 3 40 $65.00CS-33-Y 6" x 3¼" x 72" YELLOW 3 40 65.00CS-33-B 6" x 3¼" x 72" BLUE 3 40 65.00CS-33-W 6" x 3¼" x 72" WHITE 3 40 65.00CS-33-BL 6" x 4" x 71" BLACK 3 35 $60.00CS-S48-G 6" x 4" x 48" GRAY 2 24 $63.00CS-S48-Y 6" x 4" x 48" YELLOW 2 24 63.00CS-S48-B 6" x 4" x 48" BLUE 2 24 63.00CS-S48-W 6" x 4" x 48" WHITE 2 42 63.00CS-S72-G 6" x 4" x 72" GRAY 3 36 $74.00CS-S72-Y 6" x 4" x 72" YELLOW 3 36 74.00CS-S72-B 6" x 4" x 72" BLUE 3 36 74.00CS-S72-W 6" x 4" x 72" WHITE 3 36 74.00CS-TB96-G 10" x 7" x 96" GRAY 4 120 $291.00CS-TB96-Y 10" x 7" x 96" YELLOW 4 120 291.00CS-TB96-B 10" x 7" x 96" BLUE 4 120 291.00CS-TB96-W 10" x 7" x 96" WHITE 4 120 291.00DC-25/UPS/FC-70MODELNUMBERUSE WITH ABOVE NO.OF MOUNTING HOLESNET WT.(LBS.)LIST PRICEEACHDESCRIPTIONCS-AK-2 ASPHALT HARDWARE KIT 2 2 $21.00CS-33-KIT-2 CONCRETE HARDWARE KIT 2 3 14.00CS-GD-2 GLUE DOWN ANCHOR PLATE 2 4 17.00CS-AK ASPHALT HARDWARE KIT 3 3 $25.00CS-33-KIT-3 CONCRETE HARDWARE KIT 3 4 17.00CS-GD-3 GLUE DOWN ANCHOR PLATE 3 5 25.00CS-AK-4 ASPHALT HARDWARE KIT 4 4 $33.00CS-33-KIT-4 CONCRETE HARDWARE KIT 4 5 24.00CS-GD-4 GLUE DOWN ANCHOR PLATE 4 6 34.00DC-25/UPS/FC-70Rubber Speed HumpsControl traffic and reduce vehicle speeds. Ideal in neighborhoods, construction areas, hospitals,post offices, and airports. Can be removed for seal coating, snow removal, or change of location.Easy tongue and groove installation.Series RSMH-GRN and RSH-GRN are made from 100% USA recycled tire rubber. Installs easilywith lag bolts. Simply drill a hole with a masonry bit, and penetrate the asphalt or concretesurface below. Embedded yellow reflective material increases visibility and safety, day or night.Concrete and asphalt hardware included. Center and end modules sold separately.Series RSH are constructed of recycled and virgin rubber. Units are black with yellow embeddedhighway tape to ensure high visibility. Units include (1) center and (2) end modules.vestilgreenNewASPHALT KITmodel CS-AKGLUE DOWN KITmodel CS-GD-2series CS-S & CS-TBmodel CS-33-BLCONCRETE KITmodel CS-33-KIT-3Newseries RSHseries RSH-GRNLOADING DOCK EQUIPMENTMODELNUMBEROVERALL SIZE(W x L x H) DESCRIPTIONTYPE OF HARDWAREKIT INCLUDEDUNIFORMCAPACITY (LBS.)REDUCESPEEDS (MPH)NET WT.(LBS.)LIST PRICEEACHMINI RUBBER SPEED HUMPSRSMH-18C-GRN 18" x 24" x 2¼" CENTER SECTION BOTH 40,000 15 28 $111.00RSMH-18E-GRN 18" x 24" x 2¼" END SECTION BOTH 40,000 15 28 111.00MEDIUM RUBBER SPEED HUMPSRSH-36C-GRN 36" x 24" x 2½" CENTER SECTION BOTH 40,000 20 53 $175.00RSH-36E-GRN 36" x 24" x 2½" END SECTION BOTH 40,000 20 53 175.00DELUXE RUBBER SPEED HUMPSRSH-108-24-C 24" x 108" x 1.2" COMPLETE MODULE CONCRETE 40,000 5-10 106 $245.00RSH-108-24-A 24" x 108" x 1.2" COMPLETE MODULE ASPHALT 40,000 5-10 113 313.00RSH-120-36-C 36" x 120" x 2" COMPLETE MODULE CONCRETE 60,000 5-10 256 $415.00RSH-120-36-A 36" x 120" x 2" COMPLETE MODULE ASPHALT 60,000 5-10 264 490.00DC-25/UPS/FC-70www.vestil.com Phone (800) 348-0868
28Industrial Duty Circulator Fans115V 1-PHASE STANDARDTwo speed, 115V, 1 phase, ball bearing, totally enclosed and permanently lubricated IndustrialDuty Circulator Fan. Pull chain switch with a 12 foot long cord and an SJT type 3 conductorcord. Meets OSHA standards and is ETL & C/UL listed. ¼ HP electric motor.MODELNUMBERBLADEDIAMETERMOUNTINGSTYLEAMPSHIGHCFMHIGHCFMLOWNET WT.(LBS.)LIST PRICEEACHICRF-24-P 24" PEDESTAL 2.5 2750 1600 75 $246.00ICRF-24-W 24" WALL 2.5 5750 3200 45 194.00ICRF-30-P 30" PEDESTAL 2.7 6800 5000 78 250.00ICRF-30-W 30" WALL 2.7 7900 6000 48 199.00OSCILLATING STYLEICRF-24-PO 24" PEDESTAL 2.5 2750 1600 79 $334.00ICRF-24-WO 24" WALL 2.5 5750 3200 49 283.00ICRF-30-PO 30" PEDESTAL 2.7 6800 5000 82 344.00ICRF-30-WO 30" WALL 2.7 7900 6000 52 291.00DC-20/UPS/FC-110High Performance Circulator Fans115V 1-PHASE STANDARDTwo speed, 115V, 1 phase, ball bearing, totally enclosed and permanently lubricated Industrial DutyCirculator Fan. Pull chain switch with a 12 foot long cord and an SJT type 3 conductor cord. MeetsOSHA standards and is ETL & C/UL listed. ⅓ HP electric motor.LOADING DOCK EQUIPMENTmodel WSF-18-Fmodel WSF-12MODELNUMBERMODELNUMBERMODELNUMBERBLADEDIAMETERBLADEDIAMETERBLADEDIAMETERMOUNTINGSTYLEMOUNTINGSTYLERPMHIGHAMPSHIGHAMPHIGHAMPSHIGHCFMHIGHCFMHIGHCFMHIGHCFMLOWNET WT.(LBS.)LIST PRICEEACHDDB-36 36" 1100 5.6 12500 9000 82 $335.00DC-20/FC-110CFMMEDCFMLOWNET WT.(LBS.)LIST PRICEEACHWSF-12 12" WALL 1.1 2750 2200 1600 13 $74.00WSF-18 18" WALL 2.2 5750 4700 3200 20 92.00WSF-18-F 18" FLOOR 2.2 5750 4700 3200 20 95.00DC-20/UPS/FC-110CFMLOWNET WT.(LBS.)LIST PRICEEACHHPCR-30-P 30" PEDESTAL 3.4 8200 6200 78 $301.00HPCR-30-W 30" WALL 3.4 8200 6200 48 249.00HPCR-30-I 30" I-BEAM 3.4 8200 6200 52 278.00HPCR-30-C 30" CEILING 3.4 8200 6200 48 257.00DC-20/FC-110115V 1-PHASE STANDARDWork Station FansThree speed, 115V, 1 phase, totally enclosed, permanently lubricated motor Work Station Fan. Mountwith one bolt or lag screw to walls, ceilings, work benches, machines or any surface. Pull chain switch ona 10 foot long SJT type 3 conductor cord. Meets OSHA standards and is ETL & C/UL listed.Direct Drive Portable BlowerTwo speed, 115V, 1 phase, ball bearing, totally enclosed motor. Rocker switch. 15' SJT type 3 conductorpower cord. 3 paddle style steel blades. 8" rubber wheels. Meets OSHA standards. ETL & C/UL listed.Shutter Mounted Exhaust Fans115V 1-PHASE STANDARD115V 1-PHASE STANDARDInside-building installation only with vents outside. Eliminate need for external framing and shutter.Ideally suited for thin wall buildings. Units are 115V, 1 phase totally enclosed and permanentlylubricated. Pull chain switch. No cord. Junction box provided for direct wiring. Meets OSHA standards.NewMODELNUMBERBLADEDIAMETERMOTORHPAMPSHIGHCFMHIGHCFMMEDCFMLOWNET WT.(LBS.)LIST PRICEEACHSME-12 12" 1/12 1.1 2750 2200 1600 16 $161.00SME-18 18" 1/8 2.2 5750 4700 3200 25 233.00SME-24 24" 1/4 2.5 6800 --- 5000 47 307.00SME-30 30" 1/4 2.7 7900 --- 6000 54 383.00DC-20/UPS/FC-110Industrial Ceiling Fans115V 1-PHASE STANDARDLower winter heating costs by recovering residual heat trapped at roof level. Fully assembled except bladebolt down, 3 conductor power cord is 3 foot long with plug. All metal construction, with white epoxyfinish and aluminum paddles. Fan has 18" down rod with safety cable. Speed controls and reversionswitches available, please contact factory.Phone (800) 348-0868MODELNUMBER TYPE SIZE VOLTAGE/PHASE CFMNET WT.(LBS.)LIST PRICEEACHICF-48 DOWN DRAFT 48" 115V, 1PH 17000 20 $115.00ICF-56 DOWN DRAFT 56" 115V, 1PH 21000 21 125.00ICF-56-R REVERSIBLE 56" 115V, 1PH 21000 21 128.00DC-20/FC-110www.vestil.com
29COMMERCIAL CIRCULATORSCommercial Circulator FansTwo speed, 115V, 1 phase, ball bearing Commercial Circulator Fan. Pull chain switch with a 9foot long cord and an SJT type 3 conductor cord. Meets OSHA standards and is UL & C/ULlisted. ¼ HP electric motor. These Circulator Fans do not have a totally enclosed motor. Theyshould be used in a clean and dry commercial application.MODELNUMBERMODELNUMBERBLADEDIAMETERBLADEDIAMETERMOUNTINGSTYLEAMPHIGHAMPSHIGHCFMHIGHCFMHIGHCFMLOWNET WT.(LBS.)LIST PRICEEACHDDB-C-42 42" 4.3 13500 11000 93 $400.00DC-20/FC-110CFMLOWNET WT.(LBS.)LIST PRICEEACHCCRF-24-P 24" PEDESTAL 2.3 5400 4300 63 $175.00CCRF-24-W 24" WALL 2.3 5400 4300 43 150.00CCRF-30-P 30" PEDESTAL 2.4 6000 4800 66 180.00CCRF-30-W 30" WALL 2.4 6000 4800 46 155.00DC-20/UPS/FC-110Commercial Belt Drive Portable BlowerTwo speed, ½ HP, 115V, 1 phase, ball bearing motor. Rocker switch. 8 foot long SJT type 3 conductorcord. 3 paddle style steel blades. 8" rubber wheels. Meets OSHA standards and is UL listed. ThesePortable Blowers do not have a totally enclosed motor. They should be used in a clean and drycommercial application.Commercial Direct Drive BlowerTwo speed, 1/3 HP, 115V, 1 phase, ball bearing motor, permanently lubricated. Rocker switch(MB-C-30) or rotary switch (MB-RS-C-36) standard. 6 foot long SJT type 3 conductor cord. MeetsOSHA standards and is UL listed. These Direct Drive Blowers do not have a totally enclosed motor.They should be used in a clean and dry commercial application.MODELNUMBERMODELNUMBERBLADEDIAMETERBLADEDIAMETERAMPSHIGHCFMHIGHCFMHIGHCFMMEDCFMLOWNET WT.(LBS.)LIST PRICEEACHFF-C-20 20" 3450 3100 2950 17 $81.00DC-20/UPS/FC-110CFMLOWNET WT.(LBS.)LIST PRICEEACHMB-C-30 30" 3.6 6300 5500 SWIVEL 60 $249.00MB-RS-C-36 36" 3.6 8200 7,000 STATIONARY 70 250.00DC-20/UPS/FC-110Commercial Floor Fan115V 1-PHASE STANDARD115V 1-PHASE STANDARD115V 1-PHASE STANDARD115V 1-PHASE STANDARDThree speed, 1/5 HP, 115V, 1 phase, permanently lubricated motor. Rotary switch. 7 foot long SJT type3 conductor cord. Meets OSHA standards and is UL listed. These floor fans do not have a totallyenclosed motor. They should be used in a clean and dry commercial application.NewNewNewmodel MB-C-30model MB-RS-C-36Newmodel FF-C-20LOADING DOCK EQUIPMENTHeavy-Duty Portable Evaporative Coolers115V 1-PHASE STANDARDThese Portable Evaporative Coolers have large internal water reservoirs that allow units tooperate approximately 8 hours without being connected to an external water source. Water issupplied to the internal tank from a standard ¾" water hose or from optional water tank. Waterlevel in internal tank is controlled by the unit's float valve. Maintenance free submersible waterpump. 8" thick evaporative media is easily accessible for routine maintenance. Roto-moldedcorrosion free polyethylene housing. 20 foot long, 16 ga. 3 conductor cord with GFCI plug.Thermally protected, permanently lubricated fan motor. Variable speed on 36" unit / 2 speedon 16" unit. Weather tight fan and pump control switches. 4" heavy-duty casters; 2 locking, 2non-locking. ETL listed and meets OSHA specifications.Newmodel TS-EVAP-12MODELNUMBERBLADESIZEMOTORHPUNITAMPSCFMHIGHCFMLOWEFFECTIVESQUARE FEETINTERNALWATER TANKOVERALL SIZE(W x L x H)NET WT.(LBS.)LIST PRICEEACHTS-EVAP-12 12" 1/8 1.5 3800 2200 500 6 gal. 18½" x 22" x 29" 51 $435.00TS-EVAP-16 16" 1/3 7.2 2800 1600 1000 16 gal. 24" x 26" x 50" 105 1,181.00TS-EVAP-36 36" ¾ 13.9 11000 6500 3500 46 gal. 32" x 62" x 70" 325 2,452.00TS-ET-60 OPTIONAL POLYETHYLENE WATER TANK WITH METAL STAND (60 gal.) 65 $564.00DC-20/UPS/FC-110www.vestil.com Phone (800) 348-0868
30Portable Air Conditioning UnitsThese industrial air conditioning units are great for spot cooling, room cooling, and moistureremoval. These are great for use in industrial plants, hospitals, computer server rooms, anywhereelectrical equipment generates a lot of heat. Units have digital controls to run temperature ortime intervals, and high/low fan speeds. Units are portable and can fit through standard 36"doors. Includes 10 ft. power cord. Three phase unit must be hard wired. ETL listed.LOADING DOCK EQUIPMENTDIGITAL CONTROLSmodel PES-1520-3model CRFH-198NewMOISTURE CONTAINERNewmodel FFH-118Newmodel CFFH-240MODELNUMBERVOLTAGE& PHASEEFFECTIVESQ. FT.OVERALL SIZE(W x L x H)NET WT.(LBS.)LIST PRICEEACHCFMPACU-14 110V, 1PH 440/380 450 19.3" x 23.6" x 48.3" 176 $2,575.00PACU-18 110V, 1PH 540/500 600 19.3" x 23.6" x 48.3" 185 2,950.00PACU-24 110V, 1PH 710/610 750 19.3" x 23.6" x 48.3" 210 4,225.00PACU-36 240V, 1PH 880/775 1,250 30" x 33.6" x 58" 440 5,450.00PACU-70 480V, 3PH 2830/2650 2,800 30" x 33.6" x 58" 550 12,175.00DC-20/FC-110Portable Electric SalamandersThe Portable Electric Salamander is the perfect odorless, flameless electric alternative to propaneand kerosene space heaters. Safety yellow heater enclosure with safety screens on both air intakeand output openings. These units include long-life finned tubular heating elements, thermostatadjustment from 40 to 100 degrees Fahrenheit, and a fan only operating feature. Includes accesspanel for direct wiring connections and 10" wheel and handle for easy portability over all surfacetypes. Units are ETL C/U.S. listed.MODELNUMBERKWAMPSVOLTSPHASETEMPRISENET WT.(LBS.)LIST PRICEEACHDESCRIPTIONPES-1520-3 PORTABLE HEATER 15/42 208/3 45 65 $815.00PES-1524-1 PORTABLE HEATER 15/63 240/1 45 69 815.00PES-1524-3 PORTABLE HEATER 15/36 240/3 45 65 815.00PES-1548-3 PORTABLE HEATER 15/18 480/3 45 65 815.00PES-3048-3 PORTABLE HEATER 30/36 480/3 90 83 1,295.00PES-1024-1* PORTABLE HEATER 10/42 240/1 30 60 $815.00*FACTORY PRE-WIRED WITH 10' CABLE & STRAIGHT BLADE RANGE PLUGOPTIONAL 25 FOOT CORD WITH PLUGMODELNUMBER CABLE TYPE USE WITH MODELDC-20/FC-110LIST PRICEEACHPES-43-SO 4/3 SO, POWER CORD PES-1524-1 $205.00PES-64-SO 6/4 SO, POWER CORD PES-1520-3, PES-1524-3, PES-3048-3 175.00PES-124-SO 12/4 SO, POWER CORD PES-1548-3 85.00DC-20/FC-110Portable Electric HeatersMODELNUMBEROVERALL SIZE(W x D x H)1-PHASE STANDARDPortable electric heaters are lightweight, and have an easy grip handle for convenience. Theseheaters are perfect for office, or small spot heating applications. They include a 6 foot long,3 conductor cord, and temperature control thermostat. Model CFFH-240 has a two 20 ampplug configuration, which is great for construction sites. Model FFH-118 and CRFH-198meet OSHA standards and are UL & C-UL listed while CFFH-240 is only UL listed.NUMBEROF SETTINGS VOLTAGE/PHASE BTU'sNET WT.(LBS.)LIST PRICEEACHFFH-118 10" x 9½" x 16" 2 HEAT / 1 FAN 120, 1PH 5120 9 $46.00CRFH-198 11" x 12" x 15" 3 HEAT 120, 1PH 5120 9 77.00CFFH-240 10 5 /8" x 10" x 12¾" 2 HEAT 240/208, 1PH 13648 15 127.00DC-20/FC-110Portable Electric Infrared Heaters3-PHASE STANDARDProvide instant, odor-free heat for indoor and outdoor workstations and warehouse areas.Economical electric infrared heat warms only persons and objects, not the air volume. DurableU-shaped heavy-duty metal sheath heating elements are designed with an imbedded nichrone coil.All models have gold anodized aluminum reflectors, weather tight terminal box, protective wirescreens, and reinforced front edge and corner construction. Heaters can be adjusted on the handcart to operate in a horizontal or vertical position for maximizing the infrared heating pattern.Carts consist of a rugged steel design and are equipped with 6" rubber wheels and twin hand grips.Heaters are factory wired for three phase, but can be converted to single phase for most units.MODELNUMBER KW BTU's VOLTS PHASE AMPSNET WT.(LBS.)LIST PRICEEACHVFHK-624 6.0 20,478 240 3 14.4 37 $472.00VFHK-648 6.0 20,478 480 3 7.5 37 472.00VFHK-1324 13.5 46,076 240 3 33.0 65 $784.00VFHK-1348 13.5 46,076 480 3 17.0 65 784.00DC-20/UPS/FC-110Phone (800) 348-0868www.vestil.com
31Portable Infrared Heaters220V 1-PHASE STANDARDRadiant heat can be adjusted in distance and height. Adjustable brightness for various applications.Requires 220V single phase power supply @ 15 amps. Portable with four swivel casters (two withbrakes). Timer is included for auto-shut off.MODELNUMBERMODELNUMBERMAXIMUMPOWER OUTPUTOVERALL SIZE(W x D)LAMPELEMENTSELEMENT OVERALLSIZE (W x H x D)HEATED AREA(W x H) VOLTAGE AMPSELEMENT EACHSIZE (W x H x D)MODELNUMBER WATTS VOLTS PHASE BTU'sHEATSOURCESNET WT.(LBS.)NET WT.(LBS.)NET WT.(LBS.)LIST PRICEEACHHEAT-S 2400 W 3 27" x 30" x 6" 23½" x 7¾" x 4¼" 105 $1,733.00HEAT-S1 2000 W 4 39" x 18" x 6" 17¾" x 7¾" x 4¼" 115 1,845.00HEAT-S2 3000 W 6 39" x 30" x 6" 17¾" x 7¾" x 4¼" 135 2,205.00DC-20/FC-110Portable Electric Infrared Heat PanelsHigh intensity "medium wave" technology used for many applications such as: curing coatings andadhesives, laminating, heat shrinking and drying. Gentle but effective medium wave radiant heatcan quickly boost, flash-off, or cure a variety of finishes, and lessens the chance of blistering and/oroverheating the coating.Portable panels are built to withstand rigors of industrial and heavy-commercial applications, andcome standard with 20' of type SO cable. Heating elements achieve full temperatures in less then 1 to2 minutes, and are rated for an average life expectancy of 5,000 hours. Units are easily positioned withadjustable hinges allowing the user to precisely direct heat to the target area. Gold anodized aluminumreflectors and end caps allow 10% faster cure time than polished aluminum reflectors.LIST PRICEEACHPIHP-4 44 5 /8" x 56½" 40" x 44" 240 20 4 116 $1,650.00PIHP-6 66 5 /8" x 56½" 61" x 44" 240 26.7 4 141 1,900.00PIHP-11 66 5 /8" x 89½" 61" x 77" 240 46.7 7 225 3,500.00DC-20/FC-110Quartz Infrared Spot Heaters1-PHASE STANDARD240V 1-PHASE STANDARDKeep cool work areas well heated with these Infrared Heaters. The quartz tube radiates a blanket of heatin a 60° symmetrical pattern. Unit includes; gold aluminum reflector and end caps, mounting chains, Shooks and a cord set with plug. Units can be hung from the ceiling with mounting chains. For indooruse. Meets OSHA standards and is ETL C/U.S. listed.LIST PRICEEACHVCH-46C 1500 115 1 5120 9 $137.00VCH-57C 3000 240 1 10240 11 159.00VCH-WG46 S.S. WIRE GUARDS (use with model VCH-46C) 2 $28.00VCH-WG57 S.S. WIRE GUARDS (use with model VCH-57C) 2 32.00DC-20/UPS/FC-110NewNewmodel PIHP-4model PIHP-11LOADING DOCK EQUIPMENTPortable Quartz Infrared Spot Heater115V 1-PHASE STANDARDPortable heater adjusts from 2' to 6' in height. Wire guard is included, as well as a 15' cord set with plug(3 wire). Unit comes standard with four 2½" casters. Meets OSHA standards and is ETL C/U.S. listed. model VCH-48-PMODELNUMBER WATTS BTU's VOLTS PHASENET WT.(LBS.)LIST PRICEEACHVCH-48-P 1500 5,120 115 1 30 $275.00DC-20/UPS/FC-110NewLED Dock Loading Lights115V 1-PHASE STANDARDReduce broken bulb and high maintenance costs with LED Dock Loading Lights. These use 80% lessenergy than incandescent or halogen bulbs. Achieves maximum light intensity instantly, and light isoptimized for trailer illumination. These LED lights have no fragile filaments to break, eliminating theshattered glass of broken incandescent bulbs.NewvestilgreenMODELNUMBERARMLENGTHNET WT.(LBS.)LIST PRICEEACHDESCRIPTIONLL-LED-24 SINGLE STRUT 24" 11 $225.00LL-LED-40 DOUBLE STRUT 40" 18 250.00LL-LED-60 DOUBLE STRUT 60" 21 275.00LL-LED-BULB PAR 38 LED BULB 2 $140.00DC-20/UPS/FC-110model LL-LED-40www.vestil.com Phone (800) 348-0868
32Dock Loading Lights115V 1-PHASE STANDARDLights minimize freight damage while expediting loading and unloading operations. Designed to provide uniform visibilityinside trailers or around dock areas. Model LL-SAI and LL-SAF are ETL C/U.S. listed while all others are UL listed.Incandescent Lights, series LL and LL-SAI, offer good color, low replacement cost and turn on instantly even in cold environments. It utilizes a90 watt bulb, model PAR-38, sold separately. Adjustable arm knuckle joint allows vertical and horizontal positioning.Halogen Incandescent Light, model HLGN-40, typically provides more lumens/watt, better energy efficiency, has a longer service life andexperiences less light depreciation over its lifetime. It is supplied with a 500 watt bulb. Full illumination is instantaneous.High Pressure Sodium Lights, series LLS and AALLS, offer much higher lumens/watt output and a very long lamp life. Its illumination colorrendition (yellowish) is not as desirable as an incandescent. They typically require several minutes to fully illuminate, and even longer if in a coldenvironment. Low operating cost.Spun Aluminum Dock Lights, series LL-SAI and LL-SAF, stay cool to the touch even with a 300 watt incandescent light. Features strut armwith both horizontal and vertical adjustment. Available in a standard incandescent lamp head and a fluorescent lamp head. Fluorescent unitsinclude a bulb and head.LOADING DOCK EQUIPMENTINCANDESCENTSINGLE ARMmodel LL-24INCANDESCENTseries LL-SAIFLUORESCENTseries LL-SAFHIGH PRESSURE SODIUMmodel LLS-40DRYLOCATIONSDAMPLOCATIONSDOCK LOADING LIGHT OPTIONSINCANDESCENTDOUBLE ARMmodel LL-40MODELNUMBER DESCRIPTION LENGTHNET WT.(POUNDS)LIST PRICEEACHLL-24 INCANDESCENT, SINGLE ARM 24" 19 $100.00LL-40 INCANDESCENT, DOUBLE ARM 40" 22 112.00LL-60 INCANDESCENT, DOUBLE ARM 60" 28 134.00LL-90 INCANDESCENT, TRIPLE ARM 90" 42 241.00LL-SAI-40 INCANDESCENT, SINGLE STRUT ARM 40" 11 $90.00LL-SAI-60 INCANDESCENT, SINGLE STRUT ARM 60" 15 107.00HLGN-40 HALOGEN INCANDESCENT, DOUBLE ARM 40" 20 $123.00LL-SAF-40 FLUORESCENT, SINGLE STRUT ARM 40" 11 $130.00LL-SAF-60 FLUORESCENT, SINGLE STRUT ARM 60" 15 145.00LLS-24 HIGH PRESSURE SODIUM, SINGLE ARM 24" 19 $234.00LLS-40 HIGH PRESSURE SODIUM, DOUBLE ARM 40" 22 248.00LLS-60 HIGH PRESSURE SODIUM, DOUBLE ARM 60" 28 261.00LLS-90 HIGH PRESSURE SODIUM, TRIPLE ARM 90" 42 375.00AALLS-40 HIGH PRESSURE SODIUM, ADJUSTABLE ARM 40" 19 $235.00AALLS-60 HIGH PRESSURE SODIUM, ADJUSTABLE ARM 60" 22 250.00DC-25/UPS/FC-100MODELNUMBERINCANDESCENTDOUBLE ARMmodel LL-60HALOGEN INCANDESCENTDOUBLE ARMmodel HLGN-40NET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONPAR-38-90 90 WATT HALOGEN BULB, 1270 LUMENS (LL) 1 $15.00LL-S-BULB SODIUM BULB - 50 WATT 2 58.00LL-FL-BULB FLUORESCENT BULB - 55 WATT 2 32.00LL-S-HEAD SODIUM HEAD ONLY 13 $157.00LL-WG WIRE GUARD - 6" DIAMETER (INCANDESCENT) 1 21.00LL-GRILL GRILL / DIFFUSER (SODIUM) 1 21.00LL-STAND LIGHT STAND, 83" HIGH, INCLUDES ADJUSTABLE BRACKET 60 $209.00LLF-18 18" FAN, MOUNTING BRACKETS AND POWER CORD 30 97.00LL-40-FAN PACKAGE: LL-40 LIGHT, FAN, BRACKETS AND WIRING 78 216.00LL-HEAT-40 40" DOUBLE ARM LIGHT WITH HEATER ATTACHED 22 438.00DC-25/UPS/FC-100model HLGN-FWLHalogen Work Lights115V 1-PHASE STANDARDSuperior lighting at the job-site assures worker safety plus accurate loading andunloading. These premium lights are UL listed and CSA certified.500 watt halogen bulb included providing 11,000 lumens.model HLGN-PWLPhone (800) 348-0868MODELNUMBERMOUNTINGSTYLELIGHTBULBSNET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONHLGN-FWL SINGLE LAMP FLOOR 500 WATT 6 $21.00HLGN-PWL DOUBLE HEAD - DOUBLE CLAMP PEDESTAL 500 WATT 21 50.00DC-25/UPS/FC-100www.vestil.com
33Cargo Bars• Keep trailer contents in place -- eliminate damaged goods• Simple mechanical lock - will not vibrate looseDuring transport, keep trailer contents securely in place with these easy to use Cargo Bars. Constructed of1½" square tubing, unless specified. 14 gauge wall construction is lightweight yet extremely strong. Squarearticulating steel end plates feature rubber pads for positive gripping action. End plates measure 4" x 4" onmodels CL-15, CL-16, CL-17, CL-18 and CBH-32. End plates measure 4" x 2⅜" on model CB-7, CB-7-Rand CB-7-S. Bars fit between trailer walls.A) CB-5 & CB-7 B) CB-7-RC) EB-96 & EB-102L) E-TRACKEasy to use ratchet mechanismallows one person to adjust andratchet into place.M) CB-HLDRworks in conjunction with E-TRACK(E-TRACK sold separately)D) CB-7-S E) CL-15 & CL-16F) CL-17 G) CL-18H) CL-20MODELNUMBERSERVICERANGENET WT.(LBS.)LIST PRICEEACHTYPEDESCRIPTIONA CB-5 ONE PIECE ALUMINUM (ROUND TUBE) 88" to 103" 11 $54.00A CB-7 ONE PIECE ALUMINUM Heavy-Duty 89" to 104" 13 61.90B CB-7-R ONE PIECE ALUMINUM RATCHET (ROUND TUBE) 89" to 103" 16 64.40C EB-96 ONE PIECE ALUMINUM (E-TRACK) 85" to 96" 19 77.00C EB-102 ONE PIECE ALUMINUM (E-TRACK) 92" to 102" 22 80.00D CB-7-S ONE PIECE STEEL (ROUND TUBE) 88½" to 103" 14 $54.00E CL-15 ONE PIECE STEEL 87" to 119" 20 43.50E CL-16 ONE PIECE STEEL GALVANIZED 87" to 119" 22 55.60F CL-17 TWO PIECE STEEL GALVANIZED (FOLDING) 88" to 116" 22 59.20G CL-18 TWO PIECE STEEL GALVANIZED (TELESCOPIC) 90" to 139" 33 82.80H CL-20 TWO PIECE STEEL E & A TRACK END PADS 87" to 116" 22 $63.60I CBH-32 ONE PIECE STEEL WITH FULL HOOPS 87" to 116" 42 77.00J CH-7 GALVANIZED HOOPS (FOR CB SERIES ONLY) 24"W x 29"H 15 45.00/PRK CH-3 GALVANIZED HOOPS (FOR CL SERIES ONLY) 28½"W x 25½"H 19 51.00/PRL E-TRACK STEEL SECTION OF E-TRACK FOR TRAILERS 10 FOOT 17 35.00M CB-HLDR CARGO BAR HOLDER 7 55.00DC-35/UPS/STEEL FC-50/ALUMINUM FC-60Cargo Strapping• Guard against damages from slipping and shifting loads while transporting products• Tough strapping fabric is made of a polyester webbingTighten securely around cargo to help prevent damage and load shifting during transit.Spring loaded e-track fittings provide quick one-handed connection to anchor point.Both ratchet and cam buckle models tighten and release quickly.Edge Guards are reusable, durable, and economical.FLATENDmodel STRAP-27-FHI) CBH-32Top Hoop 70"W x 9"HBottom Hoop 78"W x 9"HJ & K) Cargo Bar Hoopsmodel CH-7 for CB series Cargo Barsmodel CH-3 for CL series Cargo Bars(cargo bars sold separately, hoopssold in pairs)HOOKENDNewmodel STRAP-27-RHLOADING DOCK EQUIPMENTMODELNUMBERSTRAPWIDTHWORKINGLENGTHUNIFORMWORKING LOADTIGHTENINGMECHANISMNET WT.(LBS.)LIST PRICEEACHFASTENERSTRAP-12-RE 2" 12' 1,000 RATCHETING E-CLIP 4 $17.00STRAP-16-CE 2" 16' 1,200 CAM E-CLIP 4 $19.00STRAP-16-RE 2" 16' 1,200 RATCHETING E-CLIP 4 20.00STRAP-27-RH 2" 27' 3,325 RATCHETING ROD HOOK 10 $28.00STRAP-27-FH 2" 27' 3,325 RATCHETING FLAT HOOK 10 28.00STRAP-6-RTO 2" 6" 800 D-RING/STRAP E-CLIP 1 $5.00E-CLIP-W BEAM E-SOCKET SUPPORTS THE END OF WOOD 2 x 4 2 $4.10E-CLIP-D TIE OFF THE "D" RING WHEN ATTACHED TO THE E-TRACK 2 6.60EDGE-R12 RUBBER EDGE GUARDS, 3¾"W x 12"L, 50 PIECES PER PACKAGE 46 $84.60EDGE-R6 RUBBER EDGE GUARDS, 5"W x 6"L, 100 PIECES PER PACKAGE 31 102.00EDGE-S7 STEEL EDGE GUARDS, 7½"W x 4"L, 10 PIECES PER PACKAGE 15 61.60DC-25/UPS/FC-65modelSTRAP-6-RTOmodelE-CLIP-DmodelE-CLIP-WmodelEDGE-R6 &EDGE-S7www.vestil.com Phone (800) 348-0868
LOADING DOCK EQUIPMENT34AIR BAGINFLATIONVALVEmodel BAG-IGENERAL DUTYQPC-7280-DPNewLEVER TYPEmodel LBDR-13-LPAL-12ALL WEATHERQPC-7280-UPPADLOCKNOT INCLUDEDHEAVY DUTYQPC-7280-VPRATCHET TYPEmodel LBDR-9-L30 FOOT STRAPmodel STRAP-30PAL-14PAL-16Reusable Dunnage BagsMinimize product shifting and damage in transit. The 2-ply construction consists of apolypropylene weave outer bag protecting a polyethylene inner bag. The bag provides 6 psipressure seal. Stores flat when empty. Fill with standard shop air.Air Bag Inflation Valve tool offers easy grip for convenient use. Press and hold red vinyl coatedlever. The cast zinc body has a chrome plated finish. Air inlet thread female ¼" NPT.MODELNUMBERMODELNUMBERDESCRIPTIONTAKEUPNET WT.(LBS.)LIST PRICEEACHLBDR-9-L LEVER 3¾" 10 $16.00LBDR-13-L RATCHET 3" 15 27.00DC-25/FC-50/UPSMODELNUMBERSIZE(W x H)OVERALL SIZE(W x L x H)NET WT.(LBS.)NET WT.(LBS.)LIST PRICEEACHDESCRIPTIONBAG-4836 REUSABLE BAG 48" x 36" 1 $10.40BAG-4884 REUSABLE BAG 48" x 84" 2 17.00BAG-I AIR BAG INFLATION VALVE 1 $16.80DC-25/UPSQuilted Moving PadsCushion and protect furniture, machinery, and electronic equipment. Each pad measures 72" wideby 80" long. Model QPC-7280-UP is water and mildew resistant. Units are sold in quantities of 12and the weights below reflect a dozen units.MODELNUMBERNET WEIGHT(POUNDS)LIST PRICE(DOZEN)DESCRIPTIONQPC-7280-DP GENERAL DUTY (both sides cotton) 64 $149.00QPC-7280-UP ALL WEATHER (both sides polyester) 82 147.00QPC-7280-VP HEAVY-DUTY (one side polyester/other side cotton) 79 172.00Lockable Load Binders• Provides 5,400 lbs. working load limit• Ideal for trailers, campers or farmersDC-20/UPS/FC-150Used for chain binding applications in trucking and marine industries. Heavy-duty, forged steelconstruction. Uniform proof capacity is 10,000 pounds. Ultimate uniform capacity is 19,000pounds. Accommodates 5 /16" to ⅜" chain. Insert lock through hole for maximum theft protection.Truck Mounted Strap WinchesTighten down loads to eliminate shifting. Choose from either weld or bolt on design. Strap andchrome plated winch bar sold separately. Low profile design available. Accommodates 4" straps upto 30' long.LIST PRICEEACHDESCRIPTIONSW-4-PSW WELD ON WINCH 3½" x 7¾" x 6¼" 12 $33.00SW-4-PSB BOLT ON WINCH 3½" x 7¾" x 6¼" 14 59.00SW-BAR MULTI-TASK WINCH BAR 1¼" DIA. x 36½"L 7 19.00SW-BAR-PT PAINTED WINCH BAR 1¼" x 33" 5 17.00STRAP-30 30 FOOT STRAP 4" W x 30'L 7 24.00DC-25/UPSPallet PullersPallet pullers are used to pull pallets to rear of trailers for easy fork truck access. Rugged steelconstruction. Heads are self-cleaning and unaffected by wood particles, paint or grease. Palletpullers are NOT designed for lifting.PAL-12 and PAL-16 - Single scissor action allows for wider jaw opening.PAL-14 - Cam closing action provides maximum gripping strength and reduces pinch points. Safetyhandle enables easier positioning and removal. Grips both metal and wood pallets with biting action.PAL-21 and PAL-LP - One piece curved heads have integral spurs for gripping pallet stringers.PAL-21Phone (800) 348-0868PAL-LPMODELNUMBERDESCRIPTIONUNIFORM JAW JAW NET WT. LIST PRICEPULLING CAPACITY HEIGHT OPENING (LBS.) EACHPAL-12 SINGLE SCISSOR 5,000 lbs. 2¾" 7" 14 $64.00PAL-16 HEAVY-DUTY SINGLE SCISSOR 6,000 lbs. 2" 5" 16 74.00PAL-14 CAM ACTION 5,000 lbs. 1½" 3" 17 81.00PAL-21 DOUBLE SCISSOR 5,000 lbs. 2¾" 3" 25 73.00PAL-LP LOW PROFILE DOUBLE SCISSOR 5,000 lbs. 2" 3¼" 24 81.00PPC-20 20' OF ¼" CHAIN W/GRAB HOOKS 6,000 lbs. --- --- 17 $36.00PPC-40 40' OF ¼" CHAIN W/GRAB HOOKS 6,000 lbs. --- --- 32 66.00NOT FOR LIFTINGDC-25/UPS/FC-50www.vestil.com
35Prylever BarsProvide dock workers, riggers, and freight handlers with the leverage needed to get underneath heavyobjects for transporting with fork truck, hand truck, pallet truck, or machinery movers. Two 5" x 2"poly-on-steel wheels. 6"W x 8"L x ½" thick steel nose plate with beveled edge is bolted on the woodhandle units and welded on the steel units. Steel units feature powder coat blue finish.MODELNUMBERDESCRIPTIONBARLENGTHUNIFORM CAPACITY(POUNDS)NET WT.(LBS.)LIST PRICEEACHPLB-5 WOOD PRYLEVER BAR 5' 4,250 31 $103.00PLB-6 WOOD PRYLEVER BAR 6' 4,250 32 108.00PLB-7 WOOD PRYLEVER BAR 7' 4,250 34* 113.00PLB/S-5 STEEL PRYLEVER BAR 5' 5,000 37 $119.00PLB/S-6 STEEL PRYLEVER BAR 6' 5,000 42 135.00PLB/S-7 STEEL PRYLEVER BAR 7' 5,000 47* 144.00DC-25/UPS/FC-70*WOOD HANDLEseries PLBSTEEL HANDLEseries es PLB/SPallet BusterGet rid of broken or unsightly pallets quickly and safely. Lightweight andeasy to use. Unique dual prying action with nail puller. Also can be utilizedfor dockboard removal.MODELNUMBERBARLENGTHHANDLEDIAMETERNET WT.(LBS.)LIST PRICEEACHDESCRIPTIONSKB-7 PALLET BUSTER 41½" 1¼" 8 $55.00DC-25/FC-70/UPSRubber Wheel ChocksConstructed of reinforced rubber to provide a sure grip on virtually any surface. Curved surface contoursto fit tires. Rubber resists tearing, abrasion, ozone weathering, etc. Functional design is durable in allweather conditions. Series RWC-8 is constructed of a mix of virgin and recycle, no reinforcement cords.The Airline Chocks are suitable for small and large aircraft. Model AC-13 includes a 36" longpolypropylene rope while model AC-18 has a 14" long polypropylene rope between the chocks.MODELNUMBERvestilgreenDIMENSIONS(W x H x D)NET WT.(LBS.)LIST PRICEEACHTYPEDESCRIPTIONA LWC-15 LAMINATED RUBBER 8" x 8" x 8" 18 $27.00B LWC-14 LAMINATED RUBBER 10" x 5½" x 10" 17 28.00C LWC-14M LAMINATED RUBBER (RUBBER GRIPS) 10" x 5½" x 10" 17 29.00D RWC-8 MOLDED RUBBER (EYEBOLT) 9¼" x 6" x 8" 10 $18.00E RWC-8-HDL MOLDED RUBBER (HANDLE) 9¼" x 6" x 8" 12 19.80F ORWC-8-HDL MOLDED RUBBER (ORANGE) 9¼" x 6" x 8" 12 23.30G RWC-9-U MOLDED RUBBER ("U" HANDLE) 9¼" x 6" x 8" 11 19.00H RWC-8-SBS MOLDED RUBBER (SERRATED BOTTOM) 9¼" x 6" x 8" 14 36.00I RWC-25 MOLDED RUBBER (JUMBO) 16" x 8" x 12" 22 72.00J RWC-5 MOLDED RUBBER (MOLDED HANDLE) 6" x 4" x 8" 5 25.00K RWC-11 MOLDED RUBBER (WHC-MR) 7" x 7¾" x 10" 13 30.00L RMC-4 EXTRUDED RUBBER 6½" x 4¾" x 4¼" 5 $13.90M EX-4 EXTRUDED RUBBER 10" x 3¾" x 4½" 12 31.00N EX-11 EXTRUDED RUBBER 8½" x 6" x 8½" 13 33.00O EX-13 EXTRUDED RUBBER 12" x 5¾" x 6½" 16 39.00P RWC-2-PR RUBBER W/ROPE CONNECTED 5" x 4" x 8" 7 33.00Q AC-13 AIRLINE CHOCK WITH ROPE 10" x 4½" x 5" 16 $75.40R AC-18 AIRLINE CHOCK WITH ROPE 18" x 5½" x 6" 33 86.80DC-25/UPS/FC-55PALLET BUSTERmodel SKB-7A) LWC-15B) LWC-14C) LWC-14MD) RWC-8 E) RWC-8-HDL F) ORWC-8-HDLG) RWC-9-UNewI) RWC-25K) RWC-11SERRATEDBOTTOMH) RWC-8-SBSJ) RWC-5L) RMC-4M) EX-4 N) EX-11LOADING DOCK EQUIPMENTO) EX-13P) RWC-2-PRQ) AC-13R) AC-18www.vestil.com Phone (800) 348-0868
36vestilgreenenA) EALUM-7 B) EALUM-7-HNDG C) EALUM-YELF) CWS-13NewRecycled Plastic Wheel ChocksThese recycled plastic wheel chocks are durable yet light enough to take along when you travel.Made of 100% recycled plastic. Resistant to damage from sunlight, oil, salt and chemicals.MODELNUMBERMODELNUMBERDIMENSIONS(W x H x D) COLORDIMENSIONS*(W x H x D)NET WT.(LBS.)NET WT.(LBS.)LIST PRICEEACHDESCRIPTIONPWC-G PLASTIC 7½" x 7½" x 10½" GREEN 6 $31.00PWC-Y PLASTIC 7½" x 7½" x 10½" YELLOW 6 31.00DC-25/FC-55/UPSAluminum Wheel ChocksLightweight and easy to handle extruded aluminum chocks.LIST PRICEEACHTYPEDESCRIPTIONA EALUM-7 CHOCK 7" x 8" x 10" 8 $41.00B EALUM-7-HNDG CHOCK WITH HAND GRIP 7" x 8" x 10" 8 81.00C EALUM-YEL YELLOW CHOCK 7" x 8" x 10" 19 45.00D EALUM-7-H CHOCK WITH HANDLE 7" x 8" x 10" 18 $112.00E EALUM-7-HS CHOCK W/HANDLE & SIGN 7" x 8" x 10" 19 153.00F CWS-13 ALUMINUM CHOCK W/FLAG 7" x 8" x 10½" 18 128.00*DIMENSIONS OF CHOCK ONLY - NOT INCLUDING HANDLE & SIGNDC-25/UPS/FC-85LOADING DOCK EQUIPMENTD) EALUM-7-H E) EALUM-7-HSSteel Wheel ChocksG) FAB-8 I) FAB-11K) SSC-17J) MS-15MODELNUMBERDIMENSIONS(W x H x D)NET WT.(LBS.)LIST PRICEEACHTYPEDESCRIPTIONG FAB-8 WELDED STEEL CHOCK 7½" x 8½" x 7½" 10 $38.00H FAB-10 FABRICATED STEEL CHOCK 10½" x 10" x 7½" 12 44.00I FAB-11 FORMED STEEL CHOCK 8" x 9" x 10¾" 13 30.00J MS-15 MOLDED CAST STEEL CHOCK 9" x 8½" x 8" 18 38.70K SSC-17 CAST STEEL SLOPE CHOCK 8½" x 8" x 15" 20 41.00L SWC-22 STEEL WHEEL CHOCK 6" x 8½" 17" 26 31.00M GWC-10* SERRATED STEEL CHOCK 11" x 5" x 9" 10 43.00*14"DEEP INCLUDING HANDLEL) SWC-22M) GWC-10 Urethane Wheel Chocksmodel URWC-2, URWC-15, URWC-25model URWC-8NewRWC-8-ERGONewNewmodel URWC-8-HDLH) FAB-10MODELNUMBERDIMENSIONS(W x H x D)NET WT.(LBS.)DC-25/UPS/FC-50LIST PRICEEACHDESCRIPTIONURWC-2* MINI-URETHANE CHOCK 7" x 6" x 8" 2 $21.20URWC-8 URETHANE CHOCK 9½" x 8" x 6" 3 24.00URWC-8-HDL URETHANE WITH HANDLE 9½" x 8" x 6" 4 25.00URWC-15* URETHANE WHEEL CHOCK 8" x 8" x 11" 5 33.00URWC-25* JUMBO URETHANE CHOCK 14½" x 14½" x 17" 30 $190.00URWC-25-SS* JUMBO CHOCK W/STEEL STUDS 14½" x 14½" x 17" 32 206.00URWC-45* MEGA URETHANE CHOCK 18" x 18" x 24" 54 290.00*MOLD-IN HOLE THROUGH WIDTH OF CHOCK FOR ATTACHING CHAIN (not included)DC-25/UPS/FC-55MODELNUMBERG) Textured tread plate to provide maximum traction.H) Open face radius allows chock to be used with any size tire. Includes chain.I) Formed chock utilizes a saw tooth bottom for traction.J) Features grip slot for easy pick up and positioning.K) Slope design contours to truck wheel.L) Rugged all welded construction. Works in mud, sand or concrete.M) Serrated steel wheel chock, grate style, 14"D including handle,galvanized finish, includes positioning handle with grip.Bright orange for greater visibility. Incoming and outgoing drivers can easily see chock for added safety.Safety tread on chock face provides better grip and reduces slippage.Ergo-Handle Wheel ChocksErgonomically designed to make it easy to move wheel chocks in and out of position under trailerwheels. Reduce the risk of back, knee, and foot injuries. Handle is constructed of steel and includesa yellow powder coat finish. Factory installed only.WHEEL CHOCK(W x H x D)NET WT.(LBS.)LIST PRICEEACHTYPE OF WHEEL CHOCKRWC-8-ERGO MOLDED RUBBER 9½" x 6" x 8" 15 $54.00ORWC-8-ERGO MOLDED RUBBER 9¼" x 6" x 8" 17 59.30FAB-10-ERGO FABRICATED STEEL 10½" x 10" x 7½" 17 80.00FAB-11-ERGO FABRICATED STEEL 8" x 9" x 10¾" 18 66.00DC-25/UPS/FC-55Phone (800) 348-0868www.vestil.com
37Wheel Chock AccessoriesChain and Hangers - Discourage theft and misplacement of wheel chocks, and facilitate safety inthe dock area. 15 foot chain attaches to the hanger. Hanger is then secured to the dock wall. Chainis fastened to the chock with cold shut.Wheel Chock Warning Signs - Warn truck drivers and dock workers to chock their wheels asrequired by law. Weather resistant. Bright red lettering provides high visibility. Sign has fourmounting holes. Reflective sign is available for docks open at dawn and dusk. Signs and VinylSticker measure 11¾"W x 9¾"H.MODELNUMBERNET WT.(LBS.)LIST PRICEEACHDESCRIPTIONOH-15 #2 DOUBLE LOOP COIL CHAIN (.091" THICK) WITH HANGER 4 $13.98OH-15R #2 CHAIN & HANGER, 15 FOOT LONG WITH REFLECTOR 4 15.00OH-HD HD PROOF COIL CHAIN ( 3 /16" THICK) 15' LONG W/HANGER 6 40.40SA-1012 ALUMINUM ENAMEL WHEEL CHOCK SIGN 1 $19.00SF-1012 REFLECTIVE ALUMINUM ENAMEL WHEEL CHOCK SIGN 1 35.00SV-1012 VINYL WHEEL CHOCK STICKER 1 9.00DC-25/UPS/FC-100Steel Rail ChocksRail Chocks fit most standard size rails. Double sided flanges keep chocks on track. Hardenedsteel spurs, located on the bottom side of the chock, are used to maximize a positive grip.Handle projection 36" on flag chocks, 10" on non-flag chocks. Handle height is 14". Theadjustable support legs are used to balance the Flag Rail Chocks. The Aluminum "Chock YourWheels" sign is visible from both sides. Chain length is 30" on combo units. Steel construction.MODELNUMBERNET WT.(LBS.)LIST PRICEEACHDESCRIPTIONFRC-2 FLAG RAIL CHOCK W/ADJUSTABLE HEIGHT LEG 10 $81.00SRC-1 SINGLE RAIL CHOCK 8 51.00SRC/FRC SINGLE RAIL CHOCK / FLAG RAIL CHOCK COMBO 18 127.00SRC/SRC SINGLE RAIL CHOCK / SINGLE RAIL CHOCK COMBO 16 100.00DC-25/UPS/FC-50Industrial Rubber WedgesExcellent for safety when stacking cylindrical objects. These extruded rubber wedges offer severaladvantages over wooden blocks or other forms of wedges: its resilience avoids creasing or wrinklingpaper as well as scratching or marring surfaces; it increases its grip as weight is increased.MODELNUMBER WIDTH LENGTH HEIGHTNET WEIGHT(POUNDS)LIST PRICEEACHRBW-2 6½" 4" 3¼" 2 $7.00RBW-3 6½" 6" 2¾" 3 10.50RBW-5 6½" 12" 3¼" 5 18.00RBW-10 6½" 24" 3¼" 10 39.90DC-25/UPS/FC-55Trailer JacksThe trailer jack adjustable lift range provides easy hitching and unhitching of a loaded trailer.Use for a wide variety of lifting, leveling and adjustment applications. Ideal for industrial,utility, construction or agricultural equipment trailers. Heavy-duty construction. Availablewith a side or top crank position. Mounting bracket attaches in a variety of ways in order tomeet your application needs. Scissor jacks provide stability and leveling to unattached trailersand equipment.CHAIN & HANGERmodel OH-15-HDSRC/SRCSRC/FRCLWFRC-2WARNING SIGNmodel SA-1012SRC-1ABCLOADING DOCK EQUIPMENTMODELNUMBERCRANKPOSITIONUNIFORMCAPACITYLIFTRANGENET WT.(LBS.)LIST PRICEEACHTYPEMOUNTA TJ-06 SIDE SWIVEL/WHEEL SIDE 1,000 10" 21 $33.00B TJ-F3 TUBE RING TOP 2,000 15" 20 $41.00C TJ-F1 TUBE RING TOP 1,000 10" 25 36.00D TJ-F2 FLANGE TOP 1,000 10" 27 $29.00E TJ-F4 FLANGE TOP 2,000 15" 21 38.00F TJ-AF A-FRAME TOP 2,000 10" 19 $28.00G FJ-K1 A-FRAME SIDE 1,000 15" 22 29.00H FJ-K2 A-FRAME SIDE 2,000 15" 19 41.00-- CT-02 CRANK JACK TOP 2,000 14" 9 $26.00-- CT-05 CRANK JACK TOP 5,000 14" 12 29.00I NJ-BP NOSE JACK BASE PAD -- -- 2 9.00J NJ-CR NOSE JACK CASTER -- -- 3 17.00K SJ-7523 SCISSOR JACK 7,500 23" 15 $33.00K SJ-7529 SCISSOR JACK 7,500 29" 19 34.00DC-25/UPS/FC-65D & EFG & Hwww.vestil.com Phone (800) 348-0868IJK
38NewNewMechanical Screw JacksAcme thread post supports load. No seals to leak. Will not drift down even after an extendedperiod of time.MODELNUMBERUNIFORMCAPACITY (TONS)LOWEREDHEIGHTRAISEDHEIGHTTRAVEL(INCHES)NET WT.(LBS.)LIST PRICEEACHMSJ-3 3 8¾" 13" 4¼" 12 $51.00MSJ-5 5 9¾" 15" 5¼" 18 60.00MSJ-10 10 11" 17" 6" 24 72.00MSJ-20 20 12¾" 20" 7¼" 32 112.00DC-25/UPS/FC-65Mechanical Machinery JacksMechanical Machinery Jacks are good for repairing vehicles, lifting trucks, railway maintenance,construction, mining, and agriculture. Compact design with collapsible lever offers easyoperation and simple maintenance. A self locking, anti-kickback operating lever reducesinjuries. Standard features include: folding handle, two carrying handles and a large base plate.Lifting and lowering speed is controllable. No seals to leak. Will not drift down even after anextended period of time.LOADING DOCK EQUIPMENTNewNewMODELNUMBERUNIFORMCAPACITY (TONS)LOWEREDHEIGHTRAISEDHEIGHTTRAVEL(INCHES)FORCE REQUIREDTO LIFT MAX. LOADNET WT.(LBS.)LIST PRICEEACHMMJ-3 1.5 23 5 /8" 35 7 /16" 11 13 /16" 63 lbs. 33 $115.00MMJ-6 3 29" 42 15 /16" 14" 79 lbs. 46 159.00MMJ-10 5 28¾" 42 5 /16" 13 9 /16" 90 lbs. 64 203.00DC-25/UPS/FC-65Heavy Duty Farm JacksDesigned to lift, pull, push and move heavy machinery and heavy objects. Ideal for liftingtractor and 4-wheel drive vehicles, tensioning wire fences and pulling/pushing or removingposts, poles, tree stumps, etc. Hydraulic free, full lever mechanical operation. Solid cast ironconstruction. Heavy duty 33" ratchet operating lever provides maximum leverage.MODELNUMBERUNIFORMCAPACITY (TONS)LOWEREDHEIGHTRAISEDHEIGHTTRAVEL(INCHES)NET WT.(LBS.)LIST PRICEEACHHDFJ-48 3.5 6" 42" 36" 31 $63.30HDFJ-60 3.5 6" 53" 47" 32 72.60DC-25/UPS/FC-65Economy Trailer King Pin LockTrailer King Pin lock provides security for trailers and RV's. Lock slides onto a trailer's kingpin to prevent a thief from pulling up, hitching, and driving off with your trailer. No toolsare required, just slide the king pin lock into place and turn the key. Units are powder coatedyellow and come with two keys, keyed alike.MODELNUMBER DESCRIPTION HEIGHTINSIDEDIAMETERNET WT.(LBS.)LIST PRICEEACHE-TKPL KING PIN LOCK 3" 3" 2 $29.90DC-20/UPSNewSESC-B SESC-F7 SESC-L11SESC-PPhone (800) 348-0868Security SealsSeal trailers, gates, hatches and doors with these general purpose security seals. Reveals theslightest tampering attempts. Two colors and four styles to choose from. Polypropyleneconstruction. Sold only in packages of 100.MODELNUMBERSTAMPEDMARKINGSLENGTHSEQUENTIALLYNUMBEREDNET WT.(LBS.)LIST PRICEPER PKG.SECS-B9-BL SEALED - DO NOT REMOVE 13.4" NO 0.9 $20.00SECS-B9-RD SEALED - DO NOT REMOVE 13.4" NO 0.9 20.00SECS-F7-BL SEALED 8.3" YES 0.8 $37.30SECS-F7-RD SEALED 8.3" YES 0.8 37.30SECS-L11-BL SEALED 11.7" YES 1.2 $67.80SECS-L11-RD SEALED 11.7" YES 1.2 67.80SECS-P-BL SEALED -- YES 0.9 $52.30SECS-P-RD SEALED -- YES 0.9 52.30DC-35/UPSwww.vestil.com
39Trailer Stabilizing JacksJacks are used to prevent up-endingsemi-trailers when they are not connectedto a tractor during loading and unloadingoperations. Also used to level trailersparked on sloped ground and to preventlanding gear from sinking into a softsurface. High strength steel construction.Flush-type zerk fitting for lubricatingACME screw. Meets OSHA regulationswhen used with wheel chocks. Powdercoat safety yellow finish. Includesreflective collar for visibility at night.ABCDEDVD or VIDEOAVAILABLEmodel SJS-1012MODELUNIFORM STATIC UNIFORM LIFTINGSERVICEWHEELNET WT. LIST PRICETYPE NUMBERDESCRIPTION CAPACITY (LBS) CAPACITY (LBS) RANGESIZE & TYPE (LBS.) EACHA BFSJ-2748 BIG FOOT JACK 100,000 40,000 39½" to 51" 10" hard rubber 125 $386.00B LO-J-BEAM RATCHET BEAM 100,000 40,000 39½" to 51" 10" x 2" hard rubber 160 403.00C SP-TOP-BEAM RATCHET BEAM 100,000 40,000 39½" to 51" 10" x 2" hard rubber 160 403.00D H-LO-J-BEAM HYDRAULIC BEAM 100,000 40,000 41" to 47" 10" x 2" hard rubber 228 429.00E CJ-BEAM-SN HAND CRANK 100,000 50,000 41" to 55" 16" solid foam 210 703.00E CJ-BEAM-PN HAND CRANK 100,000 50,000 41" to 55" 16" fully pneumatic 210 668.00F LO-J RATCHET 100,000 40,000 39" to 51" 10" hard rubber 110 $272.00G HI-J RATCHET 100,000 40,000 45" to 57" 10" hard rubber 115 281.00H SP-TOP SPIN TOP 100,000 40,000 39½" to 51" 10" hard rubber 110 241.00I SP-TOP-R RATCHET 100,000 40,000 41" to 50" 10" hard rubber 115 272.00J SJ-35 ECONOMY (rounded base) 50,000 5,000 44" to 51" N/A 45/UPS $105.00J SJ-40 ECONOMY (flat base) 50,000 5,000 44" to 51" N/A 45/UPS 113.00K SJ-35-2H ECONOMY 50,000 5,000 44" to 51" N/A 45/UPS 105.00L SJ-35-EF ECONOMY 50,000 5,000 41" to 57½" 8" hard rubber 60 163.00DC-25/UPS/FC-70TRAILER STABILIZING JACK OPTIONSMODELNUMBERNET WT.(LBS.)LIST PRICEEACHDESCRIPTIONJACK-100 50,000 POUNDS LIFTING CAPACITY (NOT AVAILABLE ON SJ series) 18 $52.00SJS-1012 ALUMINUM STABILIZING JACK TRAILER INSTRUCTION SIGN 1 20.00SAJ-1012 ALUMINUM DRIVERS BEWARE INSTRUCTION SIGN 1 20.00DC-25MODELNUMBERmodel SAJ-1012Extruded BumpersFGHIJKLProtect against the heavy impact and damaging results of semi-trailers and trucks with these Extruded FenderBumpers. Made of all weather and abrasion resistant rubber. The half-oval shape allows for effective fenderingaction over a wide radius. A metal plate is located inside 4" and 6" projection bumpers for support while the 2"unit comes with one washer per hole (this does not include the 120" long models). Custom lengths available up to10 feet. Installation hardware not included. Installation hardware available separately, see page 41.NET WT.(LBS.)LIST PRICEEACHTYPEDESCRIPTIONA M-2-12 12"L x 2"W x 1¾"H EXTRUDED BUMPER 2 $11.00A M-2-18 18"L x 2"W x 1¾"H EXTRUDED BUMPER 4 13.00A M-2-24 24"L x 2"W x 1¾"H EXTRUDED BUMPER 6 16.00A M-2-36 36"L x 2"W x 1¾"H EXTRUDED BUMPER 8 20.00A M-2-120* 120"L x 2"W x 1¾"H EXTRUDED BUMPER (NO HOLES) 20 60.00B M-4-12 12"L x 4¼"W x 4"H EXTRUDED BUMPER 6 $17.00B M-4-18 18"L x 4¼"W x 4"H EXTRUDED BUMPER 12 23.00B M-4-24 24"L x 4¼"W x 4"H EXTRUDED BUMPER 16 29.00B M-4-36 36"L x 4¼"W x 4"H EXTRUDED BUMPER 24 44.00B M-4-120* 120"L x 4¼"W x 4"H EXTRUDED BUMPER (NO HOLES) 60 140.00C M-6-12 12"L x 6"W x 6"H EXTRUDED BUMPER 11 $34.00C M-6-18 18"L x 6"W x 6"H EXTRUDED BUMPER 16 48.00C M-6-24 24"L x 6"W x 6"H EXTRUDED BUMPER 20 60.00C M-6-36 36"L x 6"W x 6"H EXTRUDED BUMPER 31 87.00C M-6-120* 120"L x 6"W x 6"H EXTRUDED BUMPER (NO HOLES) 110 250.00*FOR 120" BUMPERS ADD $30.00 SKID CHARGE FOR ORDERS UNDER 5 UNITSDC-25/UPS/FC-55• 3/8" MOUNTING HOLES• 5/8" ACCESS HOLE FORFASTENERSTYPE A • M-2-SERIES• 5/8" MOUNTING HOLES• 1-1/4" ACCESS HOLEFOR FASTENERSTYPE B • M-4-SERIES• 5/8" MOUNTING HOLES• 1-1/4" ACCESS HOLEFOR FASTENERSTYPE C • M-6-SERIESwww.vestil.com Phone (800) 348-0868LOADING DOCK EQUIPMENT
40HORIZONTAL BUMPERTYPE AVERTICAL BUMPERTYPE BvestilgreenANGLE FLAT BUMPERTYPE CLaminated Dock BumpersLaminated style dock bumpers provide durable, economicalprotection for your loading dock and trailers. Units are constructedof fabric reinforced rubber from recycled truck tires. Pads arelaminated between painted structural angles and held together with¾" steel tie rods. Installation is quick and easy by bolting or weldingunits to the dock. Width is bolt hole center to bolt hole center. Boltholes are 13 /16" in diameter. Installation hardware available separately,see page 41.LOADING DOCK EQUIPMENT4.5" PROJECTION LAMINATED DOCK BUMPERSTYPEMODELNUMBERDIMENSIONS(H x W x P)SHIPSVIANET WT.(LBS.)LIST PRICEEACHA 1012-4.5 10" x 12" x 4½" UPS 29 $38.00A 1014-4.5 10" x 14" x 4½" UPS 32 40.00A 1018-4.5 10" x 18" x 4½" UPS 36 46.00A 1024-4.5 10" x 24" x 4½" UPS 47 55.00A 1030-4.5 10" x 30" x 4½" UPS 60 $61.00A 1036-4.5 10" x 36" x 4½" UPS 72 68.00A 1096-4.5* 10" x 96" x 4½" TRUCK 216 256.00A 1212-4.5 12" x 12" x 4½" UPS 30 $39.00A 1214-4.5 12" x 14" x 4½" UPS 35 41.00A 1218-4.5 12" x 18" x 4½" UPS 42 50.00A 1224-4.5 12" x 24" x 4½" UPS 57 62.00A 1230-4.5 12" x 30" x 4½" UPS 66 $70.00A 1236-4.5 12" x 36" x 4½" UPS 85 86.00A 1296-4.5* 12" x 96" x 4½" TRUCK 333 298.00A 624-4.5 6" x 24" x 4½" UPS 32 $46.00A 636-4.5 6" x 36" x 4½" UPS 45 57.00C 1014-4.5F 10" x 14" x 4½" UPS 32 $55.00C 1214-4.5F 12" x 14" x 4½" UPS 36 56.00B V-1120-4.5 20" x 11" x 4½" UPS 48 $53.00B V-1124-4.5 24" x 11" x 4½" UPS 57 60.00B V-1130-4.5* 30" x 11" x 4½" TRUCK 72 79.00B V-1136-4.5* 36" x 11" x 4½" TRUCK 86 91.00*DIMENSIONS REFLECT RUBBER PORTION ONLYDC-25/UPS/FC-55TYPE ATYPE BTYPE C6" PROJECTION LAMINATED DOCK BUMPERSTYPEMODELNUMBERDIMENSIONS(H x W x P)SHIPSVIANET WT.(LBS.)LIST PRICEEACHA 1012-6 10" x 12" x 6" UPS 32 $47.00A 1014-6 10" x 14" x 6" UPS 35 49.00A 1018-6 10" x 18" x 6" UPS 40 62.00A 1024-6 10" x 24" x 6" UPS 62 $68.00A 1030-6 10" x 30" x 6" UPS 73 75.00A 1036-6 10" x 36" x 6" UPS 84 92.00A 1212-6 12" x 12" x 6" UPS 36 $50.00A 1214-6 12" x 14" x 6" UPS 46 53.00A 1218-6 12" x 18" x 6" UPS 55 66.00A 1224-6 12" x 24" x 6" UPS 66 75.00A 1230-6 12" x 30" x 6" UPS 87 $91.00A 1236-6 12" x 36" x 6" TRUCK 105 111.00A 1296-6* 12" x 96" x 6" TRUCK 280 437.00B V-1120-6 20" x 11" x 6" TRUCK 68 $77.00B V-1124-6 24" x 11" x 6" TRUCK 96 85.00B V-1130-6* 30" x 11" x 6" TRUCK 105 132.00B V-1136-6* 36" x 11" x 6" TRUCK 127 137.00*DIMENSIONS REFLECT RUBBER PORTION ONLYSpecialty Molded Dock BumpersDC-25/UPS/FC-55Manufactured from fiber reinforced prime rubber containing nylonand polyester. These molded bumpers are built to endure years ofabusive pounding. All units have pre-drilled countersunk mountingholes for easy installation. Units are drilled to accept ¾" anchorbolts. Plastic face bumper, model B-1213-4PF, features two piececonstruction fully assembled and ready for installation. Installationhardware available separately, see page 41.TYPE DTYPE FPhone (800) 348-0868TYPE ETYPE GNewMODELNUMBERNET WT.(LBS.)LIST PRICEEACHTYPEDESCRIPTIONA B-1224-3 24"W x 12"H x 3"P - RECTANGULAR SHAPED BUMPER 33 $38.20A B-1224-6 24"W x 12"H x 6"P - RECTANGULAR SHAPED BUMPER 55 81.20B T-22 22"W x 22"H x 3"P - T-SHAPED MOLDED BUMPER 43 46.00C B-1213-4 12"W x 13"H x 4"P - MOLDED BUMPER 24 $44.70D B-1213-4PF 12"W x 13"H x 4"P - PLASTIC FACE MOLDED BUMPER 24 111.40D RF REPLACEMENT FACE (FOR B-1213-4PF ONLY) 1 59.00E L-1818-4 18"W x 18"H x 4"P - L-SHAPED MOLDED BUMPER 36 $50.80F B-516 16"W x 5"H x 2"P - RECTANGULAR SHAPED BUMPER 7 23.00G B-818 18"W x 8"H x 2"P - RECTANGULAR SHAPED BUMPER 14 35.30--- B-516-SF 5"W x 16"H x 2"P - STEEL FACED MOLDED BUMPER 24 $48.10--- B-818-SF 8"W x 18"H x 2"P - STEEL FACED MOLDED BUMPER 44 57.00DC-25/UPS/FC-55Rounded Dome BumpersGreat for use under equipment for protecting surfaces. Isolate equipment from impact and vibration.Non-marking polyurethane rubber material. Pressure sensitive adhesive backing to peel and stick.MODELNUMBER DIAMETER HEIGHTPACKAGEQUANTITYNET WT.(PER PKG. POUNDS)LIST PRICEPER PKG.RDB-075 ¾" 3/8" 50 12 $59.00RDB-125 1¼" 5/8" 25 14 81.00RDB-200 2" 1" 15 15 98.00RDB-250 2" 1¼" 10 14 99.00DC-25/UPS/FC-60www.vestil.com
43POWER AND CONTROL OPTIONSMODELNUMBERLIST PRICEEACHDESCRIPTIONVCC-12VDC VOLTAGE CHANGE FROM DEFAULT TO 12V DC (BATTERY) POWERED $78.00VCC-115-1 VOLTAGE CHANGE FROM DEFAULT TO 115V 1-PHASE AC POWER 78.00VCC-208/230-1 VOLTAGE CHANGE FROM DEFAULT TO 208-230V 1-PHASE AC POWER 78.00VCC-208/230-3 VOLTAGE CHANGE FROM DEFAULT TO 208-230V 3-PHASE AC POWER 78.00VCC-460-3 VOLTAGE CHANGE TO 460V 3-PHASE AC POWER 78.00FC-2 L&T; & DA; SINGLE TWIN FOOT SWITCH INSTEAD OF 2-BUTTON CONTROL $108.00FC-4 L&T; DUAL TWIN FOOT SWITCH INSTEAD OF 4-BUTTON CONTROL 194.00ADDL-HH2PB LHL & DA; ADDITIONAL HANDHELD 2-BUTTON CONTROL ASSEMBLY ON 8' CORD $145.00ADDL-FC-2 LHL & DA; ADDITIONAL SINGLE TWIN FOOT SWITCH ON 8' CORD 220.00N4-WM2PB LHL & DA; WALL-MOUNT NEMA 4/12 2-BUTTON CONTROL ON 8' CORD $230.00N4-WM4PB L&T; WALL-MOUNT NEMA 4/12 4-BUTTON CONTROL ON 8' CORD 307.00N4-WM2PB-KSCL LHL, DA & L&T; WALL-MOUNT NEMA 4/12 PUSH-BUTTON CONTROL WITH KEY SWITCH 284.00ADDL-RALS LHL; ONE ADDITIONAL ROLLER-ARM LIMIT SWITCH $178.00RRC-2PB LHL & DA; 2-BUTTON RADIO REMOTE CONTROL $704.00RRC-4PB L&T; 4-BUTTON RADIO REMOTE CONTROL 704.00BEEPER LHL; WARNING BEEPER, BOTH DIRECTIONS $143.00STROBE LHL; WARNING STROBE, BOTH DIRECTIONS 243.00BCI BATTERY CHARGE INDICATOR 82.00KSCL-WM KEY SWITCH CONTROL LOCKOUT ONLY; IN A WALL-MOUNTED BOX 205.00IOH-230V IMMERSION OIL HEATER (3HP & 6.5HP POWER UNITS ONLY) $346.00IOH-460V IMMERSION OIL HEATER (6.5HP POWER UNITS ONLY) 523.00INDEX1-PHOTO LHL; INDEXING CONTROL USING A PHOTOSWITCH, ONE DIRECTION $890.00INDEX2-PHOTO LHL; INDEXING CONTROL USING A PHOTOSWITCH, BOTH DIRECTIONS 1,070.00ZLVS "ZERO-LEAK" VALVE SYSTEM $195.00HYDRAULIC OPTIONSMODELNUMBERLIST PRICEEACHDESCRIPTIONSTDHF-SM STANDARD ANTI-WEAR HYDRAULIC OIL, PER GALLON $13.00CWHF-SM COLD-WEATHER OIL, PER GALLON 79.00FGHF-SM FOOD-GRADE OIL, PER GALLON 24.00FRHF-SM FIRE-RESISTANT OIL, PER GALLON 16.00HPH-SM-(length in feet) HYDRAULIC HOSE, PRESSURE, SMALL 4.30/FT.HPH-LG-(length in feet) HYDRAULIC HOSE, PRESSURE, LARGE 6.80/FT.SPECIAL LOCATION CONTROL OPTION PACKAGESMODELNUMBERLIST PRICEEACHDESCRIPTIONWD-WM2PB LHL; WASHDOWN POWER & CONTROL PACKAGE FOR AC OR DC $640.00WD-FC-2 LHL; WASHDOWN POWER & CONTROL PACKAGE FOR AC OR DC, WITH TWIN FOOT SWITCH 705.00WD-WM4PB L&T; WASHDOWN POWER & CONTROL PACKAGE, FULL-SIZE 845.00WD-FC-4 L&T; WASHDOWN POWER & CONTROL PACKAGE, FULL-SIZE, WITH DUAL TWIN FOOT SWITCH 910.00EX-WMPB LHL; CLASSIFIED LOCATIONS POWER & CONTROL PACKAGE$4,230.00(OPTION MUST BE PRE-APPROVED BY ENGINEERING FOR APPLICATION)N12 LHL; NEMA 4/12 ENCLOSURES, FULL-SIZE 423.00POWER UNIT OPTIONSMODELNUMBEROPTIONS FOR ELECTRIC HYDRAULIC EQUIPMENTAvailable at the time of sale for most of the powered products listed in the Ergonomic Solutions section. Consult the factory for details.For the acronyms LHL, DA, and L&T noted in the descriptions below:LHL indicats a "Lift-Hold-Lower" power and control scheme (ex: EHLT, HDD, EM1-200)DA denotes a "double-acting" power and control scheme (ex: EM1-500, TL-100-F, HBD-6)L&T denotes a power and control scheme in which the platform, chute, etc. will both lift & tilt (ex: EHLTT, ZLTT, HLD)LIST PRICEEACHDESCRIPTIONROTARY-LHL-HHPB LHL; ROTARY AIR/OIL, HANDHELD PUSH-BUTTON (REQUIRES FILTER & LUBRICATOR) $672.00ROTARY-DA-HHPB DA; ROTARY AIR/OIL, HANDHELD PUSH-BUTTON (REQUIRES FILTER & LUBRICATOR) 746.00ROTARY-LT-WMPB L&T; ROTARY AIR/OIL, WALL-MOUNT PUSH-BUTTON (REQUIRES FILTER & LUBRICATOR) 1,387.00RECIPR-LHL RECIPROCATING AIR/OIL, NON-CART -$150.00RECIPR-CART RECIPROCATING AIR/OIL, CARTS 407.00FLR-¼ (HAS ¼" NPT HAS PORTS) FOR USE WITH OUR RECIPROCATING AIR/OIL POWER UNIT $125.00FLR-½ (HAS ½" NPT HAS PORTS) FOR USE WITH ROTARY AIR/OIL POWER UNIT 125.00MOTOR-575V-2HP 575/660V MOTOR & TRANSFORMER FOR 2HP UNIT $415.00MOTOR-575V-6.5HP 575/600V MOTOR & TRANSFORMER FOR A WL-100 OR HDC-900 481.00MOTOR-50HZ-2HP 50HZ MOTOR FOR A SINGLE-PHASE 3/4HP OR 2HP APPLICATION 376.00MOTOR-50HZ-3HP 50HZ MOTOR FOR A SINGLE-PHASE 3HP APPLICATION 583.00RPUA-OPTION REMOTELY-LOCATABLE POWER UNIT ASSEMBLY, 2HP OR LESS $150.00PLUG-AC-(plug's rated amp) PLUG INSTALLED ON POWER CORD (SPECIFY NEMA PLUG NUMBER) 165.00www.vestil.com Phone (800) 348-0868DC-20ERGONOMIC SOLUTIONS
44MECHANICAL OPTIONS FOR ELECTRIC HYDRAULIC SCISSOR LIFT TABLESMODELNUMBERDESCRIPTIONLIST PRICEEACHPMHR-REM-NRBC REMOVABLE 42"H HANDRAIL, 21" MIDRAIL, & NON-REMOVABLE TOE-BOARD $400.00 MINIMUM $28.00 per ft.PMHR-NREM-NRTB NON-REMOVABLE 42"H HANDRAIL, 21" MIDRAIL, & TOE-BOARD $345.00 MINIMUM 22.00 per ft.PMHR-SLG-(width) 42"H SELF-LOCKING GATE UP TO 6 FEET WIDE 182.00PMHR-LCG-(width) LINK CHAIN CLOSURE GATE WITH SNAP HOOK ENDS FOR MAX. 6 FEET OPENING 92.00PLATE-TRDPL 4-WAY ANTI-SKID STEEL TREAD PLATE DECK/PLATFORM 344.00PORTABLE-SEMI MANUAL SEMI-PORTABILITY OPTION (INCLUDES TWO RIGID WHEELS WITH A TWO WHEEL DOLLY JACK) 377.00PORTABLE-FULL MANUAL FULL-PORTABILITY OPTION FOR 1,000 TO 3,000 LBS. CAPACITY UNITS UP TO848.0090" LONG, INCLUDES TWO RIGID & TWO SWIVEL CASTERS, A NON-REMOVABLE PUSHHANDLE, REINFORCED FRAME, AND FOOT OPERATED FLOOR LOCK.PM-12BRIDGE-S 12"L SPLIT STEEL HINGED BRIDGE WITH RUNOFF GUARDS AND LIFTING CHAINS (72" WIDE) $377.00PM-12BRIDGE-A 12"L SPLIT ALUMINUM HINGED BRIDGE WITH RUNOFF GUARDS AND LIFTING CHAINS (72" WIDE) 730.00PM-18BRIDGE-S 18"L SPLIT STEEL HINGED BRIDGE WITH RUNOFF GUARDS AND LIFTING CHAINS (72" WIDE) 415.00PM-18BRIDGE-A 18"L SPLIT ALUMINUM HINGED BRIDGE WITH RUNOFF GUARDS AND LIFTING CHAINS (72" WIDE) 820.00HICYCLE-EHLT HIGH CYCLE BEARING PACKAGE, EHLT $3,156.00EHLT-POWCAR POWERED CAROUSEL (FULL-SIZE SCISSOR TABLES ONLY) 3,465.00PLATF-MTG-CA FOR MOUNTING CA-SERIES CAROUSEL TO PLATFORM (DOES NOT INCLUDE CAROUSEL) $95.00DC-20ERGONOMIC SOLUTIONSW3" 3"OUTSIDE MOUNTING(STANDARD)NewNFPA 701 FIRE RATEDPhone (800) 348-0868DHALUMINUM EXTRUSIONCHAIN ACCORDION SKIRTINGDVD or VIDEOAVAILABLELEXISTINGPLATFORMSELF-TAPPINGSCREWSACCORDIONSKIRT WITHSEWN IN ROPEAccordion SkirtingAccordion Skirts have a functional purpose as well as a safety purpose. Skirts comply withthe OSHA pinch point specifications. The functional advantage is minimizing dirt anddebris accumulation under the platform. Dirt can contaminate electrical and hydrauliccomponents. Life expectancy of both can be substantially reduced by this contamination.Debris such as raw materials, boards, or pallets can restrict the scissor or table movement.Accordion skirts serve to keep debris from damaging the operating mechanism, hydrauliccomponents, or electrical parts. Safety is enhanced by keeping arms, legs, fingers, and toesout from under the table. Skirts meet NFPA 701 code. Standard electric toe-guards arenot included when scissor table is fitted with accordion skirt option.TABLE SPECIFICATIONS:1) TABLE WIDTH, W = ________________________"2) TABLE LENGTH, L = _______________________"3) TABLE RAISED HEIGHT, H = _________________"4) TABLE LOWERED HEIGHT, D = ______________"CALCULATION FORMULA: (3" convolutions)All Dimensions are in InchesW = Width of Platform L = Length of Platform H = Raised HeightFABRIC ACCORDION SKIRTINGCUSTOMER INSTALLED, model SKIRT-ACC-CUST, (including hardware) ...........$10.00/SQ. FT.FABRIC ACCORDION SKIRTINGFACTORY INSTALLED , model SKIRT-ACC-FACT, (includes extra packaging).........$15.00/SQ. FT.CHAIN ACCORDION SKIRTINGCUSTOMER INSTALLED , model SKIRT-CHN-CUST, (including hardware) .........$32.00/SQ. FT.CHAIN ACCORDION SKIRTINGFACTORY INSTALLED , model SKIRT-CHN-FACT, (includes extra packaging) ........$37.00/SQ. FT.FORMULA:(W" + W" + L" + L") x H" ÷ 144 = Square FeetSquare Feet x $ (customer installed) or $ (factory installed) = List PriceWEIGHT:0.5 lbs./ft²REPAIR KIT FOR ACCORDION SKIRTINGmodel SKIRT-REPAIR ...........................................................................................$37.00 LISTVelcro Mount, Rigid PVC and Roller Curtains Also Available - Contact FactoryDC-20/FC-70www.vestil.com
45Electric Hydraulic Scissor Lift Tables460V 3-PHASE STD, OPTIONS ON PG. 43Full featured electric hydraulic scissor lift tables are used by all types of manufacturing and warehousefacilities. Safety features include: electric toe guard to protect pinch points during lowering of the table,internal brass velocity fuse to maintain platform height in event of hose or fitting failure, 24V AC pushbuttonhand control, maintenance prop, and upper travel limit switch to stop table at maximum height.2HP, 460V, 3 phase, 60 Hz totally enclosed motor standard, other voltages available. 3000 psi hydrauliccomponent rating.QUICKSHIP (460V 3 PHASE STANDARD)MODEL PLATFORM SIZENUMBER(W x L)LOWEREDHEIGHTRAISEDHEIGHT*CAPACITY(POUNDS)VOLTAGEPHASENET WT.(POUNDS)LIST PRICEEACHEHLT-2448-3-43 24" x 48" 7" 43" 3,000 460/3 700 $2,593.00EHLT-3060-3-43 30" x 60" 7" 43" 3,000 460/3 725 2,593.00EHLT-4048-3-43 40" x 48" 7" 43" 3,000 460/3 800 2,593.00EHLT-4848-3-43 48" x 48" 7" 43" 3,000 460/3 825 2,593.00EHLT-4872-3-43 48" x 72" 7" 43" 3,000 460/3 975 2,887.00EHLT-2448-4-43 24" x 48" 7" 43" 4,000 460/3 775 $3,286.00EHLT-3060-4-43 30" x 60" 7" 43" 4,000 460/3 800 3,286.00EHLT-4048-4-43 40" x 48" 7" 43" 4,000 460/3 850 3,286.00EHLT-4848-4-43 48" x 48" 7" 43" 4,000 460/3 910 3,286.00EHLT-4872-4-43 48" x 72" 7" 43" 4,000 460/3 1005 3,572.00*UNIFORM STATIC CAPACITYVERTICALTRAVELModel Number Format: EHLT - (width)(length) - capacity - raised heightPLATFORMWIDTHPLATFORMLENGTHUNIFORMCAPACITYRAISEDHEIGHTLOWEREDHEIGHTTRAVEL (^)TIME (SEC)NET WT.(POUNDS)DC-20/FC-70NARROW SCISSOR LIFT TABLESMODELNUMBERPLATFORM SIZE(W x L)LOWEREDHEIGHTRAISEDHEIGHT* CAPACITY(POUNDS)VOLTAGEPHASENET WT.(POUNDS)LIST PRICEEACHEHLT-N-1648-1-32 16" x 48" 8" 32" 1,000 460/3 415 $2,365.00EHLT-N-1648-2-32 16" x 48" 8" 32" 2,000 460/3 440 2,537.00*UNIFORM STATIC CAPACITYDC-20/FC-70LIST PRICEEACH36" 24" - 48" 48" - 72" 1,000 43" 7" 7 945 $2,585.0036" 24" - 48" 48" - 72" 2,000 43" 7" 11 966 2,757.0036" 24" - 48" 48" - 72" 3,000 43" 7" 16 987 3,159.0036" 24" - 48" 48" - 72" 4,000 43" 7" 22 1008 $3488.0036" 36" - 48" 48" - 72" 5,000 44" 8" 32 1029 3,710.0036" 36" - 48" 48" - 72" 6,000 44" 8" 32 1050 4,152.0036" 36" - 48" 48" - 72" *8,000 44" 8" 15 1281 $6,355.0033" 40" - 60" 48" - 72" *10,000 43" 10" 15 1438 7,067.0033" 40" - 60" 48" - 72" *12,000 43" 10" 15 1596 7,605.0048" 24" - 48" 64" - 90" 1,000 55" 7" 11 1155 $3,625.0048" 24" - 48" 64" - 90" 2,000 55" 7" 16 1176 3,656.0048" 24" - 48" 64" - 90" 3,000 55" 7" 22 1197 3,925.0048" 36" - 48" 64" - 96" 4,000 56" 8" 32 1218 $4,074.0048" 36" - 48" 64" - 96" 5,000 56" 8" 32 1239 4,205.0048" 36" - 48" 64" - 96" 6,000 56" 8" 48 1260 4,420.0048" 36" - 48" 64" - 96" *8,000 56" 8" 15 1501 $7,889.0045" 40" - 60" 64" - 96" *10,000 55" 10" 15 1659 8,321.0045" 40" - 60" 64" - 96" *12,000 55" 10" 20 1816 8,876.0060" 24" - 48" 84" - 108" 1,000 67" 7" 16 1785 $4,886.0060" 24" - 48" 84" - 108" 2,000 67" 7" 14 1806 5,028.0060" 24" - 48" 84" - 108" 3,000 67" 7" 16 1827 5,293.0060" 48" - 72" 96" - 120" *4,000 68" 8" 26 1848 $6,103.0060" 48" - 72" 96" - 120" *5,000 68" 8" 26 1869 7,054.0060" 48" - 72" 96" - 120" *6,000 70" 10" 30 1890 7,585.0060" 62" - 72" 96" - 120" *8,000 70" 10" 30 2131 $8,931.0060" 62" - 72" 96" - 120" *10,000 72" 12" 30 2289 9,774.0060" 62" - 72" 96" - 120" *12,000 72" 12" 30 2446 10,224.0072" 24" - 48" 102" - 120" 1,000 79" 7" 12 2047 $5,836.0072" 24" - 48" 102" - 120" 2,000 79" 7" 16 2068 6,260.0071" 48" - 72" 120" - 144" *3,000 82" 11" 16 2089 6,857.0071" 48" - 72" 120" - 144" *4,000 82" 11" 26 2110 $6,912.0071" 48" - 72" 120" - 144" *5,000 82" 11" 26 2131 8,074.0070" 62" - 72" 120" - 144" *6,000 82" 12" 30 2152 8,865.0070" 62" - 72" 120" - 144" *8,000 82" 12" 30 2415 9,910.00(^) TRAVEL TIME BASED ON THREE-PHASE MOTORDC-20/FC-70*DENOTES 6.5 HP 208-230/460V 3 PHASE (EXTERNALLY MOUNTED)Contact Factory for SpecialDesign Requirements• Patented Pinch Point PerimeterGuards for OSHA Compliance• Fused 24 Volt Push ButtonControl on 8 ft. Cord• Adjustable Upper Travel 24VLimit Switch• Internal Brass Velocity Fuse• (2HP) 56 Frame Electric Motor• Pressure Plated Pump &Manifold System• Displacement StyleHydraulic Cylinder• State-of-the-Art LifetimeLubricated Bearings• Integral Maintenance Prop• Optional Foot Controlmodel FC-2, $108.00 ListmodelEHLT-N-1648-1-32STANDARD FEATURESLINE-X® spray on Polyurea/Polyurethanecoating available on most Scissor Tables.Contact factory for additional information.www.vestil.com Phone (800) 348-0868NewDVD or VIDEOAVAILABLEERGONOMIC SOLUTIONS
46Manual Built-In Carousel for Scissor TablesPosition pallets, boxes, or crates without ever stepping around the table. This sleek flushmounted carousel smoothly rotates 360°. Easy to use operation. Capacity is 4,000 lbs.Carousel adds 1" to scissor table service range. Carousel diameter is 45". Platform sizemust be 48" x 48" minimum. Scissor table not included. Option for new table purchaseonly. Available on EHLT, EHLTX, AHLT and EHLTD. Other size carousels available.MODELNUMBERLIST PRICEEACHDESCRIPTIONROTATE MANUAL BUILT-IN CAROUSEL FOR SCISSOR TABLE $1,151.00DC-20/FC-70INTEGRAL SCALEmodel SCALEIntegral Scale for Scissor Tables• Validate Number of Pieces or Parts• Know Exactly How Much Weight is on Your Table• No Holes or Bolting Required• Installs and Removes in Seconds• Expedite Your Shipping & Palletizing Process• Available in Any Size to Fit an Existing Table(Rests on Top of Table)• Adds approximately 3⅝" to Overall Height• Scale Functions: Zero Weight and Tare Weight• Weighing Units: Pounds or Kilograms• Scale Capacity: 5,000 lbs.• Mettler Toledo ScaleMODEL NUMBER DESCRIPTION WEIGHT (LBS.) LIST PRICE EACHSCALE INTEGRAL SCALE 286 $1,548.00DC-20/FC-70PROGRAMMABLE HEIGHTmodel PROGRAMProgrammable HeightEliminate unnecessary bending and "land control jogging" by presetting multiple workingheights at the touch of a button• Set height function: Programmable up to 4 preset heights• Incremental height adjustment for jogging lift at preset increments• Raise/lower push-button on the keypad• Fully integrated controller with LCD display• A 15-button keypad on the panel display• Powered by a 24V DC motor• Excellent for repeat repositioning applications• Hybrid technology linear sensor is used to control positions at any preset heightMODEL NUMBER DESCRIPTION LIST PRICE EACHPROGRAM PROGRAMMABLE HEIGHT $1,498.00DC-20/FC-70ERGONOMIC SOLUTIONSWIRELESS REMOTE CONTROLIS FACTORY INSTALLEDITEMS ON THIS PAGE ARE OPTIONS.SCISSOR TABLESOLD SEPARATELYPhone (800) 348-0868Wireless Remote ControlsPut the power in your hands with the Wireless Remote Control System, series RC-460. This lightweight, two-button, remote control gives you the freedom to controlyour scissor table from a range up to 150 feet (range can be adjusted for optimumsignal strength and can be reduced if required). Unit is also available in a four-buttonmodel for lift and tilt tables. The remote control measures 4" wide x 6" high x 2" thick.Approved to meet part 15 of the Federal Communications Code. Designed to preventcrosstalk and false triggering from stray radio frequency.MODELNUMBERDESCRIPTIONNET WT.(POUNDS)LIST PRICEEACHRRC-2PB 2-BUTTON CONTROL (LIFT-HOLD-LOWER CIRCUIT) 1 $704.00RRC-4PB 4-BUTTON CONTROL (LIFT AND TILT CIRCUIT) 1 704.00RETROFIT AVAILABLE - CONTACT FACTORYDC-20/FC-70www.vestil.com
47Heavy-Duty Air Bag Scissor Lift TablesAir Bag Scissor Lift Tables use factory air for clean, dependable, maintenance free operation.Designed to raise products up to an ergonomic working height. Safety features include pressurerelief valve and pinch point guard. Models ABLT-1000 and ABLT-2000 come standard with afoot control. Model ABLT-4000 comes standard with a hand control, although a foot control isavailable. Incoming air must be clean, dry, and regulated to 80 psi (min.). Requires ½" incomingairline. Standard features include adjustable upper travel limit valve, state-of-the-art lifetimelubricated bearings, and maintenance prop. Filter required. Other sizes available, contact factory.NewMODELNUMBERPLATFORMSIZE (W x L)UNIFORMCAPACITYRAISEDHEIGHTLOWEREDHEIGHTNET WT.(POUNDS)LIST PRICEEACHABLT-1000 48" x 32" 1,000 33" 9" 331 $2,490.00ABLT-2000 48" x 32" 2,000 33" 9" 585 2,580.00ABLT-4000 43"-60" x 49"-72" 4,000 36" 8" 942 4,626.00OPTIONAL FOOT CONTROL FOR ABLT-4000, FC-2P, $318.00 LISTDC-20/FC-70Custom FinishAvailableLow-Profile Air Bag Scissor Lift TablesWith the lowest collapsed height air lift table on the market, you can achieve a 4" lowered height.This low height allows for more material to be placed on the lift and still be in reach of theoperator. These units have pressure relief valves to prevent over inflation of the air bag, as well as acaptured scissor track to provide stability and safety while raising and lowering. Air requirementsare 60-120 psi, with a minimum 0.5" pipe or rubber hose. Various optional components (up/down foot control, safety skirt, and larger platforms) are available, contact factory.NewMODELNUMBERPLATFORMSIZE (W x L)UNIFORMCAPACITYRAISEDHEIGHTLOWEREDHEIGHTNET WT.(POUNDS)LIST PRICEEACHABLT-H-LP-1-29 36" x 47" 1,000 29" 4" 550 $3,635.00ABLT-H-LP-2-29 36" x 47" 2,000 29" 4" 560 3,748.00ABLT-H-LP-3-29 36" x 47" 3,000 29" 4" 570 3,861.00ABLT-H-LP-4-29 36" x 47" 4,000 29" 4" 580 3,975.00ABLT-H-LP-6-23 36" x 47" 6,000 23" 4" 590 4,313.00DC-20/FC-70Air Bag Scissor Lift TablesImprove ergonomics and productivity with our Air Bag Scissor Lift Tables. TheAir Bag Technology helps raise pallets, bins, and other materials to your desiredworking height. These units have pressure relief valves to prevent over inflationof the air bag, as well as a captured scissor track to provide stability and safetywhile raising and lowering. Air requirements are 80-100 psi @ 15 CFM's.Various lift options are offered, contact factory.series ABLT-HNewMODELNUMBERPLATFORMSIZE (W x L)UNIFORMCAPACITYRAISEDHEIGHTLOWEREDHEIGHTNET WT.(POUNDS)LIST PRICEEACHABLT-H-1-32 35 1 /5" x 43¾" 1,000 32" 7" 270 $2,275.00ABLT-H-2-32 35 1 /5" x 43¾" 2,000 32" 7" 280 2,375.00ABLT-H-3-32 35 1 /5" x 43¾" 3,000 32" 7" 290 2,500.00ABLT-H-4-32 35 1 /5" x 43¾" 4,000 32" 7" 360 3,385.00OPTIONAL BOLT-ON PLATFORMS FOR ABLT-H SERIES ONLYABLT-H-P-3648 36"W x 48"L x ¼"T PLATFORM for 1-3,000 lbs. ABLT-H 123 $385.00ABLT-H-P-4848 48"W x 48"L x ¼"T PLATFORM for 1-3,000 lbs. ABLT-H 245 475.00ABLT-H-P-4848-4K 48"W x 48"L x ½"T PLATFORM for 4,000 lbs. ABLT-H 327 565.00*UNIFORM STATIC CAPACITYDC-20/FC-70Air Bag Scissor Lift Table Options for series ABLT-H & ABLT-H-LPMODELNUMBERseries ABLT shownwith platform optionsNET WT.(POUNDS)ABLT-H-FCLIST PRICEEACHDESCRIPTIONABLT-H-RP-ND MANUAL ROTATE OPTION, NO DETENTS (to be used with ABLT-H-P-4848-4K) 80 $750.00ABLT-H-RP-SD MANUAL ROTATE OPTION, SPRING DETENTS (to be used with ABLT-H-P-4848-4K) 80 875.00ABLT-H-DK180 DETENT KIT 180°, CUSTOMER TO WELD ON, NO PLATE INCLUDED 1 85.00ABLT-H-DK90 DETENT KIT 90°, CUSTOMER TO WELD ON, NO PLATE INCLUDED 1 95.00ABLT-H-FP FORK POCKETS, BOLT-ON STYLE, ADDS 4" TO HEIGHT 80 350.00ABLT-H-FC OPTIONAL FOOT PEDAL CONTROL 20 $375.00DC-20/FC-70ERGONOMIC SOLUTIONSwww.vestil.com Phone (800) 348-0868
48ERGONOMIC SOLUTIONSCustom FinishAvailableDVD or VIDEOAVAILABLEPhone (800) 348-0868Rotary Air/Hydraulic Scissor Lift TablesUtilize the convenience of factory air to power this lift table. Simply connect to an 80 CFM & 80 PSI(minimum) air supply (minimum ¾" supply recommended) through a filter, regulator, lubricator andyou now have a lift table suitable for a wide range of applications and operating environments. Featurespneumatic upper travel limit switch, safety toe guards, cylinder with internal brass velocity fuse, two buttonhand control, and life-time lubricated sleeve bearings. For other sizes and capacities please contact factory.MODELNUMBERPLATFORMSIZE (W x L)LOWEREDHEIGHTRAISEDHEIGHTUNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHAHLT-2448-3-43 24" x 48" 7" 43" 3,000 990 $3,831.00AHLT-3060-3-43 30" x 60" 7" 43" 3,000 1040 3,831.00AHLT-4048-3-43 40" x 48" 7" 43" 3,000 1080 3,831.00AHLT-4848-3-43 48" x 48" 7" 43" 3,000 1130 3,831.00AHLT-4872-3-43 48" x 72" 7" 43" 3,000 1220 3,831.00CONTACT FACTORY FOR SPECIAL SIZES AND CONFIGURATIONSDC-20/FC-70Shorty Scissor Lift TablesBuilt with the same quality as all our lift tables, the EHLTS and EHLTSD maximize safety and durability.Designed to raise products up to an ergonomic working height. When tight spaces are what you have,consider a Shorty Scissor Table. Available in both a single and double leg styles these tables offer smallerdeck sizes customized to your space requirements. Design features includes full perimeter pinch point guardand emergency internal brass velocity fuse. External power unit and hand control is standard.Model Number Format: EHLTS - (width)(length) - capacity - raised heightSINGLE LEG SETVERTICAL PLATFORMTRAVEL WIDTHPLATFORMLENGTHUNIFORMCAPACITYRAISEDHEIGHTLOWEREDHEIGHTTRAVELTIME (SEC)NET WT.(POUNDS)LIST PRICEEACH24" 24" - 48" 36" - 48" 1,000 31" 7" 12 668 $2,784.0024" 24" - 48" 36" - 48" 2,000 31" 7" 12 691 3,193.0024" 24" - 48" 36" - 48" 3,000 31" 7" 12 730 3,945.0024" 24" - 48" 36" - 48" 4,000 31" 7" 23 721 $4,263.0023" 36" - 48" 36" - 48" 5,000 31" 8" 23 744 4,411.0023" 36" - 48" 36" - 48" 6,000 31" 8" 23 792 4,685.00TRAVEL TIME BASED ON 3 PHASE POWERDC-20/FC-70Model Number Format: EHLTSD - (width)(length) - capacity - raised heightDOUBLE LEG SETVERTICAL PLATFORMTRAVEL WIDTHPLATFORMLENGTHUNIFORMCAPACITYRAISEDHEIGHTLOWEREDHEIGHTTRAVELTIME (SEC)NET WT.(POUNDS)LIST PRICEEACH41" 34" - 48" 36" - 48" 1,000 51" 10" 16 882 $4,718.0041" 34" - 48" 36" - 48" 2,000 51" 10" 23 892 5,261.0041" 34" - 48" 36" - 48" 3,000 51" 10" 32 903 5,610.0041" 34" - 48" 36" - 48" 4,000 51" 10" 32 955 $5,966.0041" 34" - 48" 36" - 48" 5,000 51" 10" 48 966 6,175.00TRAVEL TIME BASED ON 3 PHASE POWERDC-20/FC-70Double Scissor Lift TablesAchieve the extra reach you're looking for with our Double Scissor Lift Tables. These full featured electrichydraulic double scissor lift tables are used by all types of manufacturing and warehouse facilities. Safetyfeatures include: electric toe guard to protect pinch points during lowering of the table, brass safety velocityfuse to maintain platform height in the event of a hose or fitting failure, 24V AC push-button handcontrol, maintenance prop, and upper travel limit switch to stop table at maximum height reducing motorwear. 2 HP, 3-phase, 60 Hz totally enclosed motor standard, other voltages available. 3000 psi hydrauliccomponent rating.Model Number Format: EHLTD - (width)(length) - capacity - raised heightVERTICALTRAVELPLATFORMWIDTHPLATFORMLENGTH460V 3-PHASE STD, OPTIONS ON PG. 43460V 3-PHASE STD, OPTIONS ON PG. 43UNIFORMCAPACITYRAISEDHEIGHTLOWEREDHEIGHTTRAVELTIME (SEC)NET WT.(POUNDS)LIST PRICEEACH60" 34" - 48" 48" - 72" 1,000 70" 10" 11 1470 $4,718.0060" 34" - 48" 48" - 72" 2,000 70" 10" 16 1575 5,261.0060" 34" - 48" 48" - 72" 3,000 70" 10" 22 1680 5,610.0060" 34" - 48" 48" - 72" 4,000 70" 10" 32 1890 5,966.0060" 34" - 48" 48" - 72" 5,000 70" 10" 34 1942 6,742.0072" 34" - 48" 64" - 88" 1,000 84" 12" 16 1576 $5,592.0072" 34" - 48" 64" - 88" 2,000 84" 12" 32 1680 6,018.0072" 34" - 48" 64" - 88" 3,000 84" 12" 48 1785 6,180.0072" 34" - 48" 64" - 88" 4,000 84" 12" 48 1968 6,685.0072" 34" - 48" 64" - 88" 5,000 84" 12" 48 2021 8,077.00TRAVEL TIME BASED ON 460V THREE-PHASE POWERDC-20/FC-70www.vestil.com
49Work Station Electric Hydraulic Scissor TablesPLATFORMSIZE (W x L)LOWEREDHEIGHTRAISEDHEIGHTUNIFORMCAPACITYTRAVELTIME460V 3-PHASE STD, OPTIONS ON PG. 43Designed to raise products up to an ergonomic working height. The EHLT-WS maximizes safety withminimum space requirements. Ideal for all types of manufacturing and warehouse facilities. External powerunit, which can be located up to 8' away from unit and hand control standard. Electric toeguards standard.NET WT.(LBS.)LIST PRICEEACHMODEL NUMBEREHLT-WS-2436-1.5-29 24" x 36" 8 5 /8" 31" 1,500 13 sec. 700 $1,781.00EHLT-WS-2448-1.5-36 24" x 48" 7" 36" 1,500 13 sec. 720 1,843.00EHLT-WS-3248-1.5-36 32" x 48" 7" 36" 1,500 13 sec. 750 1,874.00EHLT-WS-4048-1.5-36 40" x 48" 7" 36" 1,500 13 sec. 780 1,927.00TRAVEL TIME BASED ON 3 PHASE POWERDC-20/FC-70REMOTEPOWER UNITPortable Scissor Lift Tables12V DC STD, OPTIONS ON PG. 43Heavy-duty powered lift tables are designed to transport and elevate your heaviest loads. A heavy-duty12V DC power unit with deep cycle battery and an on-board battery charger is standard, a battery chargeindicator is optional. Features 8" glass filled nylon casters (2 swivel and 2 rigid), floor lock, and patentedelectric pinch point guards. Push buttons to raise and lower lift, located on power unit and in the pendantstyle push-button control, are standard. Key-operated ON/OFF control for better security is built into thepower unit. Minimum frame width is 34". Add 25" to platform length for the overall length.VERTICALTRAVELModel Number Format: PST - (width) (length) - capacity - raised heightPLATFORMWIDTHPLATFORMLENGTHUNIFORMCAPACITYRAISEDHEIGHTLOWEREDHEIGHTTRAVELTIME (SEC)NET WT.(POUNDS)LIST PRICEEACH36" 24" - 48" 48" - 72" 1,000 46" 10" 9 1408 $3,437.0036" 24" - 48" 48" - 72" 2,000 46" 10" 14 1437 3,504.0036" 24" - 48" 48" - 72" 3,000 46" 10" 20 1491 4,470.0036" 24" - 48" 48" - 72" 4,000 47" 12" 28 1720 5,090.0036" 36" - 48" 48" - 72" 5,000 47" 12" 31 1760 5,312.0048" 24" - 48" 64" - 90" 1,000 58" 10" 14 1496 $4,610.0048" 24" - 48" 64" - 90" 2,000 58" 10" 20 1580 4,670.0048" 24" - 48" 64" - 90" 3,000 58" 10" 28 1780 5,143.0048" 36" - 48" 64" - 90" 4,000 60" 12" 38 2050 5,675.0048" 36" - 48" 64" - 90" 5,000 60" 12" 38 2070 5,806.00PORTABLE SCISSOR TABLE OPTIONSMODELNUMBERNET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONPST-AC AC MOTOR -- N/CPST-AIR* FACTORY AIR/OIL (W/FOOT TREADLE CONTROL (FRL REQ'D)*) -- N/CPST-FP MANUAL FOOT PUMP OPTION -- N/CPST-PTDS POWER TRACTION DRIVE SYSTEM, 24V DC 156 4,348.00BC BENCH TOP STYLE BATTERY CHARGER 8 133.50BCI BATTERY CHARGE INDICATOR GAUGE 1 82.00*FILTER REGULATOR - LUBRICATOR REQUIRED TO OPERATE (WARRANTY VOID WITHOUT)DC-20/FC-70Power Traction Drive SystemReduce worker fatigue and injury with the Portable Traction Drive Option. This factory installed optionis available on portable equipment including the Portable Scissor Table, Pallet Master/Pallet Server, TiltMaster, and High Rise Lift Truck. An alternative to costly fork trucks, the PTDS includes a combinationthrottle / direction butterfly style controller, an adjustable steering yoke, and an auto reverse emergency"belly" switch. This state of the art option allows a single operator to safely and ergonomically transportproducts. Power pack is 42" wide. Maximum speed is 2.5 m.p.h.MODELNET WT. LIST PRICENUMBERDESCRIPTION(POUNDS) EACHPTDS POWER TRACTION DRIVE SYSTEM, 24V DC 156 $4,348.00Hydraulic Motorcycle LiftMODELNUMBEROVERALL SIZE(W x L)BASE FRAME(W x L)UNIFORMCAPACITYSERVICERANGENET WT.(POUNDS)DC-20/FC-70Manual foot pump activated stationary lift. Ideal for casual and professional riders to work on theirmotorcycles. Features a front tire cradle to hold wheels up to 6" wide. The hinged ramp measures 27½"wide by 21½" long.LIST PRICEEACHMOTO-LIFT-1100 35" x 108" 26¾" x 65" 1,100 7" to 32" 517 $1,221.00DC-25/FC-70DVD or VIDEOAVAILABLEDVD or VIDEOAVAILABLETILT MASTER STRADDLEWITH PTDS OPTIONPALLET MASTER/PALLET SERVERWITH PTDS OPTIONPORTABLE SCISSOR TABLEWITH PTDS OPTIONMAINTENANCE DOORwww.vestil.com Phone (800) 348-0868ERGONOMIC SOLUTIONS
50DVD or VIDEOAVAILABLEOPTIONAL ONE OR TWOPIECE ACCORDION SKIRT,CONTACT FACTORYSPECIALTY FINISHES AVAILABLE,CONTACT FACTORYGround Lift Scissor TablesMODELNUMBERPLATFORMSIZE (W x L)UNIFORMCAPACITY460V 3-PHASE STD, OPTIONS ON PG. 43Designed for use when fork trucks are not available. Pallets can be loaded onto the platform with pallettrucks and raised to an ergonomic working height. Safety features include; entry-side electric toe guard toprotect pinch points during lowering of the table, velocity fuse to maintain platform height in the eventof a hose or fitting failure, foot control, maintenance prop, and upper travel limit switch to stop table atmaximum height reducing motor wear. 2HP, 208-230/460V, 3-phase, 60 Hz totally enclosed motor isstandard, other voltages available. Remote power unit can be located up to eight feet away from table.3000 psi hydraulic components rating. Optional accordion skirting available, contact factory.RAISEDHEIGHTLOWEREDHEIGHTOVERALL SIZE(W x L x H)NET WT.(POUNDS)LIST PRICEEACHEHLTG-4450-2-36 44" x 50" 2,000 36" ½" 67" x 56" x 8½" 1620 $4,136.00EHLTG-4450-4-36 44" x 50" 4,000 36" ½" 67" x 56" x 8½" 1690 4,931.00EHLTG-5250-2-36 52" x 50" 2,000 36" ½" 75" x 56" x 8½" 1690 4,224.00EHLTG-5250-4-36 52" x 50" 4,000 36" ½" 75" x 56" x 8½" 1890 5,104.00EHLTG-4470-2-48 44" x 70" 2,000 48" ½" 67" x 78" x 10" 1995 $4,451.00EHLTG-4470-4-48 44" x 70" 4,000 48" ½" 67" x 78" x 10" 2310 5,476.00EHLTG-5270-2-48 52" x 70" 2,000 48" ½" 75" x 78" x 10" 2205 4,553.00EHLTG-5270-4-48 52" x 70" 4,000 48" ½" 75" x 78" x 10" 2520 5,578.00OPTIONSEHLTG-44-SB STEEL ROLLOVER BRIDGE FOR 44"W DECKS (8" LONG) 27 $263.00EHLTG-52-SB STEEL ROLLOVER BRIDGE FOR 52"W DECKS (8" LONG) 33 348.00Low Profile Electric/Hydraulic Scissor Lift TablesDC-20/FC-70Load and unload skids with a pallet truck without the need for a pit when using the optionalapproach ramp. Superior engineering features rugged dependability. Safety features include electricperimeter pinch point guard, emergency stop velocity fuse in cylinders, fused 24V AC hand heldcontrol and maintenance supports. Remote power unit comes complete with a plastic cover toprotect the motor from dust and debris.DVD or VIDEOAVAILABLEREMOTEPOWER UNITVERTICALTRAVEL460V 3-PHASE STD, OPTIONS ON PG. 43Model Number Format: EHLTX - (width)(length) - capacity - raised heightPLATFORMWIDTHPLATFORMLENGTHUNIFORMCAPACITYRAISEDHEIGHTLOWEREDHEIGHTTRAVELTIME (SEC)NET WT.(POUNDS)LIST PRICEEACH35¾" 36" - 60" 53" - 60" 1,000 39" 3¼" 14 1470 $3,639.0035¾" 36" - 60" 53" - 60" 2,000 39" 3¼" 14 1627 3,866.0034¾" 36" - 60" 53" - 60" 3,000 39" 4¼" 22 1680 4,437.0034¾" 36" - 60" 53" - 60" 3,500 39" 4¼" 22 1869 4,664.00APPROACH RAMPS FOR LOW PROFILE SCISSOR TABLESMODELNUMBER WIDTH LENGTH HEIGHTNET WT.(POUNDS)PRICEEACHARX-3639-3 36" 39" 3¼" 150 $362.00ARX-3651-4 36" 51" 4¼" 200 425.00DC-20/FC-70 (ARX SHIP FC-60)ERGONOMIC SOLUTIONSmodel EHU-2Remote Power Unit14¾"W x 26¾"L x 9½"HLow Profile "U" Type Electric Lift TablesMODELNUMBERPLATFORMSIZE (W x L)UNIFORMCAPACITYLOWEREDHEIGHTRAISEDHEIGHT115V 1-PHASE STD, OPTIONS ON PG. 43The open center on the "U" Type Electric Lift Tables enable a pallet truck to place a load on the platform.Units feature an external power pack equipped with a pressure relief valve that prevents overloading and aflow control valve that controls the lowering speed. Remote power pack comes complete with steel coverto protect the motor from dust and debris. Raise and lower the unit using the UP and DOWN pushbuttons on the 24V control box. Safety features include electric toe guards, velocity fuse in cylinders,safety maintenance props, and an emergency stop button on the control box. Inside width is 29¾" by41¼" long. Power supply is 115V single phase with pedestal mounted push buttons.NET WT.(POUNDS)LIST PRICEEACHEHU-2 52½" x 55¾" 2,000 3½" 33½" 630 $2,860.00EHU-3 53½" x 63" 3,000 4¼" 33½" 850 3,190.00DC-20/FC-70Phone (800) 348-0868www.vestil.com
51Lift & Tilt Scissor TablesPerforms both lifting and tilting operations. 45° tilt standard. Restraining chain and 12" high lip to keepthe load in place during tilting. Safety features include: electric toe guard to protect worker from pinchpoints during lowering of table, velocity fuses to hold platform position in event of hose or fitting failure,4 push-button hand pendant control on an 8 foot coil cord, upper limit switch to stop travel at maximumheight reducing motor wear, and maintenance prop. End tilt standard, side tilt available. Optional accordionskirting available for both the lifting and tilting portions of the table, contact factory.MODELNUMBERPLATFORMSIZE (W x L)UNIFORMCAPACITYRAISEDHEIGHTLOWEREDHEIGHTOVERALLSIZE (W x L)NET WT.(LBS.)LIST PRICEEACH45° END TILTEHLTT-3648-1-47 36" x 48" 1,000 47" 11" 36" x 53" 1060 $4,112.00EHLTT-4848-1-47 48" x 48" 1,000 47" 11" 48" x 53" 1113 4,352.00EHLTT-3648-2-47 36" x 48" 2,000 47" 11" 36" x 53" 1181 $4,565.00EHLTT-4848-2-47 48" x 48" 2,000 47" 11" 48" x 53" 1296 4,737.00EHLTT-3648-3-47 36" x 48" 3,000 47" 11" 36" x 53" 1249 $5,204.00EHLTT-4848-3-47 48" x 48" 3,000 47" 11" 48" x 53" 1365 5,491.00EHLTT-3648-4-47 36" x 48" 4,000 47" 11" 36" x 53" 1312 $5,838.00EHLTT-4848-4-47 48" x 48" 4,000 47" 11" 48" x 53" 1433 6,240.00EHLTT-4848-5-47 48" x 48" 5,000 47" 13" 48" x 53" 1725 $7,732.0045° SIDE LINK TILTEHLTTS-3654-2-48 36" x 54" 2,000 48" 12" 38" x 54" 1450 $4,890.00EHLTTS-3654-4-48 36" x 54" 4,000 48" 12" 38" x 54" 1500 6,083.0090° HINGE TILTEHLTT-H-3648-2-47 36" x 48" 2,000 47" 11¼" 36" x 53" 1312 $4,837.00EHLTT-H-4848-2-47 48" x 48" 2,000 47" 11¼" 48" x 53" 1433 5,037.00LIFT & TILT SCISSOR TABLE OPTIONSMODEL NUMBERDESCRIPTIONNET WT.(LBS.)LIST PRICEEACHFC-4 FOUR PEDAL FOOT CONTROL (LIFT & TILT PRODUCTS) 12 $301.00EHLTT-ROTARY-WMPB AIR/OIL POWER W/PNEUMATIC PUSH-BUTTON* 36 1,387.000*FILTER - REGULATOR - LUBRICATOR REQUIRED TO OPERATE UNITDC-20/FC-70Zero Lift & Tilt TablesDesigned to lift or tilt products to an ergonomic working position, reducing operator bending. Products may beloaded and unloaded with the use of a standard hand pallet truck. No pit mounting required! Maximum tilt angle is45°. Lift and tilt controlled separately. Remote power unit with hand-held control standard.MODELNUMBERPLATFORMSIZE (W x L)UNIFORMCAPACITYRAISEDHEIGHTOVERALL SIZE(W x L x H)NET WT.(POUNDS)LIST PRICEEACHZLTT-4452-2-36 44" x 52" 2,000 36" 69" x 59" x 24" 2121 $4,640.00ZLTT-4452-4-36 44" x 52" 4,000 36" 69" x 59" x 24" 2173 5,618.00ZLTT-5252-2-36 52" x 52" 2,000 36" 77" x 59" x 24" 2205 $4,744.00ZLTT-5252-4-36 52" x 52" 4,000 36" 77" x 59" x 24" 2257 5,723.00ZLTT-4472-2-48 44" x 72" 2,000 48" 69" x 79" x 24" 2950 $5,016.00ZLTT-4472-4-48 44" x 72" 4,000 48" 69" x 79" x 24" 3013 6,274.00ZLTT-5272-2-48 52" x 72" 2,000 48" 77" x 79" x 24" 3045 $5,121.00ZLTT-5272-4-48 52" x 72" 4,000 48" 77" x 79" x 24" 3129 6,380.00FOOT CONTROL, MODEL FC-4, $301.00 LISTRAISED HEIGHT NOTED WITH PLATFORM IN LEVEL POSITIONSingle Scissor Lift & Tilt TablesMODELNUMBERPLATFORMSIZE (W x L)UNIFORMCAPACITYLEVELHEIGHTMAXIMUMTILTNET WT.(POUNDS)DC-20/FC-100LIST PRICEEACHPOWER UNITUNI-4848-4 48" x 48" 4,000 8" 40° INTERNAL 792 $2,746.00UNI-5448-4 54" x 48" 4,000 8" 40° INTERNAL 870 2,976.00UNI-9648-4 96" x 48" 4,000 8" 40° INTERNAL 1584 4,590.00UNI-4848-6 48" x 48" 6,000 8" 40° INTERNAL 915 $3,983.00UNI-5448-6 54" x 48" 6,000 8" 40° INTERNAL 950 4,271.00THREE SIDED ACCORDION SKIRT AVAILABLE, CONTACT FACTORY460V 3-PHASE STD, OPTIONS ON PG. 43460V 3-PHASE STD, OPTIONS ON PG. 43460V 3-PHASE STD, OPTIONS ON PG. 43Designed to position containers within easy reach of assembly line workers and machine operators.This unique design reduces fatigue by minimizing repetitive bending and stretching required to obtaincomponents from containers. 96" x 48" unit accommodates (2) 48" x 48" containers, ideal for parts transferand assembly. Platform includes a 12" high lip on tilt side. A selector pedal allows the operator to lift whiletilting, or tilt then lift. 2HP, 3-phase, 60 Hz totally enclosed motor is standard, other voltages available.Other standard features include: a two-button handheld control, integrated maintenance lock, pressureplated pump, pressure compensated flow valve, lowering valve, independent oil return, and an adjustableupward travel limit switch. Unit must be lagged to floor.DC-20/FC-70DVD or VIDEOAVAILABLESTANDARD END TILT SHOWNACCORDION SKIRT AVAILABLE,GUSSETS REQUIRED,CONTACT FACTORYmodelUNI-4848-4DVD or VIDEOAVAILABLECustom FinishAvailablemodelUNI-9648-4www.vestil.com Phone (800) 348-0868NewDVD or VIDEOAVAILABLEERGONOMIC SOLUTIONS
52Portable Uni-Tilts460V 3-PHASE STD, OPTIONS ON PG. 43Now you can transport your tilter from workstation to workstation quickly and easily with a forktruck. This unique design reduces fatigue by minimizing repetitive bending and stretching requiredto obtain components from containers. Platform includes a 12" high lip on tilt side. A selectorpedal allows the operator to lift while tilting or tilt then lift. 2HP, 208-230/460V, 3PH AC powerunit with hand pendant control is standard, other voltages available.MODELNUMBERPLATFORMSIZE (W x L)UNIFORMCAPACITYLEVELHEIGHTMAXIMUMTILTNET WT.(POUNDS)LIST PRICEEACHPOWER UNITUNI-P-4848-4 48" x 48" 4,000 12" 40° INTERNAL 1197 $3,547.00UNI-P-5448-4 54" x 48" 4,000 12" 40° INTERNAL 1241 3,701.00USABLE FORK POCKETS ARE 7½"W x 2½"HDC-20/FC-70Lift & Tilt Workstation Tables460V 3-PHASE STD, OPTIONS ON PG. 43Design of unit allows platform to lift & tilt at the same time for easy operation. Maximum tiltangle is 45° for better ergonomics and operator safety. Service height range is 10" to 24" (to lowestpoint of platform surface). Platform end includes 12" high full-width lip to support containers.Internal power unit includes electric motor, hydraulic pump, and control box. Standard featuresinclude a 2 HP 460V AC power unit with a 24 volt two button hand held pendant control, othervoltages available. Welded steel construction with yellow painted finish.DVD or VIDEOAVAILABLECustom FinishAvailableHINGE TILTmodel EHTTSLIDING TILTmodel EHTT-LMODELNUMBERPLATFORMSIZE (W x L)UNIFORMCAPACITYMAXIMUMTILTNET WT.(POUNDS)LIST PRICEEACHCYLINDERSULTT-3648-2-YEL 36" x 48" 2,000 1 45° 860 $3,137.00ULTT-4848-2-YEL 48" x 48" 2,000 1 45° 1060 3,153.00ULTT-5448-2-YEL 54" x 48" 2,000 1 45° 1095 3,176.00ULTT-3648-4-YEL 36" x 48" 4,000 1 45° 940 $3,647.00ULTT-4848-4-YEL 48" x 48" 4,000 1 45° 1110 3,660.00ULTT-5448-4-YEL 54" x 48" 4,000 1 45° 1140 3,673.00ULTT-3648-6-YEL 36" x 48" 6,000 2 45° 1120 $4,107.00ULTT-4848-6-YEL 48" x 48" 6,000 2 45° 1330 4,123.00ULTT-5448-6-YEL 54" x 48" 6,000 2 45° 1360 4,149.00FOOT CONTROL, MODEL FC-2, $108.00 LISTHinge & Sliding Tilt Tables460V 3-PHASE STD, OPTIONS ON PG. 43DC-20/FC-70Hinge and Sliding Tilt Tables offer the rugged durability of the standard Efficiency Master lineof tilters, plus they offer an extra low platform height. A 12" lip without side gussets allows forloading and unloading on three sides. Standard features include a 2 HP 460V AC power unitwith a 24 volt two button hand held pendant control, other voltages available. A pressure platedpump coupled to an application specific manifold features counterbalanced valves and modulatedflow control for maximum efficiency.The Sliding Tilt Table incorporates a patented sliding link-tilt design for maximum stability whileoccupying minimum space. As the table is tilted, the front edge of the container moves awayfrom the operator. The center-of-gravity of the load remains closer to the center of the frame.Side gussets are required when ordering optional accordion skirt.ERGONOMIC SOLUTIONSDVD or VIDEOAVAILABLEMODELNUMBER DESIGNPLATFORMSIZE (W x L)UNIFORMCAPACITYLEVELHEIGHTMAXIMUMTILTNET WT.(POUNDS)LIST PRICEEACHEHTT HINGE 48" x 48" 4,000 10" 45° 1427 $2,963.00EHTT-L SLIDING 48" x 48" 4,000 8" 45° 1449 3,175.00THREE SIDED ACCORDION SKIRT AVAILABLE, CONTACT FACTORYDC-20/FC-70Ground TilterThe Ground Tilter is the best product for tilting applications which require the use of a pallet truckfor loading and unloading. Rotate containers up to 45° from floor level to provide better access toparts in containers. Platform includes a 17" high lip on tilt side. A removable positioning bar isprovided for use with smaller containers. Designed with worker safety in mind, pinch point guardsare provided on loading side of the unit. 2HP 460V motor standard, other voltages available.Remote power unit with a protective cover measures 24"W x 24"L x 8"H. Hand pendant controlstandard. Optional foot control available.MODELNUMBERPLATFORMSIZE (W x L)460V 3-PHASE STD, OPTIONS ON PG. 43UNIFORMCAPACITYLEVELHEIGHTMAXIMUMTILTNET WT.(POUNDS)LIST PRICEEACHPOWER UNITGLT-4000 50" x 48" 4,000 ½" 45° EXTERNAL 1315 $3,606.00FOOT CONTROL, MODEL FC-2, $108.00 LISTDC-20/FC-70Phone (800) 348-0868www.vestil.com
Bench Top TiltersHeavy-duty steel Bench Top Tilters tilt loads from 0° to 45° (3" lip). Easily attached to most industrialtable tops, work benches, and mobile lift tables of sufficient load capacity and surface size. Unit slidesback as it tilts to maintain the center of gravity over the frame. Manual units can be adjusted only whenunloaded. Linear Actuated units are equipped with a push-button hand pendant control, located on an8 foot cord. Flat base plate with slotted holes for installation.MODELNUMBERPLATFORM SIZE(W x L x H)UNIFORMCAPACITYMAXIMUMTILTNET WT.(LBS.)LIST PRICEEACHOPERATIONBTT-6-36 28" x 36" x 2" 600 15°, 30° & 45° MANUAL 60 $149.00BTT-6-46 28" x 46" x 2" 600 15°, 30° & 45° MANUAL 72 162.00BTT-5-36 28" x 36" x 5" 500 0° TO 45° LINEAR ACTUATED 84 $1,005.00BTT-5-46 28" x 46" x 5" 500 0° TO 45° LINEAR ACTUATED 96 1,018.00BTT-10-36 28" x 36" x 3" 1,000 0° TO 45° LINEAR ACTUATED 96 1,075.00BTT-10-46 28" x 46" x 3" 1,000 0° TO 45° LINEAR ACTUATED 108 1,085.00DC-25/FC-70Economy Transporter / TilterMove product between work stations. Tilt crates for easier access. Manual foot pump operation. Tilts35° in just 11 strokes. Features a removable handle. Rolls smoothly on (2) swivel and (2) rigid poly 5"x 2" casters. Blue powder coat finish.New53MODELNUMBERPLATFORMSIZE (W x L)UNIFORMCAPACITYLEVELHEIGHTMAXIMUMTILTNET WT.(POUNDS)LIST PRICEEACHETT-254 40" x 42" 2,500 10" 35° 254 $824.00DC-20/FC-70Efficiency Master Tilt Tables460V 3-PHASE STD, OPTIONS ON PG. 43The model EM1-200 tilts pallets, crates, boxes, or baskets 45° to facilitate easy container loading orunloading. Tables feature all welded steel construction for years of durability. Unique design minimizespinch points to meet OSHA requirements. Units are equipped with an industrial quality, 56 frame 2 HPmotor. This motor delivers best torque with minimal amperage draw for maximum life. Standard voltageis 460V 3 phase, other voltages available. A 24V push button hand control is standard.The model EM1-500 incorporates all of the same quality features found in the Series EM1-200 butfeatures a full 90° of tilt. Unit is ideal for upending products in shipping and receiving operations.Standard with double acting cylinder for controlled tilt and return. Unit must be lagged to floor.DVD or VIDEOAVAILABLEQUICKSHIP (460V 3 PHASE STANDARD)USABLE SIZEMODEL NUMBER (W x L)UNIFORMCAPACITYMAXIMUMTILTHORIZONTALHEIGHTNET WT.(POUNDS)LIST PRICEEACHEM1-200-4848-2 48" x 48" 2,000 45° 24" 741 $2,593.00EM1-200-4848-4 48" x 48" 4,000 45° 24" 793 2,749.00DC-20/FC-70USABLE SIZE(W x L)UNIFORMCAPACITYMAXIMUMTILTHORIZONTALHEIGHTNET WT.(POUNDS)LIST PRICEEACHMODEL NUMBEREM1-200-4250-2 42" x 50" 2,000 45° 24" 710 $2,565.00EM1-200-6050-2 60" x 50" 2,000 45° 24" 804 2,626.00EM1-200-4250-4 42" x 50" 4,000 45° 24" 750 $2,713.00EM1-200-6050-4 60" x 50" 4,000 45° 24" 854 2,774.00EM1-200-4250-6 42" x 50" 6,000 45° 24" 792 $2,984.00EM1-200-4848-6 48" x 48" 6,000 45° 24" 802 3,055.00EM1-200-6050-6 60" x 50" 6,000 45° 24" 882 3,096.00EM1-500-4250-2 42" x 50" 2,000 90° 24" 734 $2,683.00EM1-500-4848-2 48" x 48" 2,000 90° 24" 827 2,709.00EM1-500-6050-2 60" x 50" 2,000 90° 24" 968 2,742.00EM1-500-4250-4 42" x 50" 4,000 90° 24" 784 $3,115.00EM1-500-4848-4 48" x 48" 4,000 90° 24" 850 3,143.00EM1-500-6050-4 60" x 50" 4,000 90° 24" 1008 3,174.00EM1-500-4250-6 42" x 50" 6,000 90° 24" 835 $3,337.00EM1-500-4848-6 48" x 48" 6,000 90° 24" 866 3,370.00EM1-500-6050-6 60" x 50" 6,000 90° 24" 1092 3,412.00OPTIONAL FOOT CONTROL, model FC-2, $108.00 LISTEFFICIENCY MASTER TILT TABLE OPTIONSDC-20/FC-7045° EFFICIENCY MASTERfeatures a 12" high lip series EM1-200Custom FinishAvailable90° EFFICIENCY MASTERfeatures a 24" high lip series EM1-500MODEL NUMBER DESCRIPTION LIST PRICE EACHEM1-300-APPB *HAND HELD CONTROL AIR POWERED HYDRAULIC - ROTARY-PB-2, FOR 45° TILTERS $683.00EM1-300-APFC *FOOT CONTROL AIR POWERED HYDRAULIC - ROTARY-FC-2, FOR 45° TILTERS 872.00EM1-300-APFT *FOOT TREADLE AIR POWERED 2000# & 4000# ONLY - RECIPR, FOR 45° TILTERS N/CEM1-600-APPB *HAND HELD CONTROL AIR POWERED HYDRAULIC - ROTARY-PB-2, FOR 90° TILTERS $743.00EM1-600-APFC *FOOT CONTROL AIR POWERED HYDRAULIC - ROTARY-FC-2, FOR 90° TILTERS 954.00*FILTER REGULATOR - LUBRICATOR REQUIRED TO OPERATE UNITwww.vestil.com Phone (800) 348-0868ERGONOMIC SOLUTIONS
54Air Corner TiltersMODELNUMBERFACTORY AIR POWEREDThe floor level airbag powered tilter provides ergonomic loading and unloading of bulk containers,gaylords, or crates. Pallet truck and fork truck accessible. Tilts up to 45°. Activated by a handoperated control lever or foot pedal. By adjusting the air regulator to a predetermined pressure,the air bag inflates tilting the container automatically as it is unloaded. As the container becomeslighter, it automatically tilts and the material shifts to the corner of the container where it can beeasily removed by manual or mechanical means. The adjustable regulator is factory preset to beginrotating the container when the weight reaches approximately 900 lbs. Pressure is easily adjustablefor the weight of your application.PLATFORMSIZE (W x L)UNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONAIR-THL HAND LEVER OPERATION 44" x 44" 1,500 460 $2,631.00AIR-TFP FOOT TREADLE OPERATION 44" x 44" 1,500 460 2,631.00AIR-PVO POWER VIBRATOR OPTION -- -- 30 $859.00DC-20/FC-100Electric/Hydraulic Corner Tilters460V 3-PHASE STD, OPTIONS ON PG. 43Reduce repetitive motion injuries and fatigue while making your job easier and faster. Designed tocorner tilt pallets, crates, boxes, or baskets 30°. AC powered with 2HP 460V 3 phase with a pushbutton control, other voltages available. Built in fork tubes for easy portability with a fork truck.MODELNUMBERPLATFORMSIZE (W x L x H)UNIFORMCAPACITY (LBS.)MAXIMUMTILTNET WT.(POUNDS)LIST PRICEEACHEMC-4242-2 42" x 42" x 24" 2,000 30° 750 $2,593.00EMC-4242-4 42" x 42" x 24" 4,000 30° 800 2,749.00EMC-4848-2 48" x 48" x 24" 2,000 30° 800 $2,708.00EMC-4848-4 48" x 48" x 24" 4,000 30° 850 2,862.00FOOT CONTROL, MODEL FC-2, $108.00 LISTDC-20/FC-100DVD or VIDEOAVAILABLESKID ONLYNO PALLETManual Tilt MasterLift, tilt, and transport crates, boxes, and pallets with an open bottom. Designed to give the useran ergonomically correct position to reach loads easily without the need for bending down orexcessively reaching over. Forks can be tilted to 90°. Rolls smoothly on 6" x 2" polyurethane swivelcasters with brake and foot protectors. Width between forks is 9½". The overall fork width is 22".The individual fork width is 6½".MODELNUMBERUNIFORMCAPACITYVERTICALLIFT HEIGHTLOWEREDFORK HEIGHTFORKLENGTHOVERALLWIDTHNET WT.(POUNDS)LIST PRICEEACHTM-22-M 2,200 11¼" 3½" 31½" 25¼" 425 $1,445.00DC-25/FC-70ERGONOMIC SOLUTIONSPhone (800) 348-086845° DUMP ANGLE(135° TOTALROTATION)model HBD-2-48DVD or VIDEOAVAILABLECustom FinishAvailableMODELNUMBERElectric/Hydraulic Box DumpersDesigned for controlled dumping of material from boxes, crates, and other types of containers.Lowered height of only ⅜" allows for pallet truck loading and unloading. Retaining bar adjustsevery 2" to accommodate a wide range of contaner heights. Each dump height has a hold downrange, see chart. Maximum rotation is 135°. Chute reach is 10" when fully rotated. Internal 2HPpower unit and hand held control standard (5HP power unit on 6,000 lbs. models). Protectivemesh side screens included. Heavy-duty welded steel construction.DUMPHEIGHTLEVEL ROTATEDHEIGHT HEIGHTUSABLE CHUTE(W x L)HOLDDOWNS460V 3-PHASE STD, OPTIONS ON PG. 43UNIFORMCAPACITYOVERALL(W x L)NET WT.(POUNDS)LIST PRICEEACHHBD-2-36 36" 53" 108" 51½" x 50" 18"-36" 2,000 64" x 67" 1564 $4,989.00HBD-2-48 48" 65" 128" 51½" x 50" 18"-42" 2,000 64" x 67" 1701 5,157.00HBD-2-60 60" 77" 148" 51½" x 50" 18"-50" 2,000 64" x 67" 1837 5,276.00HBD-4-36 36" 53" 108" 51½" x 50" 18"-36" 4,000 67" x 67" 1653 $6,151.00HBD-4-48 48" 65" 128" 51½" x 50" 18"-42" 4,000 67" x 67" 1748 6,347.00HBD-4-60 60" 77" 148" 51½" x 50" 18"-50" 4,000 67" x 67" 1932 6,449.00HBD-6-36 36" 53" 108" 51½" x 50" 18"-36" 6,000 67" x 67" 1748 $6,474.00HBD-6-48 48" 65" 128" 51½" x 50" 18"-42" 6,000 67" x 67" 1837 6,639.00HBD-6-60 60" 77" 148" 51½" x 50" 18"-50" 6,000 67" x 67" 2021 6,776.00OPTIONSHICYCLE-HBD-2/4 HIGH CYCLE PACKAGE FOR 2,000 & 4,000 LB. UNITS 30 $3,600.00HICYCLE-HBD-6 HIGH CYCLE PACKAGE FOR 6,000 LB. UNITS 90 4,080.00FC-2 FOOT CONTROL 6 $108.00DC-20/FC-150/250www.vestil.com
55Portable Pallet Inverter24V DC STANDARDTilt and rotate loads with our durable Pallet Inverter. Low profile design allows the operator tostand on the rider platform and steer the load from workstation to workstation quickly and easily.DC power lift and drive makes operation safe and efficient. The ergonomic handle features easyto operate throttle with infinite forward and reverse speeds, tilt/lower controls, safety belly reversebutton and horn. Features an electromagnetic disc brake with automatic dead-man feature thatactivates when user releases handle. Includes two 12V batteries, an on-board battery charger (AC110V or 220V/60 hz), battery level gauge, key lock, emergency battery disconnect and horn.Ideal in loading dock areas as a power pallet truck, pallet tilter or as a turntable. Rolls smoothlyon polyurethane steel and load wheels.1 2 3 4 5DVD or VIDEOAVAILABLESKID ONLYNO PALLETClose Load Tilt Load 90° ManuallyRotate 180°MODELNUMBERUNIFORMCAPACITYFORK OPENING(MIN & MAX)LOWEREDHEIGHTFORK(W x L)OVERALL SIZE(W x L x H)NET WT.(POUNDS)LIST PRICEEACHPPI-90 2,000 31½" to 47½" 3½" 6" x 30" 33½" x 78" x 54" 1650 $13,923.00Pallet InvertersMODELNUMBERMAXIMUM LOADSIZE (W x L)460V 3-PHASE STANDARDMINIMUM JAWOPENING HEIGHTMAXIMUM JAWOPENING HEIGHTNET WT.(LBS.)LIST PRICEEACHCONTROLPI-51 50" x 50" 37" 61" PENDANT 4048 $33,122.00PI-51-L 50" x 50" 37" 61" LEVER 4048 30,802.00PI-61 50" x 50" 43" 73" PENDANT 4268 $33,805.00PI-61-L 50" x 50" 43" 73" LEVER 4268 31,548.00HAND PENDANT CONTROL STANDARD / NEMA 12 RATING STANDARDLower LoadTransport InvertedLoadDC-20/FC-175Engineered to reduce your costs in production, storage, retrieval, and distribution. The 180° rotationmakes pallet exchange quick and simple while reducing product damage. Easy load transfer fromwood pallet to plastic pallet, slip sheet, or rental pallet. Units can be loaded and unloaded with a forktruck. Uniform capacity is 4,400 lbs. Machine guarding is standard, safety guarding is optional.DC-20/FLATBEDNewSHOWN WITH OPTIONAL SAFETY GUARDSTilt Master & Tilt Master StraddleLift and position filled tote boxes or baskets without the need of a fork truck or lift table using thenewly designed heavy-duty Tilt Master. These 90° tilters will function as transporters by movingcompleted products from work station to work station without waiting for a fork truck.A folding ergonomic handle for quick and easy maneuverability. Unit has a thin profile to allowthe user to get as close to the load as possible. Units roll easily on 8" x 3" phenolic steering wheels.Floor lock standard. Series TM is designed to be used with open bottom pallets or skids only whilethe Tilt Master Straddle units, series TMS, can be used with virtually any kind of container orpallet. Units are powered with a 12V DC electric motor including an on-board battery chargerstandard. Units come standard with a push-button hand control on an 8 foot coil cord.TILT MASTER & TILT MASTER STRADDLE OPTIONSMODELNET WEIGHT LIST PRICENUMBERDESCRIPTION(POUNDS) EACHTM-CHUTE RETROFIT CHUTE OPTION 18 $210.00TM-PTDS POWER TRACTION DRIVE SYSTEM 156 4,348.00BCI BATTERY CHARGE INDICATOR GAUGE 10 82.00MODELNUMBERUNIFORMCAPACITYFORKADJUSTMENTOPERATORREACH12V DC STANDARD, OPTIONS ON PG. 43FORKWIDTHROTATEDHEIGHTLOWEREDHEIGHTSKID ONLYNO PALLETDVD or VIDEOAVAILABLEOVERALL SIZE(W x L x H)TILT MASTERWith Only 10½" of ReachTILT MASTER STRADDLEWith Only 13½" of ReachNET WEIGHT(POUNDS)LIST PRICEEACHTILT MASTERTM-20 2,000 FIXED AT 26" (OD) 10½" 6" 33" 3 5 /8" 40½" x 68" x 28½" 715 $3,015.00TM-40 4,000 FIXED AT 26" (OD) 10½" 6" 33" 3 5 /8" 40½" x 68" x 28½" 770 3,339.00TM-60 6,000 FIXED AT 27" (OD) 10½" 6½" 33" 3 5 /8" 40½" x 68" x 28½" 851 4,290.00TILT MASTER STRADDLETMS-20 2,000 ½" TO 29½" (ID) 13½" 4" 37" 3" 57" x 61" x 28½" 840 $3,322.00TMS-40 4,000 ½" TO 29½" (ID) 13½" 4" 37" 3" 57" x 61" x 28½" 1155 3,572.00TMS-60 6,000 ½" TO 29½" (ID) 13½" 4" 37" 3" 57" x 61" x 28½" 1365 4,498.00DC-25/FC-70www.vestil.com Phone (800) 348-0868SKIDPALLETERGONOMIC SOLUTIONS
56Manual & Electric Hydraulic Trash Can DumpersTrash Can Dumpers are designed so one person can easily dump contents of trash cans no matter howheavy they are. Versatile adjustable unit works with only the trash cans listed below or approved equal.Available in manual foot pump, AC, or DC powered operation with hand control. DC powered unitsinclude an on-board battery charger. Heavy-duty steel construction with two rigid and two swivel castersfor portability. Maximum dump angle is 135°. Optional Trash Cans are available below.NewNewDVD or VIDEOAVAILABLEMODELNUMBERMAXIMUMDUMP ANGLEMAXIMUMDUMP HEIGHTUNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONTCD-M FOOT PUMP 135° 48" 400 386 $2,539.00TCD-AC 115V AC POWERED 135° 48" 400 400 3,530.00TCD-DC 12V DC POWERED 135° 48" 400 420 3,530.00BC REMOTE BATTERY CHARGER 8 $133.50BCI BATTERY CHARGE INDICATOR GAUGE 1 82.00DC-20/FC-100Universal Trash Can DumpersThis innovative product allows one person to easily load, maneuver, and dump heavy trash cans ofvarious sizes. The large squared chute and hold-down fingers allow this product to dump and retain mosttrash cans. Works with trash cans measuring 17½" to 36" wide, 20½" to 37" long, and 22" to 48" high,including those listed below. Multiple operations available; manual foot pump, 110V AC, and 12V DCwith on-board charger. Overall size is 45"W x 74"L x 65"H. Ships fully assembled.MODELNUMBERMAXIMUMDUMP ANGLEMAXIMUMDUMP HEIGHTUNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONTCD-U-48-M FOOT PUMP 135° 48" 400 386 $2,539.00TCD-U-60-M FOOT PUMP 135° 60" 400 436 2,885.00TCD-U-72-M FOOT PUMP 135° 72" 400 476 2,997.00TCD-U-AC AC POWER OPTION, 110V 420 $991.00TCD-U-DC DC POWER OPTION, 12V 420 991.00BC REMOTE BATTERY CHARGER 8 $133.50BCI BATTERY CHARGE INDICATOR GAUGE 1 82.00DC-20/FC-100Trash CansDurable polyethylene construction withstands subzero cold and extreme summer heat. Great for hightraffic areas such as: warehouses, fairs, ball parks, schools, etc. Each container includes two wheels foreasy portability. Hinged lip keeps rain out. Keep your waste out of eyesight in our heavy-duty and easy tomove refuse containers.ERGONOMIC SOLUTIONSmodel TH-32-GRNmodel TH-64-GYmodel TH-95-BLUDVD or VIDEOAVAILABLEMODELNUMBERMODELNUMBERDUMPHEIGHTROTATEDHEIGHTUNIFORMCAPACITY (LBS)OVERALL SIZE(W x L)NET WT.(POUNDS)LIST PRICEEACHJMD-1000-48 48" 105 13 /16" 600 57" x 61" 893 $3,874.00JMD-1000-60 60" 118 13 /16" 600 57" x 61" 998 4,015.00JMD-1000-72 72" 129 13 /16" 600 57" x 61" 1129 4,323.00MPT-1 ADD'L ½ CUBIC YARD POLYETHYLENE TOTECAPACITY 200 LBS - OVERALL SIZE: 53"W x 35"D x 42"H114 $348.00MPT-2VOLUME(GALLONS)ADD'L ½ CUBIC YARD POLYETHYLENE TOTECAPACITY 600 LBS - OVERALL SIZE: 50"W x 35"D x 37"HOVERALL SIZE(W x D x H)NET WT.(POUNDS)LIST PRICEEACHCOLORTH-32-GRN 32 GREEN 22" x 22" x 37" 18 $63.40TH-32-GY 32 GREY 22" x 22" x 37" 18 63.40TH-32-BLU 32 BLUE 22" x 22" x 37" 18 63.40TH-64-GRN 64 GREEN 23½" x 29¼" x 39¾" 29 $84.60TH-64-GY 64 GREY 23½" x 29¼" x 39¾" 29 84.60TH-64-BLU 64 BLUE 23½" x 29¼" x 39¾" 29 84.60TH-95-GRN 95 GREEN 28¼" x 34" x 44½" 51 $118.10TH-95-GY 95 GREY 28¼" x 34" x 44½" 51 118.10TH-95-BLU 95 BLUE 28¼" x 34" x 44½" 51 118.10DC-25/FC-250Multi-Purpose Tote Dumpers12V DC STD, OPTIONS ON PG. 43Collect, transport, and dump materials while saving time and reducing work related injuries. Ideal forschools, hospitals, commercial, and industrial applications. One person can easily and safely empty totesweighing up to 600 uniform pounds. To use, roll the tote into dumper, secure tote in place and depressthe 24V hand control. The tote will rotate over 135° to dump contents. Dump time is approximately 25seconds. Standard features: (2) 8" x 2" phenolic front wheels, (2) 8" x 3" phenolic rear casters, floor lock,12V DC power, hand pendant control on 8 foot coil cord and (1) MPT-2 polyethylene tote.200 $555.00DC-20/FC-100Phone (800) 348-0868www.vestil.com
Trash Can DumpersMODELNUMBER115V 1-PHASE STD, OPTIONS ON PG. 43Minimize lifting and dumping heavy trash cans with the rugged all steel Trash Can Dumper. One person caneasily and safely empty trash cans weighing up to 300 uniform lbs. into dumpsters. The automatic containerclamp securely holds the trash can container. Hand crank or 115V, 1 phase, push button actuation rotatescontainers to 135° angle (60" dump height) above dumpster. Each unit comes with (4) 5" poly-on-steelcasters, two rigid and two swivel with brake for easy maneuverability and heavy-duty mesh sides for safety.One Trash Can, model TH-95-BLU, comes standard with each unit. Additional Trash Cans are available onpage 54.OVERALL SIZE(W x L x H)NET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONT-DUMP-E 115V PUSH BUTTON ELECTRIC WINCH 42½" x 61" x 79" 1210 $2,420.00T-DUMP-HC HAND OPERATED WINCH WITH BRAKE 42½" x 61" x 79" 1150 2,267.00THE T-DUMP SERIES HAS A DUMP HEIGHT OF 60" AND A DUMP ANGLE OF 135°DC-20/FC-100DVD or VIDEOAVAILABLE57Hydraulic Work PositionerIdeal for either sitting or standing applications at work assembly areas. Lip retains plasticbins and organizers. Spring loaded detent controls the tilt angle. Hydraulic foot pumpwith a telescoping cylinder provides a 13¼" service range.Custom FinishAvailableMODELNUMBERPLATFORMSIZE (W x L)LIPHEIGHTSERVICERANGE*PLATFORMTILTUNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHWT-2016-FP 20" x 16" 1¼" 28¾" to 42" 40° 330 89 $290.00*SERVICE RANGE WITH PLATFORM IN LEVEL POSITIONDC-25/FC-70modelWT-2016-FPMobile Tilting Work TablesDesigned to bring work to an ergonomically correct position, helping to foster a morecomfortable and productive work environment. Working in a comfortable position alsoreduces fatigue and risk of injuries. Platform height and tilt angle are manually adjustable,with the exception of model WT-2424-LA, which uses a 115V electric linear actuator with ahand control. Four 3½" x 1¼" polyurethane swivel casters (two double locking) allow unit tobe transported from one work area to another while loaded. All steel construction.MODELNUMBERPLATFORMSIZE (W x L)LIPHEIGHTSERVICERANGE*PLATFORMTILTUNIFORMCAPACITYNET WT.(POUNDS)DVD or VIDEOAVAILABLELIST PRICEEACHWT-2424 24" x 24" 3" 31½" to 42" 30° 300 120 $568.00WT-2221 22" x 21" 2" 28" to 38" 45° 150 85 257.00WPT-1624 16" x 24" 2" 31½" to 42" 45° 200 60 253.00WT-2424-LA 24" x 24" 3" 31½" to 42" 30° 300 135 1,861.00*SERVICE RANGE WITH PLATFORM IN LEVEL POSITIONDC-25/FC-70HAND CRANKmodel WT-2424TURN KNOBmodel WT-2221Deluxe Roller StandsDesigned for use as an extra hand when working with long materials. Each stand includes 2" chromeplated rollers and heavy-duty cast-steel base. Choose either v-groove roller design or flat single rollerdesign. The height of each stand is adjusted with a friction lock screw or a gas charged cylinder. Greatfor use in machine and wood shops. Ships knockdown.Model STAND-T is ideal for most tubing and bar stock applications. The STAND-T is infinitelyadjustable from ½" - 6" on either side. Roller plates can also be inverted to create different offsets andto handle larger diameter tubing. Painted blue finish. Does not work with STAND-MF.MODELNUMBERVARIABLE HEIGHTSERVICE RANGEUNIFORMCAPACITYNET WT.(LBS.)LIST PRICEEACHDESCRIPTIONMANUAL OPERATIONSTAND-H 14" HORIZONTAL ROLLER 23" to 38½" 1,760 30 $87.00STAND-V (2) 5" "V" ROLLERS (9"W ACROSS) 23" to 38½" 1,760 30 91.00STAND-H-HP 14" HORIZONTAL ROLLER 27" to 42" 1,760 36 $92.00STAND-V-HP (2) 5" "V" ROLLERS (9"W ACROSS) 27" to 42" 1,760 36 92.00GAS CYLINDER, COUNTER BALANCED, OPERATIONSTAND-G-H 14" HORIZONTAL ROLLER 26" to 36" 1,760 66 $195.00STAND-G-V (2) 5" "V" ROLLERS (9"W ACROSS) 26" to 36" 1,760 66 198.00STAND-G-H-HP 14" HORIZONTAL ROLLER 33" to 43" 1,760 75 $199.00STAND-G-V-HP (2) 5" "V" ROLLERS (9"W ACROSS) 33" to 43" 1,760 75 199.00MULTI-FUNCTION, 4-WAY ROLLER, 2-WAY ROLLER, FIXEDSTAND-MF 11¼" x 1.9" (8) BALL ROLLERS 28" to 44" 125 15 $39.00OPTIONSSTAND-T ROLLER PLATE ½" to 6" 1,760 6 $59.00DC-25/UPS/FC-85TURN KNOBmodel WPT-1624STAND-MFLINEARIZER ACTUATEDmodel WT-2424-LAwww.vestil.com Phone (800) 348-0868NewSTAND-TERGONOMIC SOLUTIONS
58High Rise Lift Trucks12V DC STANDARD, OPTIONS ON PG. 43Ergonomic lift truck increases worker and machine efficiency and productivity. Reduces muscle fatigueand body injuries by bringing material closer to actual worker height. 12V DC power with on-boardbattery charger standard. Heavy loads can be lifted by electric hydraulic power and manually moved untilauto brake engages at approximately 8". Push buttons to raise and lower lift are located on power unit.Key-operated ON/OFF control for better security is built into the power unit. Unit rolls smoothly onphenolic 3" x 8" rear swivel casters and dual 2" front guide wheels.DVD or VIDEOAVAILABLESKID ONLYNO PALLETAPPLIES TO ALL PRODUCTS ON THIS PAGEHAND PUMPmodel L-220-HD& L-270-HDDVD or VIDEOAVAILABLE12V DC POWEREDmodel L-220-DC-HD& L-270-DC-HDMODELNUMBERFORK SIZE(W x L)SERVICERANGEUNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHOPERATIONHIPM-2748 27" x 48" 3½" to 31" 2,500 DC BATTERY 530 $2,203.00HIPM-2048 20" x 48" 3½" to 31" 2,500 DC BATTERY 515 2,133.00HIGH RISE LIFT TRUCK OPTIONSMODELNUMBERNET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONHIPM-PLATE SOLID PLATFORM TO FIT OVER FORKS 36 $219.00HIPM-FC-AIR FOOT TREADLE AIR/HYDRAULIC OIL - RECIPROCATING 24 NO CHARGE*HIPM-AC 24V CONTROL, 115V AC POWER OPTION 48 NO CHARGE*HIPM-PTDS POWER TRACTION DRIVE SYSTEM (OVERALL WIDTH 40") 156 4,348.00BCI BATTERY CHARGE INDICATOR GAUGE (DC UNITS ONLY) 1 82.00HIPM-FLK MANUAL FLOOR LOCK 15 200.00Tote LiftersMODELNUMBERFORK SIZE(W x L)SERVICERANGEUNIFORMCAPACITYNET WT.(POUNDS)DC-25/FC-175Designed to lift open bottom skids, boxes, and baskets. Two operations available: hand pump and12V DC power with rocker switch to raise or lower. Hand pump design features an ergonomic pumphandle with two lifting speeds to accommodate for light or heavy loads. Side stabilizers lock lift in placewhen load is raised above 20½". DC power units include on-board battery charger. Suffix "SS" standsfor stainless steel units. Stainless steel units feature nylon wheels.LIST PRICEEACHOPERATIONL-220-HD HAND PUMP 20" x 43" 3½" to 31½" 3,000 320 $852.00L-270-HD HAND PUMP 27" x 43" 3½" to 31½" 3,000 340 863.00L-270-HD-SS HAND PUMP 27" x 45" 3½" to 31½" 3,000 340 2,994.00L-220-DC-HD 12V DC POWERED 20" x 45" 3½" to 31½" 3,000 253 $1,917.00L-270-DC-HD 12V DC POWERED 27" x 45" 3½" to 31½" 3,000 427 1,992.00L-270-DC-HD-SS 12V DC POWERED 27" x 45" 3½" to 31½" 2,000 427 3,929.00DC-25/FC-175STAINLESS STEEL12V DC POWEREDmodel L-270-DC-HD-SSTOTE-LIFTER OPTIONSMODELNUMBERNET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONBCI BATTERY CHARGE INDICATOR GAUGE 1 $82.00L-PLATE-20 SOLID PLATFORM TO FIT OVER FORKS (20" Wide Unit) 36 $225.00L-PLATE-27 SOLID PLATFORM TO FIT OVER FORKS (27" Wide Unit) 37 225.00Tote-A-LoadsERGONOMIC SOLUTIONSFOOT PUMPmodel TAL-260-HD12V DC POWEREDmodel TAL-260-DCDVD or VIDEOAVAILABLEDesigned to lift open bottom skids, boxes, and baskets. The manually operated lift is easy to operate.The foot pump operated lift travels approximately ½" per stroke. To lower unit simply squeeze thebicycle style grip located on the white push bar. The battery operated lift is ideal for positioningproducts at workstation heights for increased productivity. The up/down lever control is convenientlylocated on power unit. DC powered units include on-board charger. Polyurethane swivel casters withbrake are standard on all units.MODELNUMBERFORK SIZE(W x L)UNIFORMCAPACITYSERVICERANGENET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONTAL-220-HD FOOT PUMP 21" x 43" 2,200 3½" to 33" 315 $918.00TAL-260-HD FOOT PUMP 27" x 43" 2,200 3½" to 33" 336 924.00TAL-220-DC 12V DC POWERED 21" x 43" 2,200 3½" to 33" 415 $2,000.00TAL-260-DC 12V DC POWERED 27" x 43" 2,200 3½" to 33" 440 2,007.00DC-20/UPS/FC-175TOTE-A-LOAD OPTIONSMODELNUMBERNET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONBCI BATTERY CHARGE INDICATOR GAUGE 1 $82.00TAL-PLATE-21 21" WIDE SOLID PLATFORM TO FIT OVER FORKS 36 $240.00TAL-PLATE-27 28" WIDE SOLID PLATFORM TO FIT OVER FORKS 36 240.00Phone (800) 348-0868www.vestil.com
Pallet Master/ServersEnables one person to easily move fully loaded pallets without the use of a fork truck. Unique straddledesign works well with pallets and skids with and without an understructure. Ideal for loading andunloading semi-trailers. Lowered height is 3". Move the unit around easily on its 8" x 3" (8" x 2"standard on LL-PMPS) swivel phenolic rear casters. Floor lock standard. Handle height is 36".Outriggers are adjustable on series LL-PMPS.Units on this page feature 12V DC power standard with on-board charger. Optional AC or Air/Oilpower available. Push buttons to raise and lower lift are located on power unit. Hand pendant controlon an 8 foot coil cord standard. Key-operated ON/OFF control for better security is built into thepower unit. All welded steel construction.MODELNUMBERUNIFORMCAPACITY†OPERATION(SPECIFY WHEN ORDERING)FORK SIZE(W x L)RAISEDHEIGHTNET WT.(POUNDS)LIST PRICEEACHPMPS-50M 2,500 MANUAL FOOT PUMP 4" x 36" 50" 931 $3,246.00PMPS-50 4,000 12V DC, AC or AIR/OIL 4" x 36" 50" 1081 3,246.00PMPS-60 4,000 12V DC, AC or AIR/OIL 4" x 36" 60" 1105 3,508.00LL-PMPS-50* 1,200 12V DC, AC or AIR/OIL 4" x 36" 50" 860 $2,077.00LL-PMPS-60* 1,200 12V DC, AC or AIR/OIL 4" x 36" 60" 875 2,331.00LL-PMPS-72* 1,200 12V DC, AC or AIR/OIL 4" x 36" 72" 910 2,697.00OPTIONSPMPS-48FORK 48" LONG FORKS 50 $242.00*INSIDE STRADDLE WIDTH IS ADJUSTABLE BETWEEN 30" TO 50"DC-20/FC-100†CAPACITY RATED IS AT 18" REGARDLESS OF FORK LENGTHCounter-Balanced Pallet Master/ServersMove pallets and skids from one workstation to another. Features an 18" horizontal load center andadjustable forks from 8" to 28". Units roll easily on its 8" x 3" swivel phenolic rear casters. Floor lockstandard. Handle height is 40".MODELNUMBERUNIFORMCAPACITYFORK SIZE(W x L)SERVICERANGEOVERALL HEIGHT(RAISED / LOWERED)NET WT.(POUNDS)LIST PRICEEACHCB-PMPS-6-50 600 4" x 36" 3" to 50" 91" to 73½" 2330 $3,149.00CB-PMPS-10-50 1,000 4" x 36" 3" to 50" 91" to 73½" 2730 3,461.00CB-PMPS-6-60 600 4" x 36" 3" to 60" 101" to 83½" 2380 $3,507.00CB-PMPS-10-60 1,000 4" x 36" 3" to 60" 101" to 83½" 2780 3,818.00DC-20/FC-100Counter-Balanced StackersMove small loads from one place to another without the need for oversized fork truck equipment.Counterbalance design allows the operator complete access to three sides of the load. The open frontenables the forks to be next to workstation for easy loading and unloading. Includes counterbalance.Units roll smoothly on its 6" x 2" swivel phenolic rear casters. Handle height is 40".MODELNUMBERUNIFORMCAPACITYFORK SIZE(W x L)SERVICERANGEOVERALL SIZE(W x L x H)NET WT.(POUNDS)LIST PRICEEACHCBS-64-1 1,000 3" x 25" 2½" to 56" 27" x 62" x 80" 1110 $2,731.00CBS-76-1 1,000 3" x 25" 2½" to 76" 27" x 62" x 93" 1206 2,918.00DC-20/FC-100Basket & Skid StackersMODELNUMBERUNIFORMCAPACITYFORK SIZE(W x L)SERVICERANGENET WT.(POUNDS)LIST PRICEEACHPMSS-50 4,000 4" x 36" 3½" to 50" 1058 $3,147.00PMSS-60 4,000 4" x 36" 3½" to 60" 1078 3414.00DC-20/FC-100MODELNUMBER12V DC STANDARD, OPTIONS ON PG. 43Transport open bottom pallets, skids, baskets, and crates with ease. Features an 18" horizontal load center andoverall fork width of 37". Units roll smoothly on 6" x 2" swivel phenolic rear casters. Handle height is40". Features 12V DC power standard with on-board charger. AC and Air is also available.Power Traction Drive System Option12V DC STANDARD, OPTIONS ON PG. 4312V DC STANDARD, OPTIONS ON PG. 4312V DC STANDARD, OPTIONS ON PG. 4324V DC STANDARD, OPTIONS ON PG. 43Reduce worker fatigue and injury. This factory installed option is available on portable equipment. An alternativeto costly fork trucks, the PTDS includes combination throttle / direction butterfly style controller, an adjustableyoke, and auto reverse emergency "belly" switch. This state of the art option allows a single operator to safely andeasily move products. Power pack is 42" wide. Maximum speed is 2.5 m.p.h. 24V DC system.NET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONPMPS-PTDS POWERED TRACTION DRIVE SYSTEM 156 $4,348.00PMPS-DCR RETROFIT DRUM CARRIER ROTATOR (800# CAPACITY) 239 $595.00BC BENCH TOP STYLE BATTERY CHARGER 8 133.50BCI BATTERY CHARGE INDICATOR GAUGE 1 82.00DC-20/FC-100STANDARDPALLET MASTERDVD or VIDEOAVAILABLESKID ONLYNO PALLETwww.vestil.com Phone (800) 348-086859COUNTER-BALANCEDPALLET MASTER/SERVERCOUNTERBALANCEDSTACKERseries CBSseries PMSSERGONOMIC SOLUTIONS
ERGONOMIC SOLUTIONS60DVD or VIDEOAVAILABLEPhone (800) 348-0868model HYS-96seriesSE/HPNewmodelVWS-770-AAmodelVHPS-2000-FFmodelVWS-770-FFNewmodelSL-118-FFmodel SL-63-FFSKID** & PALLETSDC Powered and Manual StackersDC Powered Stackers handle the following applications: lift and transport skids, bales, andbaskets. Load/unload trucks, stock shelves and handle dies, molds, or pallets. By combininga power lift with an easy to operate manual push, these Hydraulic Stackers (HYS-) are perfectfor maneuvering in tight or congested areas. Complete with on-board charger. Features 24"horizontal load center, adjustable straddle legs (34" to 50" I.D.), and adjustable forks 6" to 24"(O.D.). 6" swivel phenolic rear casters and 4" phenolic front wheels are standard.Manual Stackers are designed to meet the most challenging tasks. Ideal for use in variousworkstation and workplace applications. Maintenance free and easy to use. Full height pushhandle for easy steering and excellent visibility through welded mesh guard. Optional removableplatform available.Manual Hand Winch Stackers feature a heavy duty mast and a unique winch design for easierand safer lifting. Lift and lower by hand winch and steel cable mechanism. 1" lift per handlerevolution. Two rigid and two swivel wheels with brakes for easy maneuvering.Manual Hydraulic Hand Pump Stackers are sturdy and compact to fit through standard doors.Forks are raised by manual hydraulic hand pump operation and released by a lever situated on thehandle. 1" lift per handle pump. Two rigid and two swivel wheels standard.MODELNUMBERSERVICERANGEUNIFORMCAPACITYOVERALL SIZE(W x L x H)NET WT.(POUNDS)LIST PRICEEACH12V DC POWERED STACKERSHYS-60 3" to 60" 1,500 40"-56" x 58" x 70" 688 $3,935.00HYS-96 3" to 96" 1,500 40"-56" x 58" x 69" 855 5,175.00HYS-144 3" to 144" 1,500 40"-56" x 65" x 93½" 925 6,122.00MANUAL HAND WINCH STACKERS / ADJUSTABLE FORKS OVER ADJUSTABLE LEGSVWS-770-AA 1 9 /16" to 60" 770 42 1 /8" x 46 5 /8" x 78" 365 $804.00VHPS-2000-AA 1 3 /8" to 63" 2,000 46" x 60¼" x 82½" 818 1,485.00MANUAL HYDRAULIC HAND PUMP STACKERS / FIXED FORKS OVER FIXED LEGSVWS-770-FF 3 3 /8" to 60" 770 24½" x 46 5 /8" x 78" 316 $759.00VHPS-2000-FF 3¾" to 63" 2,000 27 3 /8" x 60¼" x 82¼" 748 1,239.00OPTIONAL REMOVEABLE PLATFORM, model VWS-PLATE, $121.00 LISTDC-20/FC-175Combination Hand Pump and Electric StackerAn economical alternative DC powered lift stacker. Ideal for maintenance and commercialapplications. This unit can be used as manual hand pump lift or electric powered lift. Ideal whenpower is not available. High quality hydraulic pump and DC lift system. Compact design andstrong steel profile construction. An economical lift to handle tasks such as transporting dies,molds, and skids. Powered with two (2) 12V, 40Ah batteries. Integral battery charger, batterylevel gauge, and adjustable lowering speed. All models are easily maneuverable using the standardpull handle. Individual forks are 6" wide.MODELNUMBEROVERALL FORKSIZE (W x L)LOWEREDHEIGHTRAISEDHEIGHTUNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHSE/HP-63** 26¾" x 42" 3 3 /8" 63" 2,000 750 $1,811.00SE/HP-98** 26¾" x 42" 3 3 /8" 98" 2,000 850 2,243.00SE/HP-118** 26¾" x 42" 3 3 /8" 118" 2,000 990 2,473.00OPTIONAL SOLID PLATFORM, model SL-DK, $222.00 LISTDC-25/FC-92.5Stacker with Powered LiftSemi-electric stackers with powered lift will raise and lower loads quickly and easily. Manualpush operation stackers are made using high quality material and parts. All models are easilymaneuverable using the standard pulling handle. SL stackers are highly efficient and durable.Semi-electric stackers use one 12V, 140Ah battery. Integral battery charger and battery level gauge.Overall fork size is 26¾"W x 42"L. Lowered height is 3 3 /8".Optional 24V traction drive system available. Traction drive is factory installed only.MODELNUMBERRAISEDHEIGHTUNIFORM CAPACITY0" - 63" Raised Ht.UNIFORM CAPACITY63" - 118" Raised Ht.UNIFORM CAPACITY118" - 150" Raised Ht.NET WT.(LBS)LIST PRICEEACHADJUSTABLE FORKS / ADJUSTABLE SUPPORT LEGS (works with pallets & skids)SL-63-AA 63" 2,000 lbs. - - 870 $2,518.00SL-118-AA 118" 2,000 lbs. 1,500 lbs. - 1070 3,033.00SL-137-AA 137" 2,000 lbs. 1,500 lbs. 1,000 lbs. 1140 3,319.00SL-150-AA 150" 2,000 lbs. 1,500 lbs. 1,000 lbs. 1230 3,740.00FIXED FORKS OVER FIXED SUPPORT LEGS (works with skids only)SL-63-FF** 63" 2,000 lbs. - - 830 $2,232.00SL-118-FF** 118" 2,000 lbs. 1,500 lbs. - 1020 2,747.00OPTIONSSL-HC HAND CONTROL 5 $333.00SL-DK SOLID PLATFORM 40 222.00SL-PTDS POWER TRACTION DRIVE SYSTEM 66 1,973.00DC-25/FC-92.5www.vestil.com
Stacker with Powered Drive and Powered LiftFully powered electric stacker transports loads throughout warehouse facilities quickly and withless effort. High torque 24VDC drive and lift motor handles heavy-duty jobs. Ergonomichandle features easy-to-operate throttle with infinite adjustment of forward and reverse speeds,lift/lower controls, proprietary safety-enhancing emergency reverse function, and horn.Includes an electromagnetic disc brake with automatic dead-man feature that activates whenuser releases the handle. Powered lifter has two 12V, 95Ah lead acid deep cycle batteries,integral battery charger, and battery level gauge. Stacker rolls smoothly on poly-on-steel steer& load wheels. Features 0.7 KW drive and 2.0 KW lift motor. 3-4 hour operation at fullcharge - 8 hours when used intermittently.Proprietary safety-enhancing emergency reverse functionWhen actuated, the emergency reverse belly switch instantly reverses direction and moves theunit forward (away from the operator) until the switch is released or after five seconds haveelapsed. The built-in safety circuit will automatically disable the entire unit if the emergencyreverse belly switch is activated for more than 5 seconds after which the unit must be re-set toreturn to normal operating conditions. This state-of-the-art safety device provides a level ofoperator protection which is unmatched by any unit on the market today.Two battery options are available; Absorbed Glass Matt, suffix AGM or Gel Cell, suffix GC. Bothbatteries are completely maintenance free. Sealed construction eliminates periodic watering andcorrosive acid fume spills.DVD or VIDEOAVAILABLEmodel S-118-FF61MODELNUMBERMODELNUMBEROVERALL FORKSIZE (W x L)OVERALL FORKSIZE (W x L)LOWEREDHEIGHTLOWEREDHEIGHTRAISEDHEIGHTRAISEDHEIGHTUNIFORM CAPACITY0" - 62" Raised Ht.UNIFORM CAPACITY0" - 62" Raised Ht.UNIFORM CAPACITY62" - 118" Raised Ht.UNIFORM CAPACITY62" - 118" Raised Ht.UNIFORM CAPACITY118" - 150" Raised Ht.NET WT.(POUNDS)LIST PRICEEACHS-CB-118 23 5 /8" x 30" 1 3 /16" 118" 1,000 lbs. 500 lbs. 1800 $5,639.00BATTERY OPTIONSS-AGM AGM Battery (2x12V) 100 $240.00S-GEL Gel Cell Battery (2x12V) 100 487.00DC-25/FC-92.5NET WT.(POUNDS)LIST PRICEEACHFIXED FORKS / ADJUSTABLE SUPPORT LEGS (works with pallets & skids)S-62-FA 26¾" x 42" 3 3 /8" 62" 2,000 lbs. - - 970 $5,522.00ADJUSTABLE FORKS / ADJUSTABLE SUPPORT LEGS (works with pallets & skids)S-62-AA 26¾" x 42" 3 3 /8" 62" 2,000 - - 990 $5,666.00S-118-AA 26¾" x 42" 2¼" 118" 2,000 1,500 lbs. - 1131 6,625.00S-150-AA 26¾" x 42" 3 3 /8" 150" 2,000 1,500 lbs. 1,000 lbs. 1290 7,165.00FIXED FORKS OVER FIXED SUPPORT LEGS (works with skids only)S-62-FF** 26¾" x 42" 3 3 /8" 62" 2,000 - - 950 $5,236.00S-118-FF** 26¾" x 42" 3½" 118" 2,000 1,500 lbs. - 1091 6,162.00BATTERY OPTIONSS-AGM AGM Battery (2x12V) 100 $240.00S-GEL Gel Cell Battery (2x12V) 100 487.00OPTIONAL SOLID PLATFORM, model SL-DK, $222.00 LISTDC-25/FC-92.5Counter-Balanced Powered Drive LiftCounter balance design is ideal for die loading, machine feeding, and for loading and unloadingtrucks. High torque 24VDC drive and lift motor handles heavy-duty jobs. Ergonomic handlefeatures easy-to-operate throttle with infinite adjustment of forward and reverse speeds, lift/lowercontrols, proprietary safety-enhancing emergency reverse function, and horn. Includes anelectromagnetic disc brake with automatic dead-man feature that activates when the user releases,the handle. Powered lift has two 12V, 95Ah lead acid deep cycle batteries, an integral batterycharger, and battery level gauge. Stacker rolls smoothly on poly-on-steel steer & load wheels.Features 0.7 KW drive and 2.0 KW lift motor. 3-4 hour operation at full charge - 8 hours whenused intermittently. Adjustable forks suitable for different pallets. Individual forks are 3⅛" wide.Overall size is 32¼"W x 78"L. A high level of serviceability simplifies maintenance and prolongsequipment life. Easy access battery compartment simplifies battery maintenance.Proprietary safety-enhancing emergency reverse functionWhen actuated, the emergency reverse belly switch instantly reverses direction and moves theunit forward (away from the operator) until the switch is released or after five seconds haveelapsed. The built-in safety circuit will automatically disable the entire unit if the emergencyreverse belly switch is activated for more than 5 seconds after which the unit must be re-set toreturn to normal operating conditions. This state-of-the-art safety device provides a level ofoperator protection which is unmatched by any unit on the market today.Two battery options are available; Absorbed Glass Matt, suffix AGM or Gel Cell, suffix GC. Bothbatteries are completely maintenance free. Sealed construction eliminates periodic watering andcorrosive acid fume spills.SKID & PALLETSmodelS-CB-118www.vestil.com Phone (800) 348-0868ERGONOMIC SOLUTIONS
62modelPEL-88PEL-100Programmable Index,model PEL-INDEX115V AC ChargerDVD or VIDEOAVAILABLEStandard PushButton Control PanelHandheld push-buttoncontrol, model PEL-2PBmodelPEL-400-57PEL-400-72MODELNUMBERPLATFORMSIZE (W x L)UNIFORMCAPACITY (LBS.)SERVICERANGECASTERSIZENET WT.(POUNDS)LIST PRICEEACHSTEEL QUICK LIFTSPEL-88 23½" x 18½" 175 5½" to 57" 3" 140 $1,922.00PEL-100 23½" x 18½" 125 5½" to 72" 3" 145 2,071.00PEL-400-57 24" x 20" 400 6½" to 57" 4" 440 2,629.00PEL-400-72 24" x 20" 400 6½" to 72" 4" 460 2,909.00ALUMINUM QUICK LIFTSPEL-88-A 23½" x 18½" 175 5½" to 57" 3" 115 $2,075.00PEL-100-A 23½" x 18½" 125 5½" to 72" 3" 130 2,201.00DC POWERED QUICK LIFT OPTIONSPEL-88-AC OPTIONAL 115V OR 230V, 1 PHASE SUPPLY OPTION $671.00PEL-400-AC OPTIONAL 230V 1 PHASE SUPPLY OPTION 1,343.00PEL-88-AC/DC OPERATES ON EITHER 24V DC OR 115V OR 230V, 1 PHASE 784.00PEL-400-AC/DC OPERATES ON EITHER 24V DC OR 230V, 1 PHASE ONLY 1,416.00PEL-2PB HANDHELD PUSH-BUTTON CONTROL 97.00PEL-RRC WIRELESS REMOTE CONTROL FOR THE QUICK LIFT $790.00PEL-INDEX-4 PROGRAMMABLE HEIGHT INDEXING 4 SETPOINTS $1,760.00PEL-INDEX-21 PROGRAMMABLE HEIGHT INDEXING 21 SETPOINTS 1,760.00DC-25/FC-92.5MODELNUMBERmodelPEL-88APEL-100AVersatile QuickliftsPLATFORMSIZE (W x L)DC Powered Quick LiftsQuiet, lightweight units transport and position loads quickly with justthe push of a button. Battery operated. High density polyethyleneplatform. 9" horizontal load center. Features low profile designfor maneuvering in narrow aisles and confined spaces. Poly casters;two swivel and two swivel-locking are standard on all units with theexception of the PEL-400 units. The PEL-400 comes standard withrigid front wheels and swivel rear wheels with locks. 24VDC system,with 115VAC on-board charger. Steel units have a powder coat bluefinish. A detachable handheld control with coil cord for remoteoperation is optional. The optional Programmable Height Indexingoption allows you to preset multiple working heights at the touch of abutton. Custom end attachments available.24V DC STANDARDSERVICERANGEOVERALL SIZE(W x L x H)24V DC STANDARD, OPTIONS BELOWAn economical alternative DC powered lift. Ideal for light industrial or commercial applications.Features durable belt over pulley design. This lifter has a 62" high service range and four swivelcasters to provide great versatility and convenience. White high density (HDPE) plastic platformis scratch resistant, easy to clean, and retains an attractive appearance. Just 18 seconds for the 57"platform travel. Top wheels facilitate loading into a pick-up or van. Uniform capacity is 330 lbs.Tool tray and remote battery charger are standard.CASTERSFRONT/BACKNET WT.(LBS.)LIST PRICEEACHPEL-33 20½" x 18" 5 1 /8" to 62" 20½" x 33" x 73½ 3" / 4" 128 $2,112.00PEL-S SINGLE SPINDLE 7 $169.00PEL-DS DOUBLE SPINDLE 11 193.00DC-25/FC-92.5ERGONOMIC SOLUTIONSmodel MWP-220Manual Work PositionersThese lightweight lifts are designed to take the strain out of any lifting job. Ideal for use in narrow aislesand confined spaces. Platform height is adjustable with a manual hand winch. An auto brake systemallows for controlled lowering. Front wheels are swivel, back are swivel with brakes. Quick changeattachments available - contact factory for details.MODELNUMBERPLATFORMSIZE (W x L)SERVICERANGEUNIFORMCAPACITY (LBS.)NET WT.(POUNDS)LIST PRICEEACHMWP-220 18½" x 23½" 5¼" to 59" 220 105 $643.00MWP-440 18½" x 23½" 5¼" to 59" 440 155 674.00MWP-VBLK V BLOCK ATTACHMENT 17 $81.00MWP-RR REEL ROTATOR ATTACHMENT 25 221.00MWP-DSPIN DOUBLE SPINDLE ATTACHMENT 11 76.00MWP-SPIN SINGLE SPINDLE ATTACHMENT 7 57.00DC-25/FC-92.5Phone (800) 348-0868SINGLE SPINDLE DOUBLE SPINDLE REEL ROTATOR V BLOCKwww.vestil.com
Lite Load LiftsLift and transport loads from delivery trucks to docks, or use toinventory storage systems. Easy to operate with either a hand winch orfoot pump. The platform lifts approximately 1" per winch rotation orfoot pump stroke. Available in steel or aluminum construction. Modelswith the suffix -FW roll smoothly on 6" x 2" poly-on-poly rear wheelswith 2" semi-steel front wheels. Models with the suffix -4SFL have 8"x 2" poly-on-poly rear wheels, four swivel casters, and a hand operatedfloor lock. Located on the handle are two rollers to ease loading intodelivery trucks. Horizontal load center is 10". Low Profile units have adeck height of ¼" with 2" high side lips.LITE LOAD LIFTSMODELNUMBERSTEEL CONSTRUCTIONDESCRIPTIONPLATFORMSIZE (W x L)SERVICERANGEUNIFORMCAPACITYNET WT.(LBS.)LIST PRICEEACHLLW-202058-FW* WINCH 20" x 20" 3¼" to 58" 500 145 $488.00LLW-242060-4SFL WINCH 24" x 20" 6¼" to 59" 500 212 704.00LLH-202053-FW* FOOT PUMP 20" x 20" 3¼" to 53" 500 139 $759.00LLH-242056-4SFL FOOT PUMP 24" x 20" 6¼" to 57" 500 194 941.00ALUMINUM CONSTRUCTIONALLW-2020-FW* WINCH 20" x 20" 3¼" to 58" 400 130 $568.00ALLW-2420-4SF WINCH 24" x 20" 6¼" to 59" 400 145 818.00ALLH-2020-FW* FOOT PUMP 20" x 20" 3¼" to 53" 400 130 $960.00ALLH-2420-4SFL FOOT PUMP 24" x 20" 6¼" to 57" 400 145 1,211.00DC-25/FC-92.5LOW PROFILE LITE LOAD LIFTSMODELNUMBERDESCRIPTIONPLATFORMSIZE (W x L)SERVICERANGEUNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHSTEEL CONSTRUCTIONLLPW-500-FW** WINCH 20" x 20" ¼" to 55" 500 176 $529.00LLPW-500-4SFL** WINCH 20" x 20" ¼" to 58" 500 200 745.00LLPH-500-FW** FOOT PUMP 20" x 20" ¼" to 50" 500 180 $737.00LLPH-500-4SFL** FOOT PUMP 20" x 20" ¼" to 50" 500 205 941.00ALUMINUM CONSTRUCTIONALLPW-500-FW** WINCH 20" x 20" ¼" to 55" 400 48 $617.00ALLPW-500-4SFL** WINCH 20" x 20" ¼" to 58" 400 91 867.00ALLPH-500-FW** FOOT PUMP 20" x 20" ¼" to 50" 400 46 $1,009.00ALLPH-500-4SFL** FOOT PUMP 20" x 20" ¼" to 50" 400 89 1,259.00DC-25/FC-92.5COUNTER-BALANCED LITE LOAD LIFT (STEEL) (Includes weight counter-balance)MODELNUMBERDESCRIPTIONPLATFORMSIZE (W x L)SERVICERANGEDVD or VIDEOAVAILABLELLH-202053-FWUNIFORMCAPACITYNET WT.(POUNDS)LLW-202058-FWshown with LLW-WLLIST PRICEEACHLLCB-202058 WINCH 20" x 20" 3½" to 59" 300 475 $713.00UNIFORM CAPACITY OF 300 LBS. IS BASED ON A 10" HORIZONTAL LOAD CENTERDC-25/FC-92.5ALLW-2020-FWmodel ALLPH-500-4SFLmodel LLPH-500-FW63ALLW-2420-4SFLmodel LLPW-500-FWmodel LLPH-500-4SFLOPTIONS FOR LITE LOAD LIFTSMODELNUMBERMODELNUMBEROVERALL SIZE(W x L x H)DESCRIPTIONSERVICERANGENET WT.(POUNDS)LIST PRICEEACHLLW-WL* WHEEL LOCK, FACTORY INSTALLED $61.00LLW-FL** HAND OPERATED FLOOR LOCK, FACTORY INSTALLED $61.00LLH-DSP 2 SPEED FOOT PUMP WITH FLOW CONTROL & PRESSURE RELIEF 221.00*/** LOCK OPTION ONLY FIT SOME LIFTS - NOTE ASTERISK NEXT TO MODEL # DC-25/FC-92.5Portable Hand Winch LifterThis lift is easy to maneuver with its 4" x 1" wheels, two rigid, two locking swivel.Features a removable platform with adjustable forks underneath for increasedversatility. Platform size is 20" wide by 20" long. The handle length on the handcrank may be adjusted to increase or decrease lifting/lowering speeds. Lifts 2½"per rotation. The forks measure 19¾" long. Uniform capacity 330 pounds.LIST PRICEEACHHWL-330 32 11 /16" x 22 13 /16" x 58" 3" TO 43½" 110 $463.00DC-25/FC-92.5model LLCB-202058model HWL-330OPTIONAL WHEELLOCK, model LLW-WLHAND OPERATEDFLOOR LOCKmodel, LLW-FLwww.vestil.com Phone (800) 348-0868ERGONOMIC SOLUTIONS
64DVD or VIDEOAVAILABLEHydra CartsTransport loads in the lowered position and maneuver work materials to an ergonomicheight. Ideal in compact work areas. Safe and easy one person handling of loads up to1,000 pounds. An efficient way to unload heavy objects from semi trailers. Rugged steelconstruction for years of service. Dependable precision built hydraulic system is activatedby easy action foot lever. Additional rollers on the handle make loading into a delivery truckeasy. Steel construction. Approximately 1" of lift per pump.model HYDRA-2model HYDRA-HDMODELNUMBERPLATFORMSIZE (W x L)SERVICERANGEUNIFORMCAPACITY (LBS.)NET WT.(POUNDS)LIST PRICEEACHHYDRA-2 20" x 16" 0 to 52" 750 240 $659.00HYDRA-4 20" x 22" 5½" to 52" 750 260 713.00HYDRA-HD 24" x 22" 5½" to 55" 1,000 250 871.00DC-25/FC-92.5model HYDRA-HShown attached to unitmodel HYDRA-4HYDRA CART OPTIONSMODELNUMBERLIST PRICEEACHDESCRIPTIONHYDRA-AF-18 3" WIDE BY 18" LONG FORKS $353.00HYDRA-H HAND CRANK WINCH AND HOOK OPTION 212.00HYDRA-FL FLOOR LOCK (HYDRA-4 & HYDRA-HD ONLY) 94.00Hefti-Liftsmodel HYDRA-AF-18O.D. of forks 6" to 22"modelHYD-5-EPmodelHYD-5DVD or VIDEOAVAILABLEmodelHYD-10-DCUser-friendly portable hydraulic lifts provide reliable, powerful lifting when moving andpositioning loads. Includes removable platform for operations requiring forks (except forHYD-15). Manual hydraulic foot pump yields ¾" of platform travel per stroke. Non-slipchain is used for accurate positioning. Units roll easily on two rigid andtwo swivel poly-on-steel casters and include a foot operated brake. Notfor use with pallets. All welded steel construction with chrome platformand uprights. Each fork is 4½"W x 2½"H, the fork length is the same asthe platform length. Overall fork width is 22".model H-RELEASEMODELNUMBERPLATFORMSIZE (W x L)SERVICERANGEUNIFORMCAPACITYNET WT.(LBS.)LIST PRICEEACHOPERATIONHYD-5 23" x 24" 3½" to 44" 880 FOOT PUMP 245 $686.00HYD-10 23" x 24" 3½" to 59" 880 FOOT PUMP 275 789.00HYD-15** 23" x 31½" 3½" to 63" 1,500 FOOT PUMP 420 866.00HYD-10-DC 22 1 /8" x 25¾" 3½" to 59" 880 12V DC POWER 440 2,390.00EXTENDED LENGTHHYD-5-EP 23" x 40" 3½" to 44" 400 FOOT PUMP 276 $772.00HYD-10-EP 23" x 40" 3½" to 59" 300 FOOT PUMP 320 880.00STAINLESS STEEL CONSTRUCTIONHYD-5-PSS* 23" x 24" 3½" to 44" 880 FOOT PUMP 245 $2,088.00OPTIONAL HAND RELEASE, MODEL H-RELEASE, $42.00 LISTDC-25/FC-92.5*STAINLESS STEEL DECK, FORK FRAME, BASE & HANDLE. (REMAINDER PARTS ARE CHROME PLATED)**DOES NOT COME WITH PLATFORMERGONOMIC SOLUTIONSmodelHYD-5-PSSmodel KLIFT-220"L" shaped holding bracket"T" shaped holding bracketFully Portable Aluminum Load LifterIdeal for the traveling salesperson as well as service and installation crews. Weighs amodest 59 pounds, yet safely lifts and positions up to 220 uniform pounds. Storeseasily in a truck or a car. Rolls smoothly on 4" x 2½" rear swivel casters and 3" x 1"front wheels. The overall size of the unit is 22¾"W x 30¾"L x 55"H.MODELNUMBERPLATFORMSIZE (W x L)SERVICERANGELOADCENTERSTRADDLEWIDTHNET WT.(POUNDS)LIST PRICEEACHKLIFT-220 21¾" x 19¾" 6½" to 47" 9¾" 21½" 59 $3,743.00DC-20/FC-100Adjustable Box StackerThe Adjustable Box Stacker is specially designed for transporting, stacking, and lifting plasticcrates and similar types of containers. All models are compact and light weight. Both forkwidth and box clamps are adjustable to fit different size boxes and containers. All box clampsare rubber coated for extra grip. Uniform capacity is 380 pounds.MODELNUMBERFORKLENGTHSERVICERANGENET WT.(POUNDS)LIST PRICEEACHOPERATIONABS-130 19½" 2¾" to 42¼" FOOT PUMP 156 $644.00DC-25/FC-92.5Phone (800) 348-0868www.vestil.com
65Hand Winch Lift TrucksCompact lift trucks are designed to lift material to and from shelves, move office equipment, andinstall ceiling/wall appliances. Constructed of durable steel-and-aluminum. The rugged 4" wide by1¾" thick steel forks measure 22" long (20½" O.D.). Operated by a hand-crank winch that featuresa reversible handle and a hold-down device for securing the carriage during transport. Forks raise1" per complete hand crank rotation. The non-adjustable forks can be inverted to provide differentheight ranges. Two 8" non-marking rear wheels, two 2" front swivel casters.DVD or VIDEOAVAILABLEMODELNUMBERUNIFORMCAPACITYLOWEREDHEIGHTRAISED HEIGHTFORKS DOWN/UPOVERALL SIZE(W x L x H)NET WT.(LBS.)LIST PRICEEACHSTANDARD DESIGN (Fixed Straddle Width: 13" (I.D.) and 21½" (O.D.))A-LIFT-R 500 3½" / 23½" 47" / 67" 24" x 35" x 68" 136 $691.00A-LIFT-R-HP 400 3½" / 23½" 97" / 117" 24" x 35" x 68" 140 799.00STRADDLE DESIGN (Adjustable Straddle Width: 21½" to 36" (I.D.) and 29" to 44" (O.D.))A-LIFT-S 500 1¼" / 21¼" 47" / 67" 29" x 43" x 68" 140 $735.00A-LIFT-S-HP 400 1¼" / 21¼" 97" / 117" 29" x 43" x 68" 145 819.00A-LIFT-S-EHP 350 1¼" / 21¼" 118" / 142" 29" x 43" x 79" 154 873.00COUNTERBALANCE DESIGN (counterweight included)A-LIFT-CB 500 2" / 21¼" 47" / 67" 29" x 47" x 68" 396 $982.00A-LIFT-CB-HP 400 2" / 21¼" 97" / 117" 29" x 47" x 68" 418 1,063.00A-LIFT-CB-EHP 350 2" / 21¼" 118" / 142" 29" x 47" x 68" 449 1,100.00OPTIONSA-LIFT-DK DECK PLATFORM (20½"W x 24¼"L) 25 $87.00A-LIFT-PN 10" PNEUMATIC REAR WHEELS (cannot use with CB units) 20 53.00DC-25/FC-92.5Portable Aluminum Load LifterPortable Aluminum Load Lifter is durable, lightweight,and constructed of corrosion resistant aluminum. Idealin shipping and receiving areas to load and unload palletracking and to move parts. This unit folds up and down forcompact storage and easy transportation. Ultra low profiledesign with ramp is great for appliance, office, and furniturestores. Uniform capacity is 200 lbs.STRADDLE DESIGNmodel A-LIFT-S13"STANDARD DESIGNmodel A-LIFT-RCOUNTERBALANCEDDESIGNmodel A-LIFT-CBNewMODELNUMBERPLATFORMSIZE (W x L)SERVICERANGELOADCENTERSTRADDLEWIDTHNET WT.(POUNDS)LIST PRICEEACHPALL-200 17" x 14" 1" to 61" 7" 17½" 68 $718.00DC-20/FC-100model PALL-200Portable Worksite LiftIdeal for positioning loads where they are needed. Includes a lifting platform and anoverhead lifting boom for unique applications. Features manual hand crank cable winchwith hook. Portability is easy with 8" x 2" phenolic swivel casters and push handle.Overall size is 37" wide x 48½" long x 90" high. Unit knocks-down in six pieces - base,legs and upright. Ideal for storage in tight places and for transportation in the back of avehicle. Welded steel construction with painted finish. Uniform capacity is 500 pounds.Distance between front outriggers is 27 5 /8".DVD or VIDEOAVAILABLEMODELNUMBERPLATFORMSIZE (W x L)PLATFORMSERVICE RANGESERVICERANGEBOOMREACHNET WT.(POUNDS)LIST PRICEEACHLIFTER-2 20" x 20" 14¾" to 70" 14¾" to 70" 25" 310 $1,134.00DC-25/FC-92.5Adjustable Pallet StandsThe Adjustable Height Pallet Stand is designed to manually adjust to three different ergonomicworking heights. Unit includes a three position manual adjusting bar with spring assist to help raiseand lower the deck. The Pallet Stand must be empty when adjusting the height. Unit is welded steelconstruction and painted blue. Optional bolt on manual carousel is 40" in diameter by 2" tall androtates 360°.MODELNUMBERPLATFORMSIZE (W x L)UNIFORMCAPACITYLOWEREDHEIGHTFIRSTSETTINGSECONDSETTINGTHIRDSETTINGNET WT.(LBS.)LIST PRICEEACHPS-4045 40" x 42" 5,000 10" 20¼" 30½" 35¼" 224 $518.00PS-4045/CA 40" x 42" 4,000 12¼" 22½" 32¾" 37½" 320 900.00PS-4045/CA-CK 40" x 42" 1,500 19¾" 30" 40¼" 45" 358 1,027.00PS-4045-CK 40" x 42" 1,500 17½" 27¾" 38" 42¾" 262 557.00+CASTER OPTION CONSISTS OF 6" x 2" PHENOLIC (2) RIGID AND (2) SWIVEL CASTERS WITH BRAKEDC-25/FC-70DVD or VIDEOAVAILABLEPS-4045/CAPS-4045-CKwww.vestil.com Phone (800) 348-0868ERGONOMIC SOLUTIONS
66Custom FinishAvailableResidential Wheel Chair LiftDesigned for residential use to overcome steps or vertical barriers. Safe and convenient to use with manualor powered wheel chairs having a maximum width of 32". Designed to be used outdoors, operates onbattery power and is thus unaffected by a power outage.MODELNUMBERPLATFORMOVERALLUNIFORM CAPACITY(POUNDS)RAISEDHEIGHTNET WT.(LBS.)LIST PRICEEACHEHLTG-WCL* 32"W x 50"L 750 36" 785 $4,481.00OPTIONSEHLTG-PSG UNDER-PLATFORM ELECTRIC SAFETY GUARD 40 $308.00EHLTG-SSS SOLID STEEL SHROUD 156 800.00N4-WM2PB WALL MOUNT CONTROL (EACH) -- 230.00RRC-2PB WIRELESS REMOTE CONTROL -- 704.00EHLTG-HGATE HINGED GATE, GROUND SIDE 120 1,370.00EHLTG-SHR SOLID HANDRAIL 196.00EHLTG-PMG PORCH MOUNTED GATE W/MECHANICAL INTERLOCK 145 1,428.00EHLTG-SKIRT ACCORDION SAFETY SKIRT (SIDES ONLY) -- 680.00EHLTG-CWP EXTREME COLD WEATHER PACKAGE -- 263.00*CHOOSE FROM BUTTER CREAM, BROWN, BLACK OR WHITEDC-20/FC-70DVD or VIDEOAVAILABLECustom FinishAvailableDVD or VIDEOAVAILABLEBattery Charger& Battery ChargeIndicator StandardMODELNUMBERAUTOMATIC "FLIP-UP"RAMP/ROLL-OFF GUARDfeatures a non-slip surfaceSelf-Elevating Spring TablesPLATFORMSIZE (W x L)UNIFORMCAPACITYSAFETY RAILSremovable for storageSERVICERANGECASTERSIZEOPTIONAL UNDERPLATFORM SAFETYGUARD protectsagainst pinch pointsOVERALL SIZE(W x L x H)NET WT.(LBS.)OPTIONAL SOLIDSTEEL SHROUDprotects againstpinch pointsDesigned to automatically raise or lower as materials are removed or added to the platform, keepingmaterial at an ergonomic work height. Increase productivity while reducing potentially harmful bendingand twisting motions. The counter balance springs can easily be added or removed to adjust weight-toheightsensitivity. This feature allows the user to conveniently set the table to fit each application. The ETS-230/460 has polyurethane casters while the ETS-840/1120 rolls smoothly on mold-on-rubber casters.LIST PRICEEACHETS-230 20" x 20" 230 11" to 33" 4" x 1¼" 21" x 28" x 37" 189 $1,007.00ETS-460 20" x 20" 460 11" to 33" 4" x 1¼" 21" x 28" x 37" 216 1,133.00ETS-840-30 30" x 30" 840 15" to 38" 4" x 2" 31" x 38" x 52" 448 1,812.00ETS-1120-18 18" x 18" 1,120 15" to 38" 4" x 2" 19" x 26" x 52" 380 1,492.00ETS-1120-24 24" x 24" 1,120 15" to 38" 4" x 2" 25" x 32" x 52" 385 1,561.00Auto-Hite CartsDC-30/FC-70The Auto-Hite Cart raises or lowers as materials are removed or added to the platform, keeping materialat an ergonomic work height. Increase efficiency while reducing potentially harmful bending and twistingmotions. Carts utilize tension springs which can be adjusted in order to fit each particular application. Allsteel construction with removable handle. Polyurethane casters are 5" x 2", (2) rigid and (2) swivel withbrake. Overall height is 38".ERGONOMIC SOLUTIONSSCSC-500-4242SCSC-800-2040DVD or VIDEOAVAILABLEMODELNUMBERPLATFORMSIZE (W x L)UNIFORMCAPACITYSERVICERANGEMOVEMENT*LBS. / INCHOVERALLSIZE (W x L)NET WT.(LBS.)LIST PRICEEACHSCSC-500-2040 20" x 40" 500 14" to 34" 25# / 1" 20" x 48" 359 $1,027.00SCSC-500-4242 42" x 42" 500 14" to 34" 25# / 1" 42" x 48" 366 1,274.00SCSC-1000-4242 42" x 42" 1,000 14" to 34" 50# / 1" 42" x 48" 368 1,418.00SCSC-1000-4848 48" x 48" 1,000 14" to 34" 50# / 1" 48" x 55" 419 1,898.00SCSC-2000-4848 48" x 48" 2,000 14" to 34" 100# / 1" 48" x 55" 531 2,427.00*APPROXIMATE RATIO - CHECK WITH FACTORY FOR MINIMUM WEIGHT REQUIREMENTSSelf-Elevating Lift CartsMODELNUMBERPLATFORMSIZE (W x L)UNIFORMCAPACITYSERVICERANGEOVERALL SIZE(W x L x H)NET WT.(POUNDS)DC-25/FC-70Automatic height adjustment provides ergonomic work positioning to increase productivity and decreasework related repetitive motion injuries. Model SCSC-400-2032 has one spring while the SCSC-800-2040has two springs. Heavy-duty steel construction with removable bolt-on handle. 2 rigid and 2 swivel 5" x 1"poly-on-poly casters with brake standard.LIST PRICEEACHSCSC-400-2032 20" x 32" 400 13¾" to 30" 20" x 40" x 30½" 200 $551.00SCSC-800-2040 20" x 40" 800 14½" to 31" 20" x 48" x 35½" 300 650.00DC-25/FC-100Phone (800) 348-0868www.vestil.com
Long Deck CartsThe Long Deck Cart is perfect for sheet and strip handling, ergonomic load positioning, andhandling long awkward material loads. Platform height is adjusted with manual hydraulic footpump. Structural steel base helps to distribute the load evenly. Unit comes standard with (4)swivel 5" x 2" polyurethane casters and dual floor locks. (¼" thick deck)MODELNUMBERPLATFORMSIZE (W x L)UNIFORMCAPACITYRAISEDHEIGHTLOWEREDHEIGHTNET WT.(POUNDS)LIST PRICEEACHLDLT-3060 30" x 60" 2,000 48" 31" 518 $1,489.00LDLT-3072 30" x 72" 2,000 48" 31" 563 1,522.00LDLT-3096 30" x 96" 2,000 48" 31" 638 1,904.00LDLT-30120 30" x 120" 2,000 48" 31" 771 1,947.00AC POWER 115, 208-230, 460V - 1 OR 3 PHASE, MODEL LDLT-AC, $875.00 LISTDC-20/FC-70DC POWER 12V (BATTERY CHARGER INCLUDED), MODEL LDLT-DC, $865.00 LISTRECIPROCATING AIR/OIL POWER WITH FOOT TREADLE CONTROL, MODEL LDLT-RECIPR, $417.00 LIST67Hydraulic Post TablesFoot-operated hydraulic post lift tables are built for heavy-dutyshop use. They are good for many material handling uses including:lifting dies and castings, moving machine parts, positioning welders'work, leveling feed material for pump presses, conveyors and pressbrakes, and similar material handling jobs. Posts are telescoping tohelp stabilize and support loads during operation. Units include fourcasters; two locking swivel with brakes and two rigid.Light-duty units feature a single-speed foot pump. Heavy-duty unitsfeature a two-speed foot pump for maximum operator convenience.All foot pumps include a down speed control valve for safe platformlowering.DC units include a 12V DC electric motor to raise and lower theplatform. They also include a battery, on-board charger, and a handcontrol on an 8 ft. coil cord.Model HT-02-1616A includes a platform that swivels 360° for use asa turntable. Model HT-02-1616A and HT-05-1818A standard with aremovable rubber platform cover.Partially stainless steel Post Tables are available. The platform, frame,handle, caster rigs, and hardware are all stainless steel. Pump assemblyand scissor legs are zinc plated.PP stands for poly-on-poly casters.*PS stands for poly-on-steel castersmodelHT-02-1616AmodelHT-20-2436AmodelHT-10-2036A-SSmodelHT-05-1818AmodelHT-60-2436modelHT-20-2436A-SSmodelHT-10-2036AmodelHT-20-2436-DCNewMODELNUMBERPLATFORMSIZE (W x L)UNIFORMCAPACITYSERVICERANGENUMBEROF POSTSCASTER*SIZE/TYPENET WT.(LBS.)LIST PRICEEACHOPERATIONSTEEL CONSTRUCTIONHT-02-1616A 16" x 16" 200 49" to 31" 1 4" x 1¼" PP 1-SPEED FOOT PUMP 120 $328.00HT-03-1616 16" x 16" 300 49" to 31" 1 4" x 1¼" PS 1-SPEED FOOT PUMP 120 460.00HT-05-1818A 18" x 18" 500 49" to 31" 2 4" x 1¼" PP 1-SPEED FOOT PUMP 125 501.00HT-10-2036A 20" x 36" 1,000 54" to 36" 2 5" x 1½" PS 1-SPEED FOOT PUMP 275 644.00HT-20-2436A 24" x 36" 2,000 54" to 36" 4 5" x 1½" PS 1-SPEED FOOT PUMP 323 $913.00HT-20-3036A 30" x 36" 2,000 54" to 36" 4 5" x 1½" PS 1-SPEED FOOT PUMP 400 960.00HT-20-3042 30" x 42" 2,000 54" to 36" 4 4" x 2" PHENOLIC 2-SPEED FOOT PUMP 450 983.00HT-20-3248 32" x 48" 2,000 54" to 36" 4 4" x 2" PHENOLIC 2-SPEED FOOT PUMP 475 1046.00HT-30-2436 24" x 36" 3,000 54" to 36" 4 4" x 2" PHENOLIC 2-SPEED FOOT PUMP 330 $926.00HT-30-3036 30" x 36" 3,000 54" to 36" 4 4" x 2" PHENOLIC 2-SPEED FOOT PUMP 485 974.00HT-30-3042 30" x 42" 3,000 54" to 36" 4 4" x 2" PHENOLIC 2-SPEED FOOT PUMP 470 986.00HT-40-2436 24" x 36" 4,000 54" to 36" 4 4" x 2" PHENOLIC 2-SPEED FOOT PUMP 441 $1,000.00HT-40-3036 30" x 36" 4,000 54" to 36" 4 4" x 2" PHENOLIC 2-SPEED FOOT PUMP 462 1,045.00HT-40-3042 30" x 42" 4,000 54" to 36" 4 4" x 2" PHENOLIC 2-SPEED FOOT PUMP 475 1,059.00HT-60-2436 24" x 36" 6,000 54" to 36" 4 6" x 2½" PHENOLIC 2-SPEED FOOT PUMP 577 $1,086.00HT-60-3248 32" x 48" 6,000 54" to 36" 4 6" x 2½" PHENOLIC 2-SPEED FOOT PUMP 594 1,198.00HT-20-2436-DC 24" x 36" 2,000 54" to 36" 4 4" x 2" PHENOLIC 12V DC POWER 390 $1,808.00HT-20-3036-DC 30" x 36" 2,000 54" to 36" 4 4" x 2" PHENOLIC 12V DC POWER 482 1,848.00PARTIALLY STAINLESS STEEL CONSTRUCTIONHT-02-1616A-PSS 16" x 16" 200 49" to 31" 1 4" x 1¼" PP 1-SPEED FOOT PUMP 120 $444.00HT-05-1818A-PSS 18" x 18" 500 49" to 31" 2 4" x 1¼" PP 1-SPEED FOOT PUMP 125 528.00HT-10-2036A-PSS 20" x 36" 1,000 54" to 36" 2 5" x 1½" PP 2-SPEED FOOT PUMP 275 $1,161.00HT-20-2436A-PSS 24" x 36" 2,000 54" to 36" 4 5" x 1½" PP 2-SPEED FOOT PUMP 323 $1,326.00HT-20-3036A-PSS 30" x 36" 2,000 54" to 36" 4 5" x 1½" PP 2-SPEED FOOT PUMP 400 1,548.00LOW PROFILE & SHORT PUMP LIFT RANGE AVAILABLE. CONSULT FACTORY. AC, DC, LINEAR ACTUATED or AIR/OIL AVAILABLE.MODEL NUMBERS WITH THE SUFFIX "A" ARE SHIPPED KNOCK-DOWNDC-20/FC-70www.vestil.com Phone (800) 348-0868ERGONOMIC SOLUTIONS
68PT12-10Post Lift TablesLow profile foot pump hydraulic post lift tables utilize a formed base and a telescoping cylinder toachieve a more versatile lifting range.PT2436EMODELNUMBERPLATFORMSIZE (W x L)UNIFORM CAPACITY(POUNDS)SERVICERANGENET WT.(POUNDS)LIST PRICEEACHPT12-10 20" x 30" 1,000 25" to 37" 175 $477.00PT12-20 24" x 36" 2,000 25" to 37" 220 567.00PT12-40 24" x 36" 4,000 25" to 37" 270 666.00PT2436E* 24" x 36" 2,000 34" to 52" 240 $1,240.00*LINEAR ACTUATED POWERDC-20/FC-70Mechanical Post TablesmodelMT-2436-LPAdjustable height portable tables are well suited for a wide variety of material handling applications.Moves smoothly on two rigid and two swivel 5" x 2" polyurethane casters. All welded steelconstruction (¼" deck) and blue powder coat top. Provides positive height adjustment withoutdownward drift. Features a two-speed manual gear mechanism to move heavy loads at ⅛" per crankrotation or lighter loads at 5 /16" per crank rotation. DC powered unit includes an on-board charger.NewmodelMT-2436-LP-DCCustom FinishAvailableNewMODELNUMBERPLATFORMSIZE (W x L)UNIFORMCAPACITYRAISEDHEIGHTLOWEREDHEIGHTNET WT.(LBS)LIST PRICEEACHOPERATIONMT-2436-LP 24" x 36" 2,000 42" 24" LOW PROFILE 330 $894.00MT-2442-LP 24" x 42" 2,000 42" 24" LOW PROFILE 380 1,312.00MT-2448-LP 24" x 48" 2,000 42" 24" LOW PROFILE 380 1,449.00MT-2460-LP 24" x 60" 2,000 42" 24" LOW PROFILE 375 1,815.00MT-3036-LP 30" x 36" 2,000 42" 24" LOW PROFILE 362 1,002.00MT-3042-LP 30" x 42" 2,000 42" 24" LOW PROFILE 425 1,425.00MT-3048-LP 30" x 48" 2,000 42" 24" LOW PROFILE 475 1,632.00MT-3060-LP 30" x 60" 2,000 42" 24" LOW PROFILE 482 1,928.00MT-2436-HP 24" x 36" 2,000 46" 28" HIGH PROFILE 375 $912.00MT-2442-HP 24" x 42" 2,000 46" 28" HIGH PROFILE 415 1,352.00MT-3042-HP 30" x 42" 2,000 46" 28" HIGH PROFILE 450 1,472.00MT-3048-HP 30" x 48" 2,000 46" 28" HIGH PROFILE 490 1,686.00MT-DC 115V AC POWER, 24V HAND HELD CONTROL, 80 $2,200.00MT-AC 12V DC POWER OPTION, HAND HELD CONTROL 30 2,200.00Linear Actuated Elevating Cart12V DC STANDARDDC-20/FC-70Transport materials from workstation to workstation with ease. Platform is raised and lowered with anelectric linear actuator for precise positioning. Linear actuator will not allow platform to drift down - acommon problem with hydraulic carts. This linear actuated cart is powered with a 12V DC battery andfeatures an on-board charger. Hand held pendant control connects to power unit with a 6 foot coil cord.Emergency stop button standard on hand control. Includes two rigid and two swivel casters.Model CART-500-LA-PSS: Platform, frame, handle, caster rigs, and hardware are stainless steel. Scissorlegs are zinc-plated. Battery pack, charger, and hand control are plastic. Linear actuator is plastic with achrome-plated piston. Wheels are poly-on-poly.ERGONOMIC SOLUTIONSmodelCART-660-MmodelCART-500-LAMODELNUMBERPLATFORMSIZE (W x L)UNIFORMCAPACITYLOWEREDHEIGHTRAISEDHEIGHTNET WT.(POUNDS)LIST PRICEEACHSTEEL CONSTRUCTIONCART-500-LA 19½" x 32" 500 14" 35" 330 $1,110.00PARTIALLY STAINLESS STEEL CONSTRUCTIONCART-500-LA-PSS 19½" x 32" 500 14" 35" 330 $1,332.00Mechanical Scissor CartMODELNUMBERPLATFORMSIZE (W x L)UNIFORMCAPACITYLOWEREDHEIGHTRAISEDHEIGHTNET WT.(POUNDS)DC-25/FC-70Raise and lower material quickly and easily with Mechanical Scissor Cart. Cart rolls smoothlyon two rigid and two swivel casters. Mechanical screw drive provides precise positioning with nodownward drift. Partially stainless steel carts are available. The platform, frame, handle, caster rigs,and hardware are all stainless steel. Crank assembly and scissor legs are zinc plated. Wheels arepoly-on-poly.LIST PRICEEACHSTEEL CONSTRUCTIONCART-660-M 23½" x 37" 660 17¼" 39¼" 143 $332.00PARTIALLY STAINLESS STEEL CONSTRUCTIONCART-660-M-PSS 23½" x 37" 660 17¼" 39¼" 143 $552.00DC-20/FC-70Phone (800) 348-0868www.vestil.com
Foot Pump Scissor Lift TablesFoot pump activated lift tables. Used by all types of manufacturing and warehousing facilities. Featurestorsion tubes for side to side stability, pressure flow control valve for controlled lowering, and foot pump.Optional power-lift feature available (on-board charger included on DC option). These scissor tablescan be made mobile with the optional handle and caster kit (this option will add 6½" to the raised andlowered height). Rugged welded steel construction. Painted blue finish.MODELNUMBERPLATFORMSIZE (W x L)UNIFORMCAPACITYRAISEDHEIGHTLOWEREDHEIGHT# OF PUMPS ATHIGH/LOW SPEEDNET WT.(POUNDS)LIST PRICEEACHSCTAB-400 17½" x 27½" 400 29" 8¼" 19 164 $386.00SCTAB-500 20" x 33" 500 28" 6" 13 / 26 274 870.00SCTAB-750D 20" x 40" 750 35" 7" 8 / 16 284 1,124.00SCTAB-800D 20" x 35½" 800 51" 13" 12 / 39 274 840.00SCTAB-1000 20" x 40" 1,000 32" 8" 8 / 16 270 1,061.00SCTAB-2000 42" x 42" 2,000 32" 8" 16 / 32 386 1,479.00FOOT PUMP SCISSOR TABLE OPTIONSSCTAB-DC* 12V DC HAND CONTROL WITH DEEP CYCLE BATTERY 54 $641.00SCTAB-AC* 24V AC HAND CONTROL WITH 115V 1 PHASE POWER 36 641.00SCTAB-AIR*† FACTORY AIR OVER OIL WITH FOOT TREADLE CONTROL 18 454.00SCTAB-CHK-2* CASTER & HANDLE KIT (FACTORY INSTALLED ONLY) 18 $173.00SCTAB-HDS HIGH DENSITY PVC SURFACE 4 76.00BC* BENCH TOP STYLE BATTERY CHARGER 8 133.50BCI* BATTERY CHARGE INDICATOR 1 82.00CTD* TRACTION DRIVE OPTION (TWIST THROTTLE DESIGN) 156 $1,678.00*NOT AVAILABLE ON THE SCTAB-400 AND SCTAB-800D†REQUIRES A FRL.DC-20/FC-70DVD or VIDEOAVAILABLESCTAB-750D(shown with DCpower option andcaster handle kit)SCTAB-40069SCTAB-800D(double scissor legs)(not shown)SCTAB-500SCTAB-1000(Shown withCaster/Handle Kit)Premium Scissor Lift CartsConstructed of heavy duty steel and designed to withstand the most demanding industrial environments.The simplicity and compactness of these products make them ideal for lifting and transporting loads,order-picking, die handling, and for use in support of assembly operations. Little exertion is requiredto raise and lower the deck, with the high quality foot-actuated, single-speed hydraulic pump. Thehydraulic system is equipped with an overload protection valve. Each cart has safety stops to prevent anempty deck from lowering while performing maintenance. A unique tilt-up table top allows for safe andeasy maintenance. Two rigid front casters and two rear swivel polyurethane casters with brake provide ahigh degree of maneuverability; each swivel wheel is protected by guards and is equipped with brakes.MODELNUMBERMODELNUMBERSCISSORDESIGNPLATFORMSIZE (W x L)PLATFORMSIZE (W x L)UNIFORMCAPACITYUNIFORMCAPACITY (LBS.)RAISEDHEIGHTSERVICERANGELOWEREDHEIGHTLOWERINGMETHODFOOT PUMPSPEEDNET WT.(LBS.)NET WT.(LBS.)LIST PRICEEACHCART-300-S-FR SINGLE 17¾" x 30" 300 31" 10" FOOT 92 $480.00CART-600-S-FR SINGLE 19" x 33" 600 33" 13¼" FOOT 184 684.00CART-1000-S-FR SINGLE 24" x 40½" 1,000 35½" 13½" FOOT 241 724.00CART-300-D-FR DOUBLE 19½" x 33" 300 56" 17" FOOT 221 $655.00CART-600-D-FR DOUBLE 23¼" x 33" 600 53" 11¾" FOOT 244 908.00CART-1000-D-FR DOUBLE 24" x 40½" 1,000 61" 11¾" FOOT 316 1,241.00CART-300-S-HR SINGLE 25½" x 45¼" 300 36¼" 12½" HAND 145 $691.00CART-600-S-HR SINGLE 25½" x 45¼" 600 36¼" 12½" HAND 145 704.00CART-1000-S-HR SINGLE 25½" x 45¼" 1,000 36¼" 12½" HAND 166 856.00CART-400-D-HR DOUBLE 25½" x 45¼" 400 63¾" 17¾" HAND 188 $712.00OPTIONAL STAINLESS STEEL COVER, MODEL CART-SS-CVR, $230.00 LISTStainless Steel Hydraulic Elevating CartsDC-20/FC-70Partially stainless steel carts are available for clean or corrosive environments. The platform, frame, handle,caster rigs, and hardware are all stainless steel. Scissor legs, pump assembly, and hydraulic cylinders are zincplated. Wheels are poly-on-poly.LIST PRICEEACHCART-200-D-PSS 17½" x 27½" 220 10" to 51" SINGLE 128 $830.00CART-400-PSS 17½" x 27½" 400 8¾" to 29" SINGLE 140 1,027.00CART-750-PSS 19¾" x 32½" 750 15½" to 35½" SINGLE 255 1,197.00CART-800-D-PSS 20" x 35½" 800 15½" to 53¾" SINGLE 330 1,770.00CART-1000-PSS 19¾" x 32½" 1,000 15½" to 35½" SINGLE 299 1,270.00CART-1000-LD-PSS 31½" x 63" 1,000 15" to 36" SINGLE 340 1,728.00CART-1500-D-TS-PSS 24" x 47½" 1,500 19" to 68" TWO 552 1,764.00CART-1750-PSS 20" x 39½" 1,750 16" to 39" SINGLE 288 1,149.00CART-2000-PSS 20" x 40" 2,000 15" to 39" TWO 350 2,040.00CART-4000-PSS 24" x 47" 4,000 15½" to 40" TWO 595 2,220.00DC-25/FC-70Custom FinishAvailableseriesCART-S-FRseriesCART-S-HRNewmodelCART-200-D-PSSNewmodelCART-D-FRmodelCART-1000-PSSERGONOMIC SOLUTIONSwww.vestil.com Phone (800) 348-0868
70Hydraulic Elevating CartsPortable ergonomic elevating carts minimize worker bending and lifting. <strong>Material</strong> can be easily loaded onto acart from a table, lowered to safe transporting height, and raised to unload at destination. Foot pump includesa soft-lowering down valve. Move easily on four polyurethane casters; two swivel with brakes and two rigid. Allmodels feature a single or two-speed foot pump. Steel, aluminum, or stainless steel construction.DVD or VIDEOAVAILABLE onCART-1500-D-TSCART-200CART-400CART-550-SSCART-750-TSCART-1000-TSCART-800-D-TSCART-1000-LDNewCART-1500-D-TSCART-1750CART-2000-WDCART-2000CART-200-ALUMMODELNUMBERPLATFORMSIZE (W x L)UNIFORMCAPACITYSERVICERANGEFOOT PUMPSPEEDNET WT.(POUNDS)LIST PRICEEACHPRICE FOR 2OR MOREDESCRIPTIONCART-200-D DOUBLE SCISSOR 17½" x 27½" 220 13" to 50" SINGLE 140 $455.00 $388.00CART-400 SINGLE SCISSOR 17½" x 27½" 400 8¾" to 29" SINGLE 108 385.00 328.00CART-750-TS SINGLE SCISSOR 19¾" x 32" 750 15½" to 35½" TWO 255 637.00 543.00CART-800-D-TS DOUBLE SCISSOR 20" x 35½" 800 15½" to 50¾" TWO 330 838.00 710.00CART-1000-TS SINGLE SCISSOR 19¾" x 32" 1,000 15½" to 35½" TWO 260 $694.00 $588.00CART-1000-LD SINGLE SCISSOR 31½" x 63" 1,000 15" to 36" TWO 340 820.00 698.00CART-1500-D-TS DOUBLE SCISSOR 24" x 47½" 1,500 19" to 68" TWO 552 1,188.00 1,010.00CART-1750 SINGLE SCISSOR 20" x 39½" 1,750 16" to 39" SINGLE 288 1,072.00 901.00CART-DS-1000-M DOUBLE SCISSOR 20" x 33" 1,000 14" to 42" TWO 355 $1,663.00 $1,552.00CART-2000-WD SINGLE SCISSOR 32" x 40" 2,000 15" to 39" TWO 285 1,949.00 1,854.00CART-2000 SINGLE SCISSOR 20" x 40" 2,000 15" to 39" TWO 350 1,508.00 1,436.00CART-4000 SINGLE SCISSOR 24" x 47" 4,000 15½" to 40" TWO 595 1,715.00 1,556.00CART-200-ALUM ALUMINUM 15¾" x 27½" 220 8½" to 29" 50 $450.00 $425.00CART-550-SS STAINLESS STEEL 19½" x 31½" 550 9¾" to 33½" TWO 160 $4,837.00 $4,802.00CART-1100-SS STAINLESS STEEL 23½" x 35½" 1,100 13" to 38½" TWO 240 6,118.00 6,086.00ERGONOMIC SOLUTIONSMODEL NUMBER OPTIONS FOR CART-2000, CART-2000-WD AND CART-DS-1000-M ONLY NET WT. (LBS.) LIST PRICE EACHCART-FC-AIR FOOT TREADLE AIR/HYDRAULIC OIL OPTION -RECIPR 24 $490.00CART-AC 24V HAND HELD CONTROL, 115V AC POWER 48 818.00CART-DC HAND HELD CONTROL, 12V DC POWER OPTION WITH BATTERY 60 818.00BC EXTERNAL BENCH TOP STYLE BATTERY CHARGER 8 133.50BCI BATTERY CHARGE INDICATOR GAUGE 1 82.00CTD TRACTION DRIVE OPTION (TWIST THROTTLE DESIGN), 24V DC (NOT ON CART-2000-WD) 156 1,678.00*THE SCISSOR LEGS & PUMP ASSEMBLY ARE CHROME PLATED ON THE STAINLESS STEEL CARTS. CASTER RIGS ARE ZINC PLATED.PUMP ASSEMBLY IS PAINTED. HANDLE IS CHROME PLATED. WHEELS ARE POLY ON PLASTIC.CART-500-SCLNewScissor Cart with Built-In ScaleMODELNUMBERPLATFORMSIZE (W x L)UNIFORMCAPACITYLOWEREDHEIGHTRAISEDHEIGHTNET WT.(POUNDS)DC-20**/25/FC-70Ideal for parts counting, inventory rooms, or shipping weights at the loading dock. Provides anergonomic workstation while sitting or standing.Partially stainless steel carts are available. The platform, frame, handle, caster rigs, and hardware areall stainless steel. Pump assembly and scissor legs are zinc plated. Wheels are poly on poly.LIST PRICEEACHSTEEL CONSTRUCTIONCART-500-SCL 19½" x 32" 500 14" 38" 215 $949.00PARTIALLY STAINLESS STEEL CONSTRUCTIONCART-500-SCL-PSS 19½" x 32" 500 14" 38" 215 $1,521.00INCLUDES A BUILT-IN SCALEDC-20/FC-70Phone (800) 348-0868www.vestil.com
71Die TablesDesigned to reduce back injuries and cumulative trauma disorders. Lifts heavy equipment to ergonomicworking height. Manually operated hydraulic foot pump and lift cylinder. Handle height is 41". Allwelded steel construction will provide years of service and hard work. Small frame size allows unit toaccess hard-to-reach locations. Two rigid and two swivel casters standard with floor lock.MODELNUMBERPLATFORMSIZE (W x L)UNIFORMCAPACITYLOWEREDHEIGHTRAISEDHEIGHTNET WT.(POUNDS)LIST PRICEEACHDIE-2430-36 24" x 30" 2,000 24" 36" 302 $561.00DIE-2430-48 24" x 30" 2,000 30" 48" 322 580.00DIE-2430-60 24" x 30" 2,000 36" 60" 345 619.00Lift & Tilt Carts with Sequence SelectModels CART-500-LT, CART-1000-LT, and CART-1000-LT-PSS have a uniquedesign which allows the user to RAISE and TILT materials to an ergonomic positionfor better posture and operator comfort. The manual hydraulic foot pump controlsthe platform lift, lower, and tilt. A manual selector valve is used to control the lift/lower sequence independently from the tilt sequence. The platform includes a 6½"high retaining lip on model CART-500-LT and 7" high on CART-1000-LT series.Cart is portable with two rigid and two swivel 5" poly casters.Models CART-400-LT and CART-600-LT are elevated by means of a foot actuatedhydraulic cylinder. As the table is raised, it simultaneously tilts to an angle of 45°at full elevation. Built-in retaining lip keeps containers in place. Units roll on 5"polyurethane casters, 2 rigid and 2 swivel with brakes.MODELNUMBERPLATFORMSIZE (W x L)UNIFORMCAPACITYMAXIMUMTILT*SERVICERANGENET WT.(POUNDS)DC-20/FC-70LIST PRICEEACHSTEEL CONSTRUCTIONCART-500-LT 21½" x 40" 500 35° 17 5 /8" to 34¼" 320 $2,125.00CART-400-LT 19½" x 30" 400 45° 13" to 31" 200 $675.00CART-600-LT 24" x 36" 600 45° 14" to 35" 300 744.00CART-1000-LT 22" x 33 5 /8" 1,000 40° 17½" to 35" 330 $992.00PARTIALLY STAINLESS STEEL CONSTRUCTIONCART-1000-LT-PSS 22" x 33 5 /8" 1,000 40° 17½" to 35" 330 $1,566.00*SERVICE RANGE FIGURED WITH PLATFORM LEVELAir Hydraulic CartsCART-1000-LTNewDC-25/FC-70Features two speed foot pump and hand held reciprocating air/oil power to raise the platform.Utilize the two speed foot pump for minor height adjustments and the factory air/oil power foreffortless lifting of up to 2,000 uniform pounds.Partially stainless steel carts are available. The platform, frame, handle, caster rigs, and hardware areall stainless steel. Pump assembly, hydraulic cylinder, and scissor legs are zinc plated. Wheels arepoly-on-poly.NewmodelAIR-800-DDVD or VIDEOAVAILABLECART-500-LTCART-400-LTCART-600-LTMODELNUMBERPLATFORMSIZE (W x L)UNIFORMCAPACITYSERVICERANGECASTERSIZENET WT.(POUNDS)LIST PRICEEACHSTEEL CONSTRUCTIONAIR-800-D 20" x 35½" 800 13¾" to 51" 5" x 1½" 285 $765.00AIR-1000 19¾" x 32½" 1,000 15¾" to 35½" 5" x 1½" 190 640.00AIR-1000-LD 31½" x 63" 1,000 15½" to 35½" 5" x 1½" 340 1,085.00AIR-1500-D 24" x 47¼" 1,500 19½" x 67" 6" x 2" 550 1,220.00AIR-1750 20" x 39½" 1,750 14¼" to 39½" 6" x 2" 265 768.00AIR-2000 24" x 47¼" 2,000 15" to 39½" 6" x 2" 385 858.00PARTIALLY STAINLESS STEEL CONSTRUCTIONAIR-800-D-PSS 20" x 35½" 800 13¾" to 51" 5" x 1½" 285 $1,379.00AIR-1000-PSS 19¾" x 32½" 1,000 15¾" to 35½" 5" x 1½" 190 1,157.00AIR-1000-LD-PSS 31½" x 63" 1,000 15½" to 35½" 5" x 1½" 340 1,852.00AIR-1500-D-PSS 24" x 47¼" 1,500 19½" x 67" 6" x 2" 550 2,028.00AIR-2000-PSS 24" x 47¼" 2,000 15" to 39½" 6" x 2" 385 1,758.00Pneumatic Scissor Lift TableDC-20/FC-70This unit works great in many environmentally sensitive applications. Table can be used anywhereutilizing only shop air. Air actuator valve included. No electrical power or hydraulic oil required.MODEL PLATFORM UNIFORM CAPACITY SERVICE NET WT. LIST PRICENUMBER SIZE (W x L)(POUNDS)RANGE (POUNDS) EACHAT-10 19½" x 39½" 200 13¾" to 31¼" 205 $864.00DC-20/FC-70modelAIR-1750model AT-10www.vestil.com Phone (800) 348-0868ERGONOMIC SOLUTIONS
72DC Powered and Manual Scissor CartsDVD or VIDEOAVAILABLEMANUAL TWO-SPEEDFOOT PUMPCustom FinishAvailable12V DC POWERTables provide unparalleled ergonomic support in lifting, palletizing, loading, and unloading applications.Carts are raised or lowered with either a 12V DC powered motor or a manual two-speed foot pump. Unitsroll smoothly with (2) rigid and (2) swivel 4" x 2" phenolic casters with brakes. Push handle is removable.Internal DC powered electric motor and 12V battery is included on DC units. Electric motoris rated at 1600 watts. Built-in battery charger is included (operated on 115V AC power). Pushbuttons to raise and lower lift are located on the power unit. Hand control on coil cord is alsostandard. Key-operated ON/OFF control for better security is built into the power unit. Platform isequipped with perimeter pinch-point guard for OSHA compliance.MODELNUMBERPLATFORMSIZE (W x L)SERVICERANGEUNIFORMCAPACITYLIFT SPEED OR# OF PUMPSNET WT.(POUNDS)LIST PRICEEACH12V DC POWERCART-23-10-DC 24" x 36" 11¼" to 32" 1,000 14 sec. 410 $1,664.00CART-23-15-DC 24" x 36" 11¼" to 32" 1,500 16 sec. 450 1,769.00CART-24-10-DC 24" x 48" 9¼" to 42½" 1,000 15 sec. 460 1,759.00CART-24-15-DC 24" x 48" 9¼" to 42½" 1,500 17 sec. 500 1,859.00TWO-SPEED FOOT PUMPCART-23-10-M 24" x 36" 11¼" to 32" 1,000 54 low - 27 high 380 $1,136.00CART-23-15-M 24" x 36" 11¼" to 32" 1,500 54 low - 27 high 420 1,231.00CART-24-10-M 24" x 48" 9¼" to 42½" 1,000 63 low - 31 high 430 1,241.00CART-24-15-M 24" x 48" 9¼" to 42½" 1,500 63 low - 31 high 470 1,331.00DC Powered Hydraulic Elevating Carts12V DC STANDARDDC-20/FC-70These carts are ideal for quick lifting and ergonomic material handling. Battery-powered units allowoperators to raise and lower platform with the push of a button. Units roll on two rigid and twoswivel polyurethane casters. Includes battery and on-board battery charger.model CART-1000D-DCmodel CART-1000-LD-DCmodel CART-1000-DCMODELNUMBERDESIGNPLATFORMSIZE (W x L)UNIFORMCAPACITYSERVICERANGENET WT.(LBS)LIST PRICEEACHCART-1000D-DC DOUBLE 20½" x 39¾" 1,000 19½" to 63¾" 484 $1,577.00CART-1000-DC SINGLE 20½" x 39¾" 1,000 17½" to 37½" 419 1,498.00CART-1000-WD-DC SINGLE 31½" x 47¼" 1,000 17" to 48" 485 1,775.00CART-1000-LD-DC SINGLE 24½" x 60" 1,000 17½" to 45" 473 2,018.00CART-2000-DC SINGLE 20" x 40" 2,000 15" to 39" 360 2,187.00CART-DS-1000 DOUBLE 20" x 33" 1,000 14" to 42" 370 2,349.00CART-SCTAB-500-DC SINGLE 20" x 33" 500 13" to 35" 366 $1,706.00CART-SCTAB-750D-DC DOUBLE 20" x 40" 750 14" to 42" 387 1,992.00CART-SCTAB-1000-DC SINGLE 20" x 40" 1,000 15" to 39" 402 1,920.00CART-SCTAB-2000-DC SINGLE 42" x 42" 2,000 15" to 39" 514 2,474.00Traction Drive Electric Hydraulic Elevating CartsDC-20/FC-70model CART-2000-DCmodel CART-DS-1000The Traction Drive Electric Hydraulic Elevating Carts make maneuvering heavy loads virtuallyeffortless. A twist style throttle with reverse facilitates the maneuverability of this cart. The push ofa button will raise and lower the platform. 24V DC system with 115V AC on-board charger andmaintenance free batteries. Standard features include: powered front industrial 6" x 2" drive wheels.24V DC STANDARD, OPTIONS ON PG. 43ERGONOMIC SOLUTIONSCART-DS-1000-CTD24V DC STANDARDDVD or VIDEOAVAILABLENewCART-1000D-DC-CTDMODELNUMBERPLATFORMSIZE (W x L)UNIFORMCAPACITYSERVICERANGENET WT.(POUNDS)LIST PRICEEACHCART-DS-1000-CTD 20" x 33" 1,000 15" to 41" 452 $4,048.00CART-2000-CTD 20" x 40" 2,000 16" to 40" 513 3,945.00BCI BATTERY CHARGE INDICATOR GAUGE 1 $82.00Powered Drive and Powered Lift Hydraulic Scissor CartsMODELNUMBERPLATFORMSIZE (W x L)UNIFORMCAPACITYSERVICERANGESCISSORTYPENET WT.(LBS.)DC-20/FC-70Fully powered carts provide users with motorized, variable-speed travel as well as powered liftingcapability. Carts roll smoothly and quietly on low-friction pneumatic and poly-on-steel wheels.High torque 24V DC drive and lift motors handle heavy-duty jobs. Standard features: easy-tooperatethrottle that adjusts forward and reverse speeds over a range of 0-3.7 mph, deck levelcontrol buttons (raise and lower), emergency reverse function, automatic braking, horn, key switch,integrated battery charger, and battery charge indicator. These carts use two 12V, 35Ah batteries.LIST PRICEEACHCART-1000-DC-CTD 20½" x 40" 1,000 20½" to 40" SINGLE 393 $3,401.00CART-1500-DC-CTD 20½" x 40" 1,500 23" to 66½" SINGLE 507 3,487.00CART-1000D-DC-CTD 20½" x 40" 1,000 20½" to 40" DOUBLE 405 3,409.00CART-1500D-DC-CTD 20½" x 40" 1,500 23" to 66½" DOUBLE 530 3,576.00DC-20/FC-70Phone (800) 348-0868www.vestil.com
73Ball Transfer PlatformsUnits simply bolt on to any platform. Chrome ball transfers are on 4" x 4¾" centers with a squarepattern while the powder coated units are on 3" centers. Attach to Hydraulic and Mechanical PostTables and Lift Tables. Optional 18"W x 2½"H retractable stops available.MODELNUMBEROVERALL SIZE(W x L)UNIFORMCAPACITY / BALLNET WT.(POUNDS)LIST PRICEEACHFINISHBALL-1830 18" x 28" 75 CHROME 30/UPS $246.00BALL-2036 20" x 36" 75 CHROME 50/UPS 304.00BALL-2448 24" x 48" 75 POWDER COAT BLUE 110/UPS 371.00BALL-4048 40" x 48" 75 POWDER COAT BLUE 150 493.00BALL-3060 30" x 60" 75 POWDER COAT BLUE 160 515.00"Pop-Up" Ball Transfer PlatformsMODELNUMBEROVERALL SIZE(W x L x H)BALL SPACING(W x L)UNIFORMCAPACITYNET WT.(POUNDS)DC-25/UPS/FC-85An economical way to increase usable height and product manipulation to any cart or table. A ballretraction handle is conveniently located on the side to secure load. Mount to our scissor carts orpost tables.LIST PRICEEACHPOPUP-1932 19" x 32" x 8½" 4½" x 5¼" 250 70 $274.00POPUP-4048 40" x 48" x 8½" 4½" x 5¼" 250 180 486.00Ball Transfer Strips & Single Ball TransfersDC-25/FC-85Single strips of ball transfers are easy to install and simple to use. To install, simply line it up onyour cart, table, or workstation and bolt on at each end. Standard finish is chrome.The Single Ball Transfers feature a hardened cup, protective debris shield, and include lag-down tabs.BALL TRANSFER STRIPSMODELBALLUNIFORM NET WT. LIST PRICENUMBER LENGTH SPACING FINISH CAPACITY / BALL (POUNDS) EACHBALL-S30 30" 3¼" CHROME 75 9 $57.00BALL-S40 40" 3¼" CHROME 75 12 74.00BALL-S60 60" 3¼" CHROME 75 16 94.00SINGLE BALL TRANSFERBALL-1F 1" D 1¼" H ZINC PLATED 75 1/2 $2.60DC-25/UPS/FC-85Conveyor with Retractable End StopsProvide smooth and easy flow from cart to workstation. Attaches to anyscissor table, cart, or work bench with a deck length of 32". Allows youto position objects easily. Features retractable end stops so items won'tslide off during transit. Ideal for use at feed tables for sheet metal workingmachines, press brakes, and machine centers. Adds 3¾" to lowered andraised height of cart. Fits model CART-750-TS and CART-1000-TS.Retractable End StopShown with aScissor Cart(Cart Sold Separately)Cart Sold Separately.See Page 70BALL TRANSFER STRIPSINGLE BALL TRANSFERmodel BALL-1FMODEL PLATFORM SIZE UNIFORM ROLLER ROLLERNET WT.LIST PRICENUMBER (W x L x H) CAPACITY DIAMETER SPACING (POUNDS) EACHCONV-1832 18" x 32" x 3¾" 800 2" 3" CENTERS 63 $223.00Roller ConveyorMODELNUMBEROVERALL(W x L)USABLEWIDTHNUMBER OFROLLERSUNIFORM CAPACITYTOTAL (LBS.)DC-25/UPS/FC-100Put these conveyors on the floor next to your work stations or use them in your dock area.Minimize the reliance on a fork truck. Minimize lifting and carrying. 10 gauge zinc plated steelframe (3½" x 1") resists corrosion. Rollers are 2.4" in diameter on 3" centers. 13 gauge springloaded rollers are set low in frame. Couplers included to join units together. Ships assembled.NET WT.(POUNDS)LIST PRICEEACHCONV-52-5-2-3L-Z 52" x 60" 50" 20 5,000 310 $595.00CONV-52-10-2-3L-Z 52" x 120" 50" 40 5,000 540 1,291.00Turnabout Pallet TruckMODELNUMBERUNIFORMCAPACITYShips with the Handle Detached StandardOVERALL FORKDIMENSIONSFORKSERVICE RANGENET WT.(POUNDS)DC-25/FC-85Unique turnabout pallet truck allows for turning on a dime! Special center wheels allow pallet truck tospin within operating space. Spring-loaded actuation does not interfere with normal operation. Offersgreatly improved product maneuverability.LIST PRICEEACHPM5-2748-TURN 5,500 27"W x 48"L 3½" to 7¾" 320 $575.00DC-25/FC-92.5Cart Sold Separately.See Page 70www.vestil.com Phone (800) 348-0868NewNewERGONOMIC SOLUTIONS
74DVD or VIDEOAVAILABLESolid Steel Push Rods6 DegreeArticulating Wheelsmodel PM10-2245User FriendlyEntry & Exit WheelHydraulic Pump includesOverload Relief Valve.Pump Bypasses at FullHeight.Full Featured Pallet TrucksAn economical way for one person to move heavy pallet loads without the use of a fork truck!Includes two articulating steering wheels and two front load rollers. Ergonomic design requires only75 pounds of pulling force when fully loaded. Steering wheels include bearing dust covers for addedlife. Nose wheels are located on the front edge of each fork to assist in clean pallet entrance andexit. Reinforced triple-formed steel forks provide twice the strength of standard single-formed forks.Forks are 6¾" wide each. Equipped with internally mounted solid steel adjustable push rods. Springloaded handle automatically returns to vertical position when not in use. Hydraulic pump designfacilitates easy-access seal replacement. Chrome-plated hydraulic pump piston for long seal life.MODELNUMBERUNIFORMCAPACITYOVERALL FORKDIMENSIONSFORKSERVICE RANGENET WT.(LBS.)LIST PRICEEACHLOTS OF 6PRICE EACH †PM5-2748 5,500 27"W x 48"L 2 7 /8" to 7¾" 280 $338.00 $308.00PM5-2048 5,500 20 5 /8"W x 48"L 2 7 /8" to 7¾" 225 325.00 296.00PM5-2036 5,500 20"W x 36"L 2 7 /8" to 7¾" 200 427.00 389.00PM6-2748 6,000 27"W x 48"L 2 7 /8" to 7¾" 330 $481.00 $421.00PM10-2245** 10,000 22¾"W x 45¼"L 3½" to 7 7 /8" 423 1,507.00 1,453.00PM5-2748-N* 5,500 27"W x 48"L 2 7 /8" to 7¾" 316 400.00 362.00PM5-2748-S** 5,500 27"W x 48"L 2 7 /8" to 7¾" 325 405.00 367.00PM4-2772 4,400 27"W x 72"L 2 7 /8" to 7¾" 401 612.00 536.00PM4-2796 4,000 27"W x 96"L 2 7 /8" to 7¾" 400 632.00 577.00*NYLON WHEELS / **STEEL WHEELS (ALL OTHERS ARE POLY-ON-STEEL)FOOT BRAKE KIT OPTION, model PM5-FB, $28.00 LISTDC-25/FC-92.5Pallet Truck with Hand Brake Option, model PM5-2748-HB, allows you to depress the hand braketo slow down or stop truck. The "Dead Man" Hand Brake Pallet Truck, model PM5-2748-DMHB,only moves when you depress the hand brake. Factory installed only.PALLET TRUCKS WITH BRAKE OPTIONSMODELUNIFORMNUMBERCAPACITYOVERALL FORKDIMENSIONSFORKSERVICE RANGENET WT.(POUNDS)LIST PRICEEACHPM5-2748-HB 5,500 27"W x 48"L 2 7 /8" to 7¾" 300 $388.00PM5-2748-DMHB 5,500 27"W x 48"L 2 7 /8" to 7¾" 300 490.00DC-25/FC-92.5Standard Pallet Truck• Economical • Powder Coat Finish • Quality Built • User Friendly • Low MaintenanceProven ergonomic design has been time-tested for providing years of reliable service. An economicalway for one person to move heavy pallet loads without the use of a fork truck. Ergonomic designrequires only 75 pounds of pulling force when fully loaded. Spring loaded loop handle automaticallyreturns to vertical position when not in use. Chrome-plated hydraulic pump piston for long seal life.ERGONOMIC SOLUTIONSPhone (800) 348-0868Low Profile Design with1-7/8" Lowered HeightMODELNUMBERUNIFORMCAPACITYOVERALL FORKDIMENSIONSFORKSERVICE RANGENET WT.(POUNDS)LIST PRICEEACHLOTS OF 6PRICE EACH †PM5-2748-Y 5,500 27"W x 48"L 2 3 /8" to 7¾" 300 $325.00 $305.00DC-25/FC-92.5Low Profile Pallet TrucksThe Low Profile Pallet Truck can enter a pallet from all four sides. All steel frame is reinforced tohandle 4,000 lb. capacity loads. Individual fork width is 6¾" wide. Wide loop control handle withlift, neutral, and lower functions provides fingertip control. Lifetime lubricated bearings. Hydraulicsystem has hard chrome plated pump piston with polyurethane seals. Suspension system has heavydutythrust bearing. Complete with adjustable push rods, polyurethane wheels, steel load rollers, andred powder coat finish.MODELNUMBERMODELNUMBERUNIFORMCAPACITYUNIFORMCAPACITYOVERALL FORKDIMENSIONSOVERALL FORKDIMENSIONSFORKSERVICE RANGENET WT.(POUNDS)FORKSERVICE RANGELIST PRICEEACHNET WT.(POUNDS)LOTS OF 6PRICE EACH †PM4-2048-LP* 4,000 20 5 /8"W x 48"L 1 7 /8" to 6" 228 $365.00 $326.00PM4-2748-LP 4,000 27"W x 48"L 1 7 /8" to 6" 270 365.00 326.00PM4-3348-LP 4,000 33"W x 48"L 1 7 /8" to 6" 300 369.00 329.00*MODEL PM4-2048-LP HAS A TRIANGULAR APRONDC-25/FC-92.5Super Low Profile Pallet TrucksThese pallet trucks are ideal for extra low applications. Features 1½" lowered fork height for extralow profile skids, pallets, or machinery. Fingertip lever switch for raise, lower, and neutral operation.Rubber cushioned handle grip. Powder coat finish.LIST PRICEEACHPM2-2044-SLP 2,200 20"W x 44"L 1½" to 3 3 /8" 313 $439.00PM2-2744-SLP 2,200 27"W x 44"L 1½" to 3 3 /8" 323 469.00PM2-3344-SLP 2,200 33"W x 44"L 1½" to 3 3 /8" 333 480.00PALLET TRUCKS SHIP WITH HANDLE DETACHED STANDARDDC-25/FC-92.5www.vestil.com
Quick Lift Pallet TrucksLifts to maximum height with just 4 pumps. Reduce operating costs. An economical way for oneperson to move heavy pallet loads without the use of a fork truck! Includes two articulating steeringwheels and two front load rollers. Ergonomic design requires only 75 pounds of pulling force whenfully loaded. Steering wheels include bearing dust covers for added life. Nose wheels are located onthe front edge of each fork to assist in clean pallet entrance and exit. Reinforced triple-formed steelforks provide twice the strength of standard single-formed forks. Forks are 6¾" wide each. Equippedwith internally mounted solid steel adjustable push rods. Spring loaded handle automatically returnsto vertical position when not in use. Hydraulic pump design facilitates easy-access seal replacement.Chrome-plated hydraulic pump piston for long seal life.MODELNUMBERMODELNUMBERUNIFORMCAPACITY (LBS)UNIFORMCAPACITYFORK SIZE(W x L)OVERALL FORKDIMENSIONSSERVICERANGEFORKSERVICE RANGENET WT.(LBS.)NET WT.(POUNDS)LIST PRICEEACHPM5-2048-QL 5,500 20" x 48" 3" to 7½" 280 $367.00PM5-2748-QL 5,500 27" x 48" 3" to 7½" 225 367.00Wheel Nose Pallet Trucks• Optimize Floor and Truck Space with this Innovative Pallet TruckMODELNUMBEROVERALL FORKDIMENSIONSFORKSERVICE RANGENET WT.(LBS.)DC-25/FC-92.5The Wheel Nose Pallet Truck is designed to position pallets or skids closely together. The fork endis set back from the front rollers allowing for one pallet pick up at a time. The unit has a rubbergrip handle with a three position lever for easy operation and maneuvering. This heavy-duty unitis rated at 5,000 pounds capacity and has a service range from 3½" to 8". Units include twoarticulating steering wheels and two front load rollers. Spring loaded loop handle automaticallyreturns to vertical position when not in use. 38" forks are used for maneuvering in tight spaces.MODELNUMBERUNIFORMCAPACITYOVERALL FORKSIZE (W x L)SERVICERANGENET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONPM5-2038-WN WHEEL NOSE 5,000 20" x 38" 3½" to 8" 260 $395.00PM5-2738-WN WHEEL NOSE 5,000 27" x 38" 3½" to 8" 280 411.00Specialized Pallet Trucks (with nylon wheels)• Pallet Trucks for Corrosive and Sanitary EnvironmentsDC-25/FC-92.5Stainless Steel and Stainless Steel Frame & Forks - Ideal for sanitary, pharmaceutical, medical,food, and wet environments. Choose type 304 stainless steel frame and forks only or 100% type 304stainless steel pallet truck for long life in the most harsh environments. 5,500 lbs. uniform capacity.Galvanized and Zinc Coated - Ideal for corrosive environments. Full-featured pallet trucks weredesigned for chemical, pharmaceutical, and wash-down applications. 5,500 lbs. uniform capacity.LIST PRICEEACHDESCRIPTIONPM5-2048-SS STAINLESS STEEL 21½"W x 45"L 2 7 /8" to 7¾" 300 $1,825.00PM5-2748-SS STAINLESS STEEL 27"W x 48"L 2 7 /8" to 7¾" 327 1,825.00PM5-2748-SFF SS FRAME & FORKS 27"W x 48"L 2 7 /8" to 7¾" 327 1,002.00PM5-2748-S-G GALVANIZED 27"W x 48"L 2 7 /8" to 7¾" 327 502.00PM5-2748-S-Z ZINC COATED 27"W x 48"L 2 7 /8" to 7¾" 322 465.00Pallet Trucks with Digital ScaleDC-25/FC-92.5The Pallet Truck with Digital Scale allows you to weigh your load on the spot for maximum efficiency.The frame uses heavy-duty steel construction for maximum strength and durability. This model isvery user friendly and is suitable for low height lifting. The built-in scale allows you to weigh yourload as you are handling it. The scale is selectable in a variety of increments to adjust to the size ofyour load. It has keyboard calibration and functional setup with automatic zero capabilities. Digitalfiltering is used to help compensate for vibration and motion to make the Pallet Truck with DigitalScale smooth and accurate. Forks are 7" wide each. Factory calibrated for shipping destination.Standard with an on-board charger and AC adaptor. NTEP approval also available.LIST PRICEEACHPM-2048-SCL-LP 5,000 22 3 /8"W x 48"L 3" to 7½" 338 $1,579.00PM-2748-SCL-LP 5,000 27½"W x 48"L 3" to 7½" 371 1,579.00PM-2048-SCL-LP-PT* 5,000 22 3 /8"W x 48"L 3" to 7½" 343 $1,921.00PM-2748-SCL-LP-PT* 5,000 27½"W x 48"L 3" to 7½" 378 1,921.00304 STAINLESS STEEL PALLET TRUCK WITH SCALEPM-2748-SCL-LP-SS 5,000 27½"W x 48"L 3" to 7½" 410 $4,823.00LEGAL FOR TRADE PALLET TRUCKS (NTEP APPROVED)PM-2048-NTEP-SCL-LP 5,000 21 7 /8"W x 45¼"L 3" to 7½" 270 $2,987.00PM-2748-NTEP-SCL-LP 5,000 27 7 /8"W x 45¼"L 3" to 7½" 280 2,987.00*PALLET TRUCK WITH SCALE AND PRINTER DC-25/FC-175PALLET TRUCKS SHIP WITH HANDLE DETACHED STANDARDStandardPallet Truckmodel PM-2748-SCL-LPSCALE HEADSHOWN WITHOPTIONALPRINTERwww.vestil.com Phone (800) 348-0868NewWheel NosePallet TruckmodelPM-2748-SCL-LP-SSmodelPM-2748-NTEP-SCL-LPNew75DVD or VIDEOAVAILABLEERGONOMIC SOLUTIONS
76NewEPT-2547-30DVD or VIDEOAVAILABLEEPT-2748-45Fully Powered Electric Pallet Trucks24V DC STANDARDFully powered electric pallet truck for easy and quick operation. Raise and lower loads with a push of abutton. Maneuvers loads in warehouses and trailers. Reinforced welded forks with adjustable tie-rodsgive long service. High-torque 24V DC drive & lift motors handle heavy-duty jobs. Ergonomic handlefeatures easy to operator throttle with infinite adjustment of forward and reverse speeds, lift/lower controls,proprietary safety-enhancing emergency reverse function, and horn. Includes an electromagnetic discbrake with automatic dead-man feature that activates when the user releases the handle.3,000 lbs. unit uses 2, 12V, 95Ah batteries, integral battery charger, battery level gauge, and emergencybattery disconnect. The truck rolls smoothly on poly-on-steel, steer and load wheels. Features 0.7 KWdrive and 1.3 KW lift motor. 3-4 hour operation at full charge - 8 hours when used intermittently.4,500 lbs. unit uses 4, 6V, 200Ah batteries, integral battery charger, battery level gauge, and emergencybattery disconnect. The truck rolls smoothly on poly-on-steel steer and load wheels. Features 1.2 KWdrive and 2.0 KW lift motor. 6-7 hours operation at full charge - 8 hours when used intermittently.Proprietary safety-enhancing emergency reverse functionWhen actuated, the emergency reverse belly switch instantly reverses direction and moves the unit forward(away from the operator) until the switch is released or after 1.5 seconds have elapsed. The built-in safetycircuit will automatically disable the entire unit if the emergency reverse belly switch is activated for morethan 1.5 seconds after which the unit must be re-set to return to normal operating conditions. This stateof-the-artsafety device provides a level of operator protection which is unmatched by any unit on themarket today.EPT-45-RP-KITMODELNUMBERUNIFORM*CAPACITYFORK SIZE(W x L)SERVICERANGEOVERALL SIZE(W x L x H)NET WT.(LBS.)LIST PRICEEACHEPT-2047-30 3,000 20" x 45" 3.2" to 7.8" 28¼" x 62¼" x 50" 660 $3,595.00EPT-2547-30 3,000 25" x 47" 3.1" to 7.8" 28¼" x 65¼" x 50" 671 3,343.00EPT-2048-45 4,500 20" x 48" 3.4" to 7.8" 30" x 78½" x 49" 990 $6,054.00EPT-2748-45 4,500 27" x 48" 3.2" to 8.2" 30" x 73½" x 51" 1012 5,675.00EPT-2796-45 4,500 27" x 96" 3.2" to 8.2" 30" x 125" x 51" 1250 9,875.00EPT-45-RP-KIT OPTIONAL RIDER PLATFORM, FIELD INSTALLED 21 $200.00INCLUDES STAND-ON PLATFORM which flips up when not in use (18"W x 12"L x 4¾"H)EPT-2048-45-RP 4,500 20" x 48" 3.4" to 7.8" 30" x 89¾" x 51" 1250 $6,274.00EPT-2748-45-RP 4,500 27" x 48" 3.4" to 7.8" 30" x 89¾" x 51" 1250 5,895.00OPTIONAL BATTERIESEPT-30-AGM AGM BATTERY FOR 3,000 LB. UNITS 100 $158.00EPT-30-GEL GEL CELL BATTERY FOR 3,000 LB. UNITS 100 205.00EPT-45-AGM AGM BATTERY FOR 4,500 LB. UNITS 240 $779.00EPT-45-GEL GEL CELL BATTERY FOR 4,500 LB. UNITS 240 665.00*CONTINUOUS DUTY RATING / ADD 500 LBS. UNIFORM CAPACITY FOR INTERMITTENT DUTY RATINGDC-25/FC-85/175ERGONOMIC SOLUTIONSDVD or VIDEOAVAILABLENewElectric Pallet Truck with ScaleMODELNUMBERUNIFORM*CAPACITYFORK SIZE(W x L)24V DC STANDARDVerify inbound and outbound freight right on your pallet truck and then move your loads with ease.LCD Scale, with ½" high characters and 5 function keys (ZERO, TARE, NET/GROSS, PRINT, LB./KG.), displays weight in 1 lb. increments within trucks rated capacity. Scale (best accuracy is 0.01% ofmaximum calibrated weight) display operates on standard Alkaline batteries. Scale is not NTEP approved(not legal for trade). Scale head includes RS232 port for serial printing. Raise and lower loads with a pushof a button. Maneuver loads in warehouses and trailers. Reinforced welded forks with adjustable tie-rodsgive long service. High-torque 24V DC drive & lift motors handle heavy duty jobs. Ergonomic handlefeatures easy to operate throttle with infinite adjustment of forward and reverse speeds, lift/lower controls,proprietary safety-enhancing emergency reverse function, and horn. Includes an electromagnetic discbrake with automatic dead-man feature that activates when the user releases the handle.SERVICERANGEOVERALL SIZE(W x L x H)NET WT.(LBS.)LIST PRICEEACHEPT-2547-30-SCL 3,000 25" x 48" 3.4" to 7.8" 28½" x 66" x 49" 715 $4,481.00EPT-2748-45-SCL 4,500 27" x 48" 3.6" to 8" 30¼" x 76½" x 49" 1056 6,813.00EPT-45-RP-KIT OPTIONAL RIDER PLATFORM, FIELD INSTALLED 21 $200.00EPT-SCL-PT OPTIONAL PRINTER 5 461.00INCLUDES STAND-ON PLATFORM which flips up when not in use (18"W x 12"L x 4¾"H)EPT-2748-45-SCL-RP 4,500 27" x 48" 3.6" to 8" 30¼" x 76½" x 49" 1269 $7,033.00OPTIONAL BATTERIESEPT-30-AGM AGM BATTERY FOR 3,000 LB. UNITS 100 $158.00EPT-30-GEL GEL CELL BATTERY FOR 3,000 LB. UNITS 100 205.00EPT-45-AGM AGM BATTERY FOR 4,500 LB. UNITS 240 $779.00EPT-45-GEL GEL CELL BATTERY FOR 4,500 LB. UNITS 240 665.00*CONTINUOUS DUTY RATING / ADD 500 LBS. UNIFORM CAPACITY FOR INTERMITTENT DUTY RATINGDC-25/FC-85/175Phone (800) 348-0868www.vestil.com
77Semi-Electric Pallet TruckSemi-Electric design provides functional benefits and lower costs. Forks are raised manual like a standardpallet truck. Battery-powered DC traction-drive system for effortlessly moving heavy loads. Handleincludes forward/reverse throttle control levers and emergency stop button. Features: manual batterydisconnect switch, battery charge level gauge, and on-board 110V AC battery charger. Travel speed whenloaded is 1.86 mph / unloaded 2.17 mph. Maximum grade is 4%.NewMODEL UNIFORM OVERALL SERVICE OVERALL SIZE NET WT. LIST PRICENUMBER CAPACITY FORK WIDTH RANGE(W x L x H) (POUNDS) EACHEPT-S-2548-25 2,500 25"W x 48"L 3.2" to 7.8" 25¼" x 64¾" x 50½" 630 $2,699.00DC-25/FC-85/175All Terrain Pallet Truck• Inside Straddle is 50" / Outside Straddle is 64"• Pneumatic Tires have Sealed Bearings for Outside DurabilityMODELNUMBERUNIFORMCAPACITYADJUSTABLEFORK WIDTHFORKLENGTHSERVICERANGEOVERALL SIZE(W x L x H)NET WT.(POUNDS)NewThis lightweight yet strong tubular frame design handles evenly distributed loads. Largewheels allow for movement over most surfaces. Use at construction sites, gravel pits, andnurseries. Features large 16" front pneumatic tires and 10" pneumatic steering wheels.Individual forks are 4"W x 2"H (4¾"W on model ALL-T-HD). Easy to operate with threeposition handle, UP, DOWN, and NEUTRAL. Optional Tow Bar package allows the AllTerrain Pallet Truck to be towed by an ATV or small utility tractor. Designed for pulling ineither loaded or unloaded position.LIST PRICEEACHALL-T-2 2,000* 9½" to 26" 32" 3" to 9" 64" x 50" x 51" 410 $704.00ALL-T-HD 2,500** 10" to 26¾" 32" 3" to 9" 64" x 50" x 51" 525 948.00ALL-TTB OPTIONAL TOW BAR PACKAGE (40½"L x 4½"W x 5"D) 62 $174.00*2,000 lbs. at 12" horizontal load center, 1,500 lbs. at 15" and 1,000 lbs. at 24" horizontal load center DC-25/FC-175**2,500 lbs. at 12" horizontal load center, 2,000 lbs. at 15" and 1,500 lbs. at 24" horizontal load centerADJUSTABLEWIDTH FORKSOPTIONALTOW BAR PACKAGEGas Powered All Terrain Pallet TrucksAll terrain pallet truck with gas-powered traction drive system. Great for moving heavy loadsover rough terrain. Powered by a Briggs & Stratton 6HP gas-powered engine for both thepower traction drive and fork lift/lower. Handle with forward reverse speed control and deadman safety switch. Hydrostatic transmission with hand-operated forward and reverse selection.Powered fork raise and lower control lever. Usable width between outriggers is 52". Forks adjust8" to 36". Pneumatic steer wheels are 13" diameter x 4" wide each. The drive wheels are 18"diameter x 8½" wide each (foam filled pneumatic front wheels on ALL-T-4-GPT standard).Wheels include sealed bearings for outdoor use. Steering arc is 150°. Comply with ASMEB56.1-2004. Optional 13.5 HP engine with electric start and heavy duty transaxle available.NewMODELNUMBERLOAD CENTERUNIFORM CAPACITYFORK(W x L)SERVICERANGEOVERALL SIZE(W x L)NET WT.(POUNDS)LIST PRICEEACHALL-T-2-GPT 2,000* 4" x 36" 3" to 12" 79" x 78" 1200 $6,713.00ALL-T-2-GPT-L 2,000** 4" x 48" 3" to 12" 79" x 90" 1300 7,246.00ALL-T-4-GPT 4,000* 4" x 36" 3" to 12" 79" x 78" 1200 $7,324.00ALL-T-4-GPT-L 4,000** 4" x 48" 3" to 12" 79" x 90" 1300 7,868.00ALL-T-GPT-13HP 13.5 HP ENGINE FACTORY UPGRADE 215 $1,172.00ALL-T-GPT-PRO OPTIONAL PROPANE POWERED 150 1,330.00ALL-T-GPT-PT OPTIONAL POWER TILT ALLOWS FOR TILTINGOF FORKS ±8° & ADDS 6" TO OVERALL LENGTH265 1,195.00*CAPACITY AT 18" LOAD CENTER**CAPACITY AT 24" LOAD CENTERBig Wheel Pallet TruckShips with the Handle Detached Standard• Steering Wheels are 7 7 /8" x 2" Poly-on-Steel, Load Rollers are 3" x 3¾"DC-25/FC-85/175Use less pushing or pulling force when transporting large heavy loads across floors with the BigWheel Pallet Truck. An alternative to fork trucks, this unit makes it easier to move loaded tubsweighing up to 4,500 uniform pounds (does not work with standard pallets). The service rangeenables the pallet truck to service high bottom tubs. The Big Wheel Pallet Truck retains all of thequality workmanship of our other Pallet Master Pallet Trucks.MODELUNIFORM OVERALL FORK SERVICE NET WT. LIST PRICENUMBER DESCRIPTION CAPACITY SIZE (W x L)RANGE (POUNDS) EACHBW-PJ BIG WHEEL 4,500 26¾" x 51½" 5½" to 15¼" 299 $643.00DC-25/FC-92.5DVD or VIDEOAVAILABLEERGONOMIC SOLUTIONSwww.vestil.com Phone (800) 348-0868
78DVD or VIDEOAVAILABLENose WheelRight/Left WheelsMoves FORWARD,BACKWARD, LEFT,and RIGHTForward/Back WheelSide Winder Pallet TruckTransport long loads down narrow aisles with this heavy-duty Side Winder Pallet Truck.This versatile Pallet Truck retains all the quality workmanship of a standard pallet truck inaddition to providing lateral movement. Simply place the forks into the pallet then elevate toapproximately seven inches, rotate handle, and lock detent into place. The second set of rollers,right/left, are actuated. Now push the Side Winder perpendicular to the traditional direction.MODELUNIFORM OVERALL FORK SERVICE NET WT. LIST PRICENUMBER DESCRIPTION CAPACITY SIZE (W x L) RANGE (POUNDS) EACHSW-PJ SIDE WINDER 3,000 27" x 48" 3½" to 8" 311 $445.00Ergonomic Power Assist Pallet TruckDC-25/FC-92.5Anyone who has operated a fully loaded pallet truck knows the most strenuous part is startingthe wheels rolling. This Pallet Truck solves this back breaking problem. Pumping the handle ofthe pallet truck serves two purposes. First, it serves the traditional purpose of lifting the forks.Second, switch to the power drive accumulator and by pulling the handle back, the pallet truckbegins to roll automatically, thus reducing the pulling force.ERGONOMIC SOLUTIONSNewNewNewMODELUNIFORM OVERALL FORK FORK NET WT. LIST PRICENUMBERCAPACITY DIMENSIONS SERVICE RANGE (POUNDS) EACHPM5-2748-PA-Y 5,000 27"W x 48"L 3" to 7½" 190 $1,499.00Roll Pallet TruckMODELNUMBERMODELNUMBERMODELNUMBEROVERALLSIZE (W x L)OVERALL SIZE(W x L)ACCOMMODATESROLLS SIZE (DIA.)USABLE FORKPOCKETS (W x H)SERVICERANGEACCOMMODATESFORK DIMENSIONSFORK POCKETSPACINGUNIFORMCAPACITYINCREASEDHEIGHTNET WT.(POUNDS)NET WT.(POUNDS)NET WT.(POUNDS)DC-25/FC-92.5Transport rolls of material with standard pallet trucks. Sloped ends allow for manually rollingmaterial into position. V-shaped center holds rolls in position. Steering wheels measure 7⅞" x2" while the load rollers are 3⅛" x 3⅞".LIST PRICEEACHPM4-3048-RL 30" x 48" 15¾" to 23 5 /8" 0 to 6¾" 4,000 320 $612.00PM4-3348-RL 33" x 48" 23 5 /8" x 31½" 0 to 6¾" 4,000 330 622.00PM4-4048-RL 40" x 48" 31½" x 33 1 /6" 0 to 6¾" 4,000 380 632.00PM4-4548-RL 45" x 48" 47¼" x 63" 0 to 6¾" 4,000 390 787.00Pallet Truck Roll AdaptorDC-25/FC-92.5Hold and transport rolls of material with standard pallet trucks. Sloped ends allow formanually rolling material into position. V-shaped center holds rolls in position. Built-in forkpockets allow for movement with standard pallet truck. Heavy-duty welded steel constructionwith power coat finish.LIST PRICEEACHPMRA-27 47" x 36¼" 7½" x 3½" 19¾" on center 250 $798.00PMRA-20 40" x 36¼" 7½" x 3½" 12¾" on center 225 726.00Pallet Truck HoistDC-25/FC-92.5The pallet truck hoist is an affordable and practical alternative for lifting and lowering loads toand from elevated work stations. It provides workers with a mobile lifting jib that quickly securesto a standard 27" x 48" pallet truck. Fork pockets measure 7¾" x 2¾" ID. Once installed, thepallet truck can still be used with most pallets and skids allowing for transport of heavy palletloads while retaining the ability to lift and lower loads to and from the pallet. It uses a clutchlesscable winch with 80" of cable (88" with hook and shackle) for easy lifting and lowering. Steelconstruction with water-based enamel coat.MODEL OVERALL OVERALL BOOM HOOK FROM UNIFORM NET WT. LIST PRICENUMBER HEIGHT BASE WIDTH LENGTH UPRIGHT CAPACITY (POUNDS) EACHPJ-LIFT 76½" 30" 22¾" 19" 500 180 $496.00PRICE EXCLUDES PALLET TRUCKSkid Adapters for Pallet TrucksDC-25/FC-70/92.5/175Increase your pallet truck service by 3" to handle skids with the Skid Adapter. Adapts to modelPM5- "Pallet Master Pallet Trucks" only with an overall fork width of either 20" or 27" anda minimum fork length of 48". Skid adapter may be rotated into vertical position for normalpallet truck use.LIST PRICEEACHDESCRIPTIONPM5-20SA SKID ADAPTERS 20"W x 48"L 3" 60 $145.00PM5-27SA SKID ADAPTERS 27"W x 48"L 3" 75 157.00PALLET TRUCKS SHIP WITH HANDLE DETACHED STANDARDDC-25/FC-70/92.5/175Phone (800) 348-0868www.vestil.com
Pallet Jockey for "Walkie" TrucksThe Pallet Jockey is a simple device that allows drivers and warehouse personnel to efficiently unloadsideways pallets with their "Walkie" powered pallet trucks without wasting valuable time and resources.Maximum capacity is 4,000 lbs.The Non-Adjustable unit is ideal for warehouse distribution centers that have one particular electricpallet truck model. To use simply place the Pallet Jockey hooks into the fork wheel openings. Fitspopular sizes of walkie trucks (verify your fork width and end of fork dimensions) and our electricpallet truck, model EPT-2547-30.The Adjustable unit is designed to fit various types of electric pallet jacks. To use simply loosen wingbolts and slide adjustable brackets to proper slot, then tighten wing bolts.MODELNUMBERPOWERED PALLET TRUCKSTYLE IT WORKS WITHNET WT.(LBS.)LIST PRICEEACHDESCRIPTIONPJ-1005 NON-ADJUSTABLE VARIOUS ELECTRIC WALKIE TRUCKS 25 $200.00PJ-2001 ADJUSTABLE VARIOUS ELECTRIC WALKIE TRUCKS 26 222.00Pallet Truck ChockDesigned to prevent empty pallet trucks from moving. Ideal foruse in semi-trailers and delivery trucks. Features a convenientmold-in handle for positioning. Chocks both wheels and forkheels. Bottom surface includes rubber suction-cup grips. Solidmolded plastic construction.NewDC-25/UPSNON-ADJUSTABLEmodel PJ-1005ADJUSTABLEmodel PJ-200179MODELOVERALL SIZEUSABLE SIZENET WT. LIST PRICENUMBER(W x L x H)(W x L)(POUNDS) EACHPTC-8 15 3 /8" x 27 3 /16" x 3 1 /8" 6¾" x 8" 8 $53.00Pallet Truck StopDC-25/UPSThis unique pallet truck stop was designed to eliminate freight and trailer door damage due to runaway pallettrucks. It is easy to use and store. It protects valuable freight and equipment from damage caused when apallet truck drifts. Ideal for freight companies, delivery companies, and other material handling customers.MODELOVERALL SIZEUSABLE SIZENET WT. LIST PRICENUMBER(W x L x H)(W x L)(POUNDS) EACHVPTS-05 11½" x 11½" x 2" 8 7 /8" x 5 7 /8" 3 $51.00Pallet Truck Wedge with MagnetDC-25/UPSPrevent pallet truck damage in moving semi-trailers with the Pallet Truck Wedge. Constructed of 100%molded urethane. Step-down design for use with all types of pallet trucks. Magnetic back for securing topallet truck for storage. Lightweight and easy to use.MODELOVERALL SIZENET WT. LIST PRICENUMBERDESCRIPTION(W x L x H)(POUNDS) EACHPJ-4 PALLET TRUCK WEDGE 4" x 5¾" x 2¼" 3 $20.90Pallet Truck CaddyDC-35/UPSThis economical product will convert a standard pallet truck into a portable workstation in minutes. Ithas been designed with user efficiency and convenience in mind. Easily attaches to virtually any type ofpallet truck with hardware included. Manufactured from durable molded yellow plastic for an attractivelook. Features beverage holder, tool pockets, pen and pencil tray, and clipboard holder. Large storagecompartment in back can also be used as a wastebasket. Installation hardware and instructions included.MODELNET WT. LIST PRICENUMBERDESCRIPTION(POUNDS) EACHP-CADDY PALLET TRUCK CADDY 5 $86.00Serrated Steel Fold-Up StepsMODELNUMBERSTEP SIZE(W x D)UNIFORMCAPACITY (LBS)NET WT.(POUNDS)DC-25/UPSEasily rotate step to vertical position when not in use. Step is steel with powder coat blue finish and hasa serrated surface for traction. Two 7 /16" diameter mounting holes included. Fasteners are not included.Available in manual or spring loaded design. Powder coated blue finish.LIST PRICEEACHDESCRIPTIONSFS-149 MANUAL FOLD-UP STEP 14" x 9" 350 25 $88.00SFS-149-SL SPRING LOADED STEP 14" x 9" 350 26 113.00DC-25/UPSLOWER PALLET TRUCKCORNER ON WEDGEwww.vestil.com Phone (800) 348-0868ERGONOMIC SOLUTIONS
80Adjustable Work-Mate StandsMinimizes fatigue by elevating workers to heights that are comfortable and ergonomically correct. Especially useful when multiple shiftemployees operate the same piece of machinery. Serrated style platforms ensure safe footing in most wet environments. Ergonomic matting deckstyle provides comfort for the operator who stands all day. The height of each leg can be adjusted individually to ensure proper working height.All sizes have four legs except the 60", 72" and 96" long models which have six legs. Uniform capacity is 500 lbs. each. Welded construction.Custom FinishAvailableSERRATED DECKERGO-MATTING DECKThreaded ScrewLegs are StandardNewERGONOMIC SOLUTIONSDECK SIZE(W x L)SERVICERANGESTEELMODEL NUMBERNET WT.(LBS)LIST PRICEEACHSTAINLESS STEELMODEL NUMBERNET WT.(LBS)LIST PRICEEACHALUMINUMMODEL NUMBERNET WT.(LBS)LIST PRICEEACHSERRATED DECK19" x 24" 5" to 8" AHW-L-1924 22 $160.00 AHW-L-1924-SS 24 $768.00 AHW-L-1924-A 17 $520.0024" x 24" 5" to 8" AHW-L-2424 30 172.00 AHW-L-2424-SS 33 826.00 AHW-L-2424-A 21 559.0019" x 36" 5" to 8" AHW-L-1936 35 190.00 AHW-L-1936-SS 39 912.00 AHW-L-1936-A 24 618.0024" x 36" 5" to 8" AHW-L-2436 40 $200.00 AHW-L-2436-SS 44 $960.00 AHW-L-2436-A 26 $650.0019" x 48" 5" to 8" AHW-L-1948 44 212.00 AHW-L-1948-SS 48 1,018.00 AHW-L-1948-A 28 689.0024" x 48" 5" to 8" AHW-L-2448 49 224.00 AHW-L-2448-SS 54 1,075.00 AHW-L-2448-A 31 728.0024" x 60" 5" to 8" AHW-L-2460 59 $248.00 AHW-L-2460-SS 65 $1,190.00 AHW-L-2460-A 36 $806.0024" x 72" 5" to 8" AHW-L-2472 72 308.00 AHW-L-2472-SS 79 1,478.00 AHW-L-2472-A 42 1,001.0024" x 96" 5" to 8" AHW-L-2496 94 403.00 AHW-L-2496-SS 103 1,934.00 AHW-L-2496-A 53 1,310.0019" x 24" 9" to 14" AHW-H-1924 42 $191.00 AHW-H-1924-SS 46 $917.00 AHW-H-1924-A 27 $621.0024" x 24" 9" to 14" AHW-H-2424 48 197.00 AHW-H-2424-SS 53 946.00 AHW-H-2424-A 30 640.0019" x 36" 9" to 14" AHW-H-1936 50 204.00 AHW-H-1936-SS 55 979.00 AHW-H-1936-A 31 663.0024" x 36" 9" to 14" AHW-H-2436 54 $212.00 AHW-H-2436-SS 59 $1,018.00 AHW-H-2436-A 33 $689.0019" x 48" 9" to 14" AHW-H-1948 58 222.00 AHW-H-1948-SS 64 1,066.00 AHW-H-1948-A 35 722.0024" x 48" 9" to 14" AHW-H-2448 60 233.00 AHW-H-2448-SS 66 1,118.00 AHW-H-2448-A 36 757.0024" x 60" 9" to 14" AHW-H-2460 68 $259.00 AHW-H-2460-SS 75 $1,243.00 AHW-H-2460-A 40 $842.0024" x 72" 9" to 14" AHW-H-2472 78 322.00 AHW-H-2472-SS 86 1,546.00 AHW-H-2472-A 45 1,047.0024" x 96" 9" to 14" AHW-H-2496 102 429.00 AHW-H-2496-SS 112 2,059.00 AHW-H-2496-A 57 1,394.00ERGO-MATTING DECK19" x 24" 5" to 8" AHT-L-1924 25 $188.00 AHT-L-1924-SS 28 $902.00 AHT-L-1924-A 19 $611.0024" x 24" 5" to 8" AHT-L-2424 33 206.00 AHT-L-2424-SS 36 989.00 AHT-L-2424-A 23 670.0019" x 36" 5" to 8" AHT-L-1936 38 230.00 AHT-L-1936-SS 42 1,104.00 AHT-L-1936-A 25 748.0024" x 36" 5" to 8" AHT-L-2436 44 $252.00 AHT-L-2436-SS 48 $1,210.00 AHT-L-2436-A 28 $819.0019" x 48" 5" to 8" AHT-L-1948 47 267.00 AHT-L-1948-SS 52 1,282.00 AHT-L-1948-A 30 868.0024" x 48" 5" to 8" AHT-L-2448 52 294.00 AHT-L-2448-SS 57 1,411.00 AHT-L-2448-A 32 956.0024" x 60" 5" to 8" AHT-L-2460 63 $334.00 AHT-L-2460-SS 69 $1,603.00 AHT-L-2460-A 38 $1,086.0024" x 72" 5" to 8" AHT-L-2472 76 412.00 AHT-L-2472-SS 84 1,978.00 AHT-L-2472-A 44 1,339.0024" x 96" 5" to 8" AHT-L-2496 100 541.00 AHT-L-2496-SS 110 2,597.00 AHT-L-2496-A 56 1,758.0019" x 24" 9" to 14" AHT-H-1924 48 $219.00 AHT-H-1924-SS 53 $1,051.00 AHT-H-1924-A 30 $712.0024" x 24" 9" to 14" AHT-H-2424 54 232.00 AHT-H-2424-SS 59 1,114.00 AHT-H-2424-A 33 754.0019" x 36" 9" to 14" AHT-H-1936 56 245.00 AHT-H-1936-SS 62 1,176.00 AHT-H-1936-A 34 796.0024" x 36" 9" to 14" AHT-H-2436 60 $264.00 AHT-H-2436-SS 66 $1,267.00 AHT-H-2436-A 36 $858.0019" x 48" 9" to 14" AHT-H-1948 64 276.00 AHT-H-1948-SS 70 1,325.00 AHT-H-1948-A 38 897.0024" x 48" 9" to 14" AHT-H-2448 66 302.00 AHT-H-2448-SS 73 1,450.00 AHT-H-2448-A 39 982.0024" x 60" 9" to 14" AHT-H-2460 74 $346.00 AHT-H-2460-SS 81 $1,661.00 AHT-H-2460-A 43 $1,125.0024" x 72" 9" to 14" AHT-H-2472 84 426.00 AHT-H-2472-SS 92 2,045.00 AHT-H-2472-A 48 1,385.0024" x 96" 9" to 14" AHT-H-2496 110 568.00 AHT-H-2496-SS 121 2,726.00 AHT-H-2496-A 61 1,846.00Plastic Floor GridDC-25/FC-50Ideal for storing product at an elevated height above cold and damp floors. Alternatively used as anergonomic work surface to provide an anti-fatigue worker friendly environment. Snap together, abrasionresistant "GRID" sections are ideal for wet floors such as paint booths, car washes, or general work areas.Lightweight units are only 2 pounds per section. Easy to attach, no hardware necessary. Sold 15 per box.MODELOVERALL SIZE UNIFORM CAPACITY QUANTITY NET WT. LIST PRICENUMBER(W x L x H)(POUNDS)PER BOX PER BOX PER BOXF-GRID 11.8" x 23.6" x 1" 1,100 15 30 lbs. $84.00DC-25/UPS/FC-250Phone (800) 348-0868www.vestil.com
Adjustable Step-Mate StandsOur Step-Mate Stands can be used as either a comfortable worker platform or a semi-permanentstep. Individual step size is 12" deep. Top step is fixed 7" higher than bottom step. The first stepis adjustable 4¼" to 8¾", second step 11¼" to 15¾", and third step is 18¼" to 22¾".Serrated surface ensures safe footing. Legs adjust individually by screwing them into orout of the leg base. Welded construction. Uniform capacity 500 lbs.OVERALL SIZE(W x D)NUMBEROF STEPSPortability dolly kit allowsfor movement of multiplestep units. Dolly featuresspecial brackets for usewith step stands. Includestwo pneumatic wheels forportability.model ASP-PORT-HTList Price Ea. $72.00STEEL MODELNUMBERNET WT.(LBS)LIST PRICEEACHSTAINLESS STEELMODEL NUMBERNET WT.(LBS)LIST PRICEEACHALUMINUMMODEL NUMBERNET WT.(LBS)LIST PRICEEACH24" x 24" 2 ASP-24 25 $210.00 ASP-24-SS 28 $1,008.00 ASP-24-A 19 $683.0036" x 24" 2 ASP-36 33 226.00 ASP-36-SS 36 1,085.00 ASP-36-A 23 735.0048" x 24" 2 ASP-48 38 246.00 ASP-48-SS 42 1,181.00 ASP-48-A 25 800.0060" x 24" 2 ASP-60 44 274.00 ASP-60-SS 48 1,315.00 ASP-60-A 28 891.0072" x 24" 2 ASP-72 47 338.00 ASP-72-SS 52 1,622.00 ASP-72-A 30 1,099.0024" x 36" 3 ASP-24-3 40 $288.00 ASP-24-3-SS 44 $1,382.00 ASP-24-3-A 26 $936.0036" x 36" 3 ASP-36-3 51 300.00 ASP-36-3-SS 56 1,440.00 ASP-36-3-A 32 975.0048" x 36" 3 ASP-48-3 62 313.00 ASP-48-3-SS 68 1,502.00 ASP-48-3-A 37 1,017.00Linearizer Electric Worker PlatformsBolt-on portability kit, allowsStep-Mate Stands to be tilted andmoved. Handle also serves as asingle side handrailing for extrastability and balance while standingon top step. Includes handle andtwo rigid wheels. Steel construction withpainted finish. Fits on 24", 36" and 48"wide units.model ASP-PORTList Price Ea. $66.00Designed to raise or lower a worker to optimum working height. Typical applications include packagingstations, heavy machinery such as drill presses, or individual work cells. Lifting source is a low maintenanceelectric linear actuator. An ergonomic anti-fatigue mat is included on the platform. Two rigid casters on theback side are standard. Unit is operated with a pendant hand held push button control on an 8' cord.Newmodel ASP-48Custom FinishAvailablemodel ASP-48-381model ASP-36-SSDC-25/FC-50MODELNUMBERPLATFORMSIZE (W x L)LOWEREDHEIGHTRAISEDHEIGHTUNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHOPERATIONWP-400-AC 36" x 24" 2" 14" 400 115V AC POWER 288 $1,151.00WP-400-DC 36" x 24" 2" 14" 400 12V DC POWER 299 1,151.00WP-400-AIR 36" x 24" 2" 14" 400 FACTORY AIR 288 1,151.00Posi-Crank Worker PlatformsMODELNUMBERPLATFORMSIZE (W x L)LOWEREDHEIGHTRAISEDHEIGHTUNIFORMCAPACITYNET WT.(POUNDS)DC-25/FC-70With a simple turn of a crank, the Posi-Crank Worker Platform height may be adjusted to the optimumergonomic level suitable for each operator. The Posi-Crank incorporates the use of ACME threaded rodsand a series of gears for simple yet effective height adjustment. The crank handle may be removed formaximizing the operating space. The deck is constructed of steel tread plate for better traction.LIST PRICEEACHOPERATIONPOS-3636 36" x 36" 3" 19" 500 HAND CRANK 193 $851.00POS-3648 36" x 48" 3" 19" 500 HAND CRANK 220 942.00POS-3672 36" x 72" 3" 19" 500 HAND CRANK 283 1,050.00ELECTRIC/HYDRAULIC OPERATION, model POS-EH, $941.00 LIST ADDERElectric Order PickerMODELNUMBEROVERALL SIZE(W x L x H)12V DC STANDARDModel EOP-440: Reduce strain while increasing safety and productivity during repeated orderpicking applications. Manually pushed unit is easy to position. The lift operates with a 12V DCbattery. Includes an on-board charger.Model EOP-500: All steel, manually-propelled EOP-500 allows personnel to access material storedin elevated locations faster, safer, and more efficiently than traditional means. Features includebubble levels for proper leveling and safety stops to mechanically prevent the platform fromlowering during maintenance. Compact, stable lifts are designed to maneuver in tight spaces andto provide simple, push-button elevator activation. Manual platform emergency lowering valveand slip-resistant deck standard. Rolls on 8" polyurethane swivel and fixed casters. Lift time whenloaded is 20 seconds. With the unit unloaded, lift time is 14 secondsSERVICERANGEUNIFORMCAPACITYNET WT.(LBS.)LIST PRICEEACHEOP-440 24¾" x 47½" x 41" 26" TO 59" 440 333 $2,951.00EOP-500 28¾" x 49½" x 70½" 27" TO 118" 500 715 $6,921.00DC-25/FC-92.5DC-20/FC-70model EOP-440model EOP-500www.vestil.com Phone (800) 348-0868NewERGONOMIC SOLUTIONS
82ERGONOMIC SOLUTIONSPhone (800) 348-0868NewFOREST GREEN, model RWPT-FG-24-GRNGREY, model RWPT-GY-39-GRNseries TSFSINGLE-PLY MATTINGseries EAM-SNewvestilgreenHOW TOASSEMBLENewvestilgreenvestilgreenAdd-A-LevelRaise workers to an optimum ergonomic height. Constructed from a heavy-density polyethylene resinwhich is 100% recycled. The flow-through grid design permits liquids and small scrap to drain away.Also good for use as storage platform to keep products off wet floors. Add-on units come standardwith vertical connectors to allow units to be stacked and locked together. The poly-clip connector kitallows you to connect units side by side. Many different configurations available, contact factory.MODELNUMBER DESCRIPTION WIDTH LENGTH HEIGHTMODELNUMBERMODELNUMBERSIZE(W x L) THICKNESS COLORSIZE(W x L) COLORNET WT.(POUNDS)NET WT.(POUNDS)LIST PRICEEACHRWPT-BL-24-GRN 24" x 24" 1" BLACK 28 $66.00RWPT-BL-24-GRN-1.75 24" x 24" 1¾" BLACK 35 87.00RWPT-TC-24-GRN 24" x 24" 1" TERRA COTTA 28 $66.00RWPT-TC-24-GRN-1.75 24" x 24" 1¾" TERRA COTTA 35 87.00RWPT-FG-24-GRN 24" x 24" 1" FOREST GREEN 28 $66.00RWPTFG-24-GRN-1.75 24" x 24" 1¾" FOREST GREEN 35 87.00RWPT-GY-24-GRN 24" x 24" 1" GREY 28 $66.00RWPT-GY-24-GRN-1.75 24" x 24" 1¾" GREY 35 87.00DC-20/FC-100/UPSLIST PRICEEACHDESCRIPTIONTSF-GRN SURFACE 19½" x 19½" x ¾" BLACK 5 $16.00TSF-RAMP-GRN RAMP 19½" x 5¾" x ¾" BLACK 1 10.25TSF-CRNR-GRN CORNER 6" x 6" x ¾" BLACK 1 7.50100% RECYCLEDMATERIALNET WT.(POUNDS)DC-20/FC-100/UPSLIST PRICEEACHMODEL NUMBEREAM - S - (WIDTH") - (LENGTH") - (COLOR) SINGLE-PLY MATTING 1.05 LBS./FT² $12.00EAM - D - (WIDTH") - (LENGTH") - (COLOR) DOUBLE-PLY MATTING 1.50 LBS./FT² 18.00MAT COLORS - BLACK, BLUE, BROWN, GRAY, GREEN, ORANGE, RED, WHITE, YELLOWUNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHP-2436-2.625 BASE 24" 36" 2.875 250 12 $55.00P-2436-2.625-A ADD-ON 24" 36" 2.625 250 12 55.00P-2448-2.625 BASE 24" 48" 2.875 250 15 $88.00P-2448-2.625-A ADD-ON 24" 48" 2.625 250 15 88.00P-2496-2.625 BASE 24" 96" 2.875 250 30 $115.00P-2496-2.625-A ADD-ON 24" 96" 2.625 250 30 115.00P-3696-2.625 BASE 36" 96" 2.875 250 44 $147.00P-3696-2.625-A ADD-ON 36" 96" 2.625 250 44 147.00YELLOW BOARDER MATTINGM-2436-YB MATTING 24" 36" ½" n/a 12 $113.00M-2448-YB MATTING 24" 48" ½" n/a 15 218.00M-2496-YB MATTING 24" 96" ½" n/a 28 282.00M-3696-YB MATTING 36" 96" ½" n/a 39 350.00POLY CLIP CONNECTOR KIT, model VRC-3000, $7.00 LIST / PACK OF FOURRooftop/Walkway Patio Paver TilesTread Safe Interlocking Non-Slip Industrial SurfaceDC-25/FC-100Ideal for high-traffic roofs, rooftop patios, condo patios, these walkway pads are a safe, durable solutionfor any area. Made in the USA from durable recycled tire rubber, these tiles are environmentallyfriendly and provide excellent resistance to severe wind/weather, as well as damaging UV rays. Easy toinstall by either adhering to a base, bonding side to side, or laying loose. Tiles leave no standing water,due to their 1¾" drainage grooves.Tread Safe Flooring can be used indoors or outdoors and is a Green alternative to your safetyflooring. The precision octagon grid design allows for a free flow of liquids below the surface ofthe tiles to keep feet comfortable and dry. More comfortable to stand on, anti-fatigue benefits withmore than 50% recycled rubber and the remainder is postindustrial recycled plastic. Flooring isresistant to extreme temperature variations, UV light, oil, and moisture. Other colors available,contact factory. Made in the USA.Ergo Anti-Fatigue MattingUnique waffle-pattern ergo matting provides comfort for users that stand all day long. Single-plymatting is designed for occasional use. Double-ply matting is designed for heavy-duty use includingwheeled cart traffic. Many different colors to choose from. Pricing is noted for maximum width of 48".Available in roll lengths up to 50 feet. For special widths greater than 48" contact factory.DC-25/UPS/FC-100www.vestil.com
Ergonomic MattingProvide your workers the comfort cushioning they deserve while standing long hours at a time.These mats are ideal for use at industrial workstations, retail stores, restaurants, and offices. Threedifferent styles to choose from.MODELNUMBERSIZE(W x L) THICKNESSNET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONITMAT-23 INDUSTRIAL Tread plate 2' x 3' 9/16" 6 $42.00ITMAT-35 INDUSTRIAL Tread plate 3' x 5' 9/16" 15 102.00ITMAT-312 INDUSTRIAL Tread plate 3' x 12' 9/16" 36 241.00CK-35 COMFORT KING MATTING 3' x 5' 3/8" 14 $73.00CK-310 COMFORT KING MATTING 3' x 10' 3/8" 32 137.00WM-23 WELDING SPARK SAFE MATTING 2' x 3' ½" 7 $52.00WM-35 WELDING SPARK SAFE MATTING 3' x 5' ½" 17 123.00WM-312 WELDING SPARK SAFE MATTING 3' x 12' ½" 42 295.00Heated Walkway Mats & Stair MatsDC-20/UPSDesigned to prevent snow and ice accumulation around the home or facility. They plug in anystandard 115V outlet generating heat to melt snow at a rate of 2" per hour. The mats are built withnon-slip; UV protected reinforced rubber, and are designed to be left outside for the entire winterseason. Each unit comes with ½" grommet holes on each side (approximately every three feet) to helpsecure them in place. Units come with a 6' cord.Stair Mats are designed with watertight connector cables enabling it to connect to additional stair mats.A single outlet can connect up to 10 stair mats. Each mat comes with one power supply cord, 6' long.MODELNUMBEROVERALL SIZE(W x L) WATTS AMPSNET WT.(POUNDS)LIST PRICEEACHHEATED WALKWAY MATSWHM-2460 24" x 60" 301 2.5 20 $325.00WHM-24120 24" x 120" 635 5.3 39 650.00WHM-3660 36" x 60" 457 3.8 33 $485.00WHM-36120 36" x 120" 964 8.0 66 970.00HEATED STAIR MATSSHM-1136 11" x 36" 70 0.6 6 $145.00SHM-1148 11" x 48" 96 0.8 8 190.00ACCESSORIESTST-120 THERMOSTAT 15 2 $35.00STS-120 SNOW & TEMPERATURE SENSOR 18 5 310.00Assembly Chairs115V 1-PHASE STANDARDDC-25/UPS/FC-100High quality durable seating is ideal for production lines, workstations, and industrial/commercialenvironments. Pneumatic seat height adjustment. Easy to clean seats. The ergonomic style of modelWSS-60 features a five foot pad design and a stand with tilt adjustment. The worker stool, modelWLPS-2, has a soft foamed polyurethane seat with a five foot pad base design with casters.COMFORT KINGMATTINGseries CKWELDINGSPARK SAFEMATTINGseries WMNewINDUSTRIAL Tread plateseries ITMAT83MODELNUMBERMODELNUMBERBASE SIZE(W x D)SEATHEIGHT RANGESEAT SIZE(W x D)UNIFORMCAPACITY (LBS)SEAT HEIGHTRANGEUNIFORMCAPACITYNET WT.(POUNDS)NET WT.(POUNDS)LIST PRICEEACHDIAMETERWSS-60 12½" 21" to 31" 250 20 $161.00WLPS-2 13½" 15" to 20" 300 15 106.00Ergonomic Worker SeatsDC-25/UPS/FC-100From a low crouch to a standing position, the seat height of the CPRO-200 and CPRO-600 canbe adjusted in 2" increments by removing the seat and hooking it to the horizontal bars located onthe chair frame. These units have four rubber "shocks" under the seat base that allow the seat to tiltforward, left, and right so it can accommodate your body movements. The front tilted position of theseat helps the user maintain the natural posture position of the spine.The portable work chair, model CPRO-800LP, is not only convenient but easy to use. Simply unfold therear legs and slide the contoured padded seat to the desired ergonomic height. The infinite adjustmentguarantees the optimum work posture. Folds up to a 4" profile for easy portability and storage.LIST PRICEEACHCPRO-200 14" x 21" 14" x 9" 13" to 26" 400 12 $148.00CPRO-600 14" x 21" 14" x 9" 13" to 34" 400 18 178.00CPRO-800LP 13" x 20" 13½" x 10" 18" to 33" 300 20 113.00DC-40/UPS/FC-100model WSS-60modelCPRO-800LPmodelCPRO-200model WLPS-2modelCPRO-600ERGONOMIC SOLUTIONSwww.vestil.com Phone (800) 348-0868
84Massage & Heat Cushion12V CIGARETTE PLUG STANDARDUnique product design provides operator massage and heat for better comfort during longsitting periods. Includes 12V cigarette plug, home adapter, and fork truck adapter for use in forktrucks, cars, and office chairs. LCD hand held control provides nice visual for user to recognizedifferent massage and heat settings. Automatic shut-off times of 10, 20 and 30 minutes.Adjustable intensity with eight modes for different massage settings. Cushion is attached to seatwith elastic straps.modelBACK-MAXMODELNUMBERSEAT SIZE(W x L)BACK SIZE(W x H) MASSAGE HEATERNET WT.(POUNDS)LIST PRICEEACHCUSH-M 20" x 18" 20" x 29" YES NO 5 $129.00CUSH-M-H 20" x 18" 20" x 29" YES YES 5 141.00Back Support CushionsThere is more stress placed on the lower back than on any other part of the body. Providessupport for the lower back to relieve and prevent back pain and fatigue. The S-shaped framecomfortably conforms to the natural S-curve of the spine to guide the back into correctalignment and promote proper sitting posture. Lightweight and portable. Designed for usein any seat; in the office, vehicle, fork truck, or at home. Attaches with hook and loop typefasteners. All Back Support Cushions are black in color.DC-25/UPSmodelBACK-COMBOMODELNUMBEROVERALL SIZE(W x D x H)NET WT.(POUNDS)LIST PRICEEACHPRICE FOR 2OR MOREDESCRIPTIONBACK-MAX DELUXE 19" x 8" x 22" 4½ $48.90 $46.70BACK-COMBO COMBINATION 19" x 8" x 22" 6 57.10 52.50DC-25/UPSFork Truck Seats and AccessoriesErgonomic and comfortable seat design helps provide optimum body support for individualoperators. Replace worn or broken fork truck seats with our easy to install universal mountingdesign. Standard features include: ergonomic seat design, vinyl or cloth material, low profile design,safety seat switch, storage pockets, seat back angle adjustment 8°, and retractable safety belt.model LTS-Vwith seat beltmodel LTS-PNmodel LTSD-Vwith seat beltmodel LTS-ETErgo-Turn System - Smooth pivoting motion enables driver to turn seat 30° left or right ofcenter position. Swivel system can be incorporated with air suspension system for total driverergonomics.Air Suspension System - Minimizes harmful vibration to fork truck driver. Reduces fatigue andback pain.Seat Safety Switch - Prevents fork truck from operating when an operator is not sitting on theseat. Rated 50 VDC, 2A.Chrome Hip Restraints - Used in place of arm rests to stabilize and secure the operator in the forktruck seat.Flip Up Arm Rest - Flip up arm rests are moveable to allow easy access on and off fork truck.ERGONOMIC SOLUTIONSmodel LTS-HRmodel LTS-FTSBmodel LTS-SSSmodel LTS-ARmodelDESK-MMODELNUMBERNET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONLTSD-V VINYL FORK TRUCK SEAT WITH SEAT BELT 50 $165.00LTSD-C CLOTH FORK TRUCK SEAT WITH SEAT BELT 49 165.00LTS-V VINYL FORK TRUCK SEAT WITH SEAT BELT 40 $114.00LTS-C CLOTH FORK TRUCK SEAT WITH SEAT BELT 39 114.00ACCESSORIES FOR BOTH THE LTSD and LTSLTS-ET SWIVEL PLATFORM WITH 30° LEFT/RIGHT 22 $125.00LTS-PN AIR SUSPENSION SYSTEM 29 97.00LTS-SSS SEAT SAFETY SWITCH (REPLACEMENT) 2 23.00LTS-HR CHROME PLATED HIP RESTRAINTS 4 30.00LTS-AR FLIP UP STYLE ARM RESTS 6 37.00LTS-FTSB FORK TRUCK SAFETY BELT (REPLACEMENT) 5 42.00DC-30/FC-125Desk MoverMove fully loaded desks without removing drawers and files. To use: position the 31½" wide by16" deep platform under desk pedestals and depress handle to raise desk and engage safety latch.Standard features include steel lift platform and removable handle. Elevated desk moves easilywith or without handle on 3" swivel rubber casters.MODEL LOWEREDRAISED UNIFORM CAPACITY NET WT. LIST PRICENUMBER HEIGHTHEIGHT(POUNDS) (POUNDS) EACHDESK-M 4¾" 10¼" 600 45 $183.00DC-25/UPS/FC-70Phone (800) 348-0868www.vestil.com
85Fork Truck JacksManual Hydraulic Fork Truck JackDesigned to raise your fork truck for maintenance. Features high-quality seals, chrome platedinternal components, and rugged steel construction. Maximum lift of 16" provides roomneeded to perform a variety of repairs. Manually raised by hand pump lever. Removablehandle and compact size makes it easy to maneuver and transport. Includes two jack stands(13 ton capacity per pair) with holding pins for adjustable heights.Air Powered Fork Truck JackAir-assist motor quickly raises saddle to lift point and then lifts load to desired height.Air powered for quick and easy operation. Uses standard coupler hook-up to a shop aircompressor with air regulator control lever handle. Pressure relief valve is located on top ofhandle for metered control and load height adjustment.MODELNUMBERSERVICERANGEUNIFORMCAPACITY (LBS.)NET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONFORK-J HYDRAULIC 2¼" to 16" 8,000 98 $395.00AIR-J AIR 8¼" to 18¼" 44,000 131 611.00Heavy-Duty Power Pack (hydraulic maintenance sets)DC-25/UPS/FC-70Hand operated hydraulic maintenance set enables the user to safely and conveniently push,pull, spread, and bend to accomplish daily maintenance tasks. The 4 ton kit comes in ahandy storage/carrying case. The 10 ton kit comes in a roller case.model H-44 TONMANUALHAND PUMPmodel FORK-JAIR POWEREDmodel AIR-JMODELNUMBERCASE SIZE(W x L x H)NUMBEROF PIECESUNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHH-4 23" x 13" x 7" 15 4 TONS 40 $222.00H-10 36" x 15" x 7" 16 10 TONS 75 265.00Quick Adjust VisesMODELNUMBERMODELNUMBERMAXIMUMWIDTHUNIFORMCAPACITYJAWWIDTHNET WT.POUNDSNET WT.(LBS.)DC-25/UPS/FC-85• Pipe Vise Feature • Rotates on Base • Precision SliderRotate knob one turn counterclockwise and move jaw freely in or out to quickly adjust toyour needs.LIST PRICEEACHDESCRIPTIONVISE-5 ADJUSTABLE VISE 5" 4.1" 17 $106.00VISE-6 ADJUSTABLE VISE 6" 5.3" 21 125.00VISE-8 ADJUSTABLE VISE 8" 7.1" 33 170.00DC-25/UPS/FC-70Battery Transfer CartBattery Transfer Cart is designed for use with pallet trucks to load, unload, and transfer fork truckbatteries. Features roller deck for easy battery movement. Front locking safety tabs to secure batteryin cart. Pallet truck is not included. Welded steel construction with powder coat yellow finish.The stand alone Battery Transfer Cart, model BTC-CART, includes casters for portability. Specifyroller height when ordering.Optional winch attachment, model BTC-WINCH, can be installed easily to either BTC unit withthe supplied hardware. The manual winch is designed to pull battery out of fork truck.MODELNUMBEROVERALL SIZE(W x D x H)UNIFORMCAPACITYNET WT.(LBS.)LIST PRICEEACHDESCRIPTIONBTC-PJ USE W/PALLET TRUCK 32" x 42" x 7" 4,000 140 608.00BTC-CART* STAND ALONE CART 30" x 40" 4,000 250 775.00BTC-WINCH WINCH ATTACHMENT 46"H -- 30 95.00*SPECIFY ROLLER HEIGHT WHEN ORDERINGSynchronized Lift SystemsDC-25/FC-70This unique system may be attached to your equipment to allow for quick and easy height adjustment.It provides for completely synchronized lifting of all four legs at the same time, regardless of weightdistribution. Electric/hydraulic operation with single or three phase power available (specify whenordering). Includes four lifting legs with flexible hydraulic hose and quick connectors, slave-stylemanifold block, and electric motor. Each lifting leg includes a bolt-on mounting plate (hardware notincluded). The easy to install components are shipped ready to use. Steel construction.LIST PRICEEACHDESCRIPTIONSTROKESYNC-3 (4) Retrofit Legs, Pump & Manifold 3,000 12" 400 $4,641.00SYNC-6 (4) Retrofit Legs, Pump & Manifold 6,000 12" 450 6,763.00DC-20/FC-70model H-1010 TONmodel BTC-PJ WITH WINCH ATTACHMENT,model BTC-WINCHwww.vestil.com Phone (800) 348-0868ERGONOMIC SOLUTIONS
86Opti-Benches (mechanical adjustable-height work table)An ergonomic work station featuring a variable height working surface for accommodatingdifferent sized workers. This work station utilizes a manual hand crank that will easily raiseor lower the working surface. A handy storage shelf is located underneath the platform. Steelconstruction. Painted finish.MODELNUMBERPLATFORMSIZE (W x L)SERVICERANGEUNIFORMCAPACITY (LBS.)NET WT.(POUNDS)LIST PRICEEACHHAND CRANK, MECHANICALERG-3048-M 30" x 48" 30" to 46" 500 550 $1,413.00ERG-3060-M 30" x 60" 30" to 46" 500 616 1,487.00ERG-3660-M 36" x 60" 30" to 46" 500 715 1,534.00ERG-3672-M 36" x 72" 30" to 46" 500 781 1,626.00HAND CRANK, HYDRAULICERG-3048-H 30" x 48" 30" to 46" 500 550 $1,413.00ERG-3060-H 30" x 60" 30" to 46" 500 616 1,487.00ERG-3660-H 36" x 60" 30" to 46" 500 715 1,534.00ERG-3672-H 36" x 72" 30" to 46" 500 781 1,626.00ELECTRIC HYDRAULIC, 115V 1-PHASE POWERERG-3048-EH 30" x 48" 30" to 46" 500 601 $1,897.00ERG-3060-EH 30" x 60" 30" to 46" 500 635 1,973.00ERG-3660-EH 36" x 60" 30" to 46" 500 737 2,021.00ERG-3672-EH 36" x 72" 30" to 46" 500 795 2,113.00DC-20/FC-70model EWB-6030Manual Adjustable Ergonomic Work BenchesRaise material to an ergonomic working height with the Manual Adjustable ErgonomicWork Bench. A fold away hand crank is located directly under the platform for easy raisingand lowering. Hydraulic system will raise platform evenly. Rugged steel understructure.MODELNUMBERPLATFORMSIZE (W x L)SERVICERANGEUNIFORMCAPACITY (LBS.)NET WT.(POUNDS)LIST PRICEEACHEWB-6030 60" x 30" 32" to 46" 750 316 $1,095.00EWB-7236 72" x 36" 32" to 46" 750 339 1,126.00DC-20/FC-70ERGONOMIC SOLUTIONSPhone (800) 348-0868model EAH-3672-MTMaple Top Includedmodel EAH-2465PUSH BUTTON SLIDEOUT CONTROL PANELElectric Adjustable-Height Work BenchesSoft start and stop prevents jarring and provides smooth and even height adjustment.Increase productivity while decreasing fatigue and trauma associated with uncomfortablework positions. Hand pendant control with raise and lower buttons on coil cord andhideaway slide in tray. 115V, 1 phase power supply standard.Extremely sturdy construction with programmable controller allows for three preset heightsor for infinite control up and down range with push buttons. Uniform capacity is 750 lbs.MODELNUMBERPLATFORMSIZE (W x L)SERVICERANGENET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONEAH-3672-MT MAPLE TOP 36" x 72" 28" to 45½" 309 $2,186.00EAH-2465 FRAME ONLY 24" x 65" 26½" to 44" 204 1,831.00Linear Actuated Adjustable-Height Work Bench115V 1-PHASE STD.OPTIONS ON PG. 43DC-20/FC-70Increase productivity by allowing the body to reposition to a more comfortable position.The Linear Actuated Adjustable-Height Table allows anyone, regardless of their height, toeasily use the table as a workstation or desk. Cantilever design optimizes foot, knee, and legroom. The 36" wide x 36" deep platform is large enough for small parts assembly and willhold up to 500 pounds evenly distributed. A hand-held raise and lower control is attachedto the understructure of the table; no more misplacing the remote. Durable hardwoodplatform standard.MODEL PLATFORM SERVICE UNIFORM OVERALL FRAME NET WT. LIST PRICENUMBER SIZE (W x L) RANGE CAPACITY SIZE (W x L) (POUNDS) EACHLAW-3636 36" x 36" 30" to 45" 500 36" x 36" 210 $1377.00DC-20/FC-70www.vestil.com
Semi-Automatic Stretch Wrap Machines115V 1-PHASE STD, OPTIONS BELOWIncrease productivity in the shipping department or at the end of a production line.This unit is complete with a 48" diameter powered turntable and counter-balancedstretch film mast. Easy to operate, simply depress the foot pedal and manually move themast up and down. Powered by a 115V, 1/2 HP motor with soft start/stop and variablespeed control. Variable R.P.M. 3-12. Unit comes with one film rod with special spacersthat can be used with any height roll of stretch wrap material between 10" and 20".Ships with mast unbolted. Some assembly required.The Approach Ramp option allows the operator to load and unload the machine with apallet truck (model SWA-48 only).The Powered Mast option is available with a 24V hand control to work with thosetaller loads. The hand held control is used to raise/lower the film while the foot controlis used to operate the turntable.87PACKAGING EQUIPMENTDVD or VIDEOAVAILABLEOPTIONALAPPROACH RAMPDIGITAL SCALEmodel SWA-SCALE(SWA-48 sold separately)modelSWA-60-PMO115V, 1/2 HPMOTORAPPROACH RAMPmodel SWA-R-4836MODELNUMBERTURNTABLEDIAMETERTURNTABLEHEIGHTUNIFORM CAPACITY(POUNDS)MAXIMUM LOADDIAMETERMAXIMUM LOADHEIGHTNET WT.(POUNDS)LIST PRICEEACHSWA-48 48" 2 3 /8" 4,000 76" 78" 665 $3,993.00SWA-54 54" 11" 5,000 86" 75" 1543 5,853.00SWA-60 60" 11" 5,000 86" 75" 1659 6,119.00ACCESSORIES & OPTIONSSWA-PMO 115V POWERED MAST OPTION (FACTORY INSTALLED)30 $2,025.00SWA-PMO-VCC VOLTAGE CHANGE ADDER FOR NON-115V SINGLE PHASE POWERED MASTS-- 560.00SWA-PMO-RF 115V POWERED MAST OPTION (RETROFIT - FIELD INSTALLED)120 2,604.00SWA-SCALE* SCALE (AVAILABLE ONLY ON SWA-48 & ADDS 3" TO HEIGHT - FACTORY INSTALLED) 680 4,045.00SWA-VCC NON-STANDARD VOLTAGE OR PHASE SUPPLY (115V 1 PHASE STANDARD)--- 431.00SWA-R-4836* 48"W x 36"L x 2-¼"H APPROACH RAMP (FOR ELECTRIC PALLET TRUCKS)*175 353.00SWA-R-4848* 48"W x 48"L x 2-¼"H APPROACH RAMP (FOR MANUAL PALLET TRUCKS)*220 467.00SWA-R-4860-SCL 48"W x 60"L x 6"H APPROACH RAMP (FOR SWA-48 WITH SCALE) (ELECTRIC & MANUAL PALLET TRUCKS) 346 674.00SWA-FILM 20"W x 80 ga. x 6,000' x 3" CORE (ONE ROLL)42 112.00SWA-REV TWIN FOOT SWITCH CONTROL FOR FORWARD/REVERSE OPERATION 15 $215.00SWA-COUNT COUNTER OPTION, KEEP TRACK OF CAROUSEL ROTATION 5 352.00SWA-NRTL-COMP UL APPROVED COMPONENTS 10 265.00SWA-INDEX AUTO-INDEXING 90°, 120°, OR 180° 25 583.00SWA-NM SWA-54 & 60 WITH NO MAST (SPECIFY TURNTABLE DIAMETER) --- -515.00*FOR USE WITH MODEL SWA-48 ONLYDC-20/FC-60Low Profile Stretch Wrap MachineMODELNUMBERTURNTABLEDIAMETERTURNTABLEHEIGHT115V 1-PHASE STANDARDEnjoy the features of our thin-spin carousel but with the added benefit of a stretch wrap machine withpowered rotation. Rotation is controlled by a foot switch on 8' cord. 115V power input with variableAC motor allows adjustable deck speed of 3-12 rpm and includes soft-start / stop. With the overallheight at only 1", loading and unloading up to 4,000 uniform lbs. is possible by the use of a manual orpowered pallet truck. A built-in perimeter ramp allows over 300° of access. Unit comes standard withmanual stretch wrap mast. Optional 115V, 1 phase AC powered mast option (PMO) includes handcontrol with up and down buttons. Film-wrap tension is controlled with an adjustable, friction-brakeassembly. Film placement is controlled manually by moving the carriage assembly up and down onthe vertical mast. An easy-to-release, hand operated carriage-brake allows the carriage to move freelymaking film application fast and simple.UNIFORMCAPACITYNET WT.(LBS.)LIST PRICEEACHSWA-51-LP 51" 1" 4,000 450 $5,079.00SWA-LP-PMO POWERED MAST OPTION, 115V SINGLE PHASE 450 2,025.00DC-20/FC-60LOW PROFILE DESIGNDOES NOT REQUIREAPPROACH RAMP FORPALLET TRUCK USE.www.vestil.com Phone (800) 348-0868New
88PACKAGING EQUIPMENTNewNewSemi-Automatic Stretch Wrap MachinesMODELNUMBERTURNTABLEDIAMETERWRAPHEIGHTTURNTABLEHEIGHTUNIFORMCAPACITYNET WT.(LBS.)LIST PRICEEACHSWA-50 50" 78" 2 1 /16" 4,000 430 $3,917.00SWA-70 70" 78" 2 3 /16" 4,000 750 5,769.00SWA-5070LP-PMO POWERED MAST OPTION (50" & 70" DIA.) 400 $2,025.00SWA-50-R-4848 APPROACH RAMP 48"W x 48"L x 2"H 253 $467.00SWA-70-R-4848 APPROACH RAMP 48"W x 48"L x 2"H 268 484.00SWA-50-SCALE DIGITAL SCALE OPTION (50" DIAMETER) 680 $4,045.00SWA-70-SCALE DIGITAL SCALE OPTION (70" DIAMETER) 884 4,962.00SWA-50-R-4860-SCL APPROACH RAMP FOR SCALE OPTION 346 $674.00SWA-70-R-4860-SCL APPROACH RAMP FOR SCALE OPTION 353 688.00DC-20/FC-60Medium Duty High PerformanceSemi-Automatic Stretch Wrap Machine115V 1-PHASE STANDARDNew innovative design offers 50" and 70" carousel sizes. Carousel rotation is controlled by afoot switch on 8 foot cord. 115V power input with variable AC motor allows adjustable deckspeed of 3-12 rpm and includes soft-start / stop.Film-wrap tension is controlled with an adjustable, friction-brake assembly. Film placementis controlled manually by moving the carriage assembly up and down on the vertical mast.An easy-to-release, hand operated carriage-brake allows the carriage to move freely makingfilm application fast and simple.System will accept 10"-20" material. Ships with mast disconnected – simply raise mast andclamp into place. Some assembly required. The standard manual film wrap delivery can beupgraded to 115V 1-phase AC powered mast option (PMO). Optional Approach Rampallows the operator to load and unload the machine with a pallet truck.115V 1-PHASE STANDARDDVD or VIDEOAVAILABLEUser friendly control center provides workers efficient control of the wrapping process. Thestate of the art digital control circuit allows the operator to set the number of pallet rotationsand film wrapping patterns, with 4 standard multifunction wrapping patterns. The operatorsimply ties off the film wrap on the carousel and presses the start button.When the SWA-60-AW has completed the wrapping process, the operator can simply cut filmor use auto break feature and remove the wrapped pallet. The powered carousel has variablespeed, 0-13 rpm, with soft start and stop feature. Photocell sensors automatically adjust todifferent pallet heights. 20" high film wrap can be set to a 240% or 340% pre-stretch. Filmnot included. Ships knockdown. Some assembly required. 115V 1-phase power.MODELNUMBERTURNTABLEDIAMETERWRAP*HEIGHTTURNTABLEHEIGHTUNIFORMCAPACITYNET WT.(LBS.)LIST PRICEEACHSWA-60-AW 60" 88" 3 1 /8" 4,000 1652 $10,443.00SWA-82-AW 82" 96" 3 1 /8" 4,000 1892 13,488.00SWA-R-60-AW APPROACH RAMP (SWA-60-AW) 40"W x 60"L x 3"H 300 579.00SWA-R-82-AW APPROACH RAMP (SWA-82-AW) 40"W x 60"L x 3"H 310 598.00SWA-60-AW-SCL SCALE (FACTORY INSTALLED / ADDS 3" TO HEIGHT) 500 $4,737.00SWA-R-60-AW-SCL 48"W x 94"L x 6½"H APPROACH RAMP 450 862.00*BASED ON 20" HIGH ROLL OF MATERIALDC-20/FC-60New<strong>Material</strong> Pallet Stretch Wrap MachineGain the flexibility to apply stretch wrap film at any work station. This portable walkaround stretch wrapper has electronic touch sensitive controls to make packaging tasks easier.Powerful DC battery powered lift moves film wrap up and down as operator simply walksaround the packages. Designed to help you to wrap large and tall packages that could notbe wrapped on the standard carousel stretch wrappers. Features a easy reload film system.The upright is constructed of aluminum while the rest is steel construction with powder coatyellow finish. Includes (4) 3" swivel casters. Film is not included.MODELNUMBERUNIFORM ROLLCAPACITY (LBS)MAXIMUM*WRAP HEIGHTMINIMUM*WRAP HEIGHT24V DC STANDARDNET WT.(LBS.)LIST PRICEEACHPEL-100-A-SWA 95 86" 2" 202 $2,982.00*BASED ON 20" HIGH ROLL OF MATERIALDC-20/FC-92.5Phone (800) 348-0868www.vestil.com
89Low-Profile Powered CarouselThe Low-Profile Powered Carousel features a heavy-duty steel non-skid tread plate platform 48"in diameter. This unit handles loads up to 4,000 pounds. Model POW-CAR-LP features 300°ramp allowing access for pallet trucks, approach ramp is not necessary. Model POW-CAR iseasily accessible with a fork truck; optional approach ramp is required for pallet truck use. A footcontrol with a variable speed control (8 foot power cord), cushion start/stop, and rugged ¾ HPmotor with belt drive are standard. Units are pre-wired to work on 115V/single phase power.MODELNUMBERMODELNUMBER DIAMETER HEIGHTUNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHR.P.M.PT-100 12" 4½" 100 3-1/2 34 $474.00PT-250 18" 5½" 250 3 56 681.00PT-750 18" 6 3 /8" 750 2 66 859.00FOOT CONTROL, MODEL FC-2, $92.00 LISTOPTIONAL 1 OR 2 R.P.M., model PT-1/2RPM, $51.00 LIST (NOT available on PT-100)COUNTER-CLOCKWISE ROTATION, model PT-CCW, $43.00 LISTMODELNUMBERCAROUSELHEIGHTMODELNUMBER DESCRIPTION R.P.M. HEIGHTHEIGHTRANGEUNIFORMCAPACITYUNIFORM CAPACITY(POUNDS)NET WT.(POUNDS)NET WT.(POUNDS)NET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONR.P.M.POW-CAR-LP 115V AC POWER 1" 4,000 3-12 450 $4,099.00POW-CAR 115V AC POWER 2 3 /8" 4,000 3-12 569 3,360.00SWA-R-4836 PALLET TRUCK APPROACH RAMP 48"W x 36"L x 2¼" 175 $353.00SWA-R-4848 PALLET TRUCK APPROACH RAMP 48"W x 48"L x 2¼" 220 467.00DC-20/FC-60Stand Alone Powered CarouselEasily rotate pallets, skids, and other large objects with these rugged powered carousels. Eachunit includes a 48" diameter round tread plate turntable. Turntable is supported with invertedcasters for use as bearings. Units come with turntable, base, 115V 1 phase power unit, andvariable-speed control (electric/hydraulic unit has fixed speed control). Turntable is operated witha foot control. Uniform capacity is 4,000 lbs. Heavy-duty steel construction.LIST PRICEEACHSTPC-CD CHAIN DRIVEN 3-12 24" 788 $4,021.00STPC-EHD ELECTRIC HYDRAULIC DRIVEN 8 13½" 788 4,245.00Heavy-Duty King Pin CarouselMODELNUMBERSIZE(W x L) HEIGHTUNIFORMCAPACITY(LBS)NET WT.(POUNDS)DC-20/FC-60LIST PRICEEACHCA-KP-3636-4 36" x 36" 2 5 /8" 4,000 221 $1,033.00CA-KP-3636-6 36" x 36" 2¾" 6,000 263 1,127.00CA-KP-4848-4 48" x 48" 2 5 /8" 4,000 367 $1,349.00CA-KP-4848-6 48" x 48" 2¾" 6,000 442 1,408.00CA-KP-6060-4 60" x 60" 2 5 /8" 4,000 554 $1,579.00CA-KP-6060-6 60" x 60" 2¾" 6,000 654 1,682.00Powered Turntables115V 1-PHASE STANDARD115V 1-PHASE STANDARD115V 1-PHASE STD, OPTIONS ON PG. 43All the ergonomic benefits of the standard carousel with a top plate and stabilizing center pin.Unit will handle a wider variety of loads. Features include ¼" tread plate top on 4,000 lbs. and⅜" tread plate top on 6,000 lbs. models. Also includes a heavy-duty maintenance free bearing.The king pin design allows off set loading up to 50% of the capacity on at least 50% of the deck.Standard top plates are square with rounded corners. Contact factory for special sizes.Turntables with Powered Height AdjustmentDC-25/FC-60Keep tedious material handling at your fingertips. Easy, smooth, clockwise rotation for hundreds ofapplications. Rotation speed is non-adjustable. These Powered Turntables are wired to 115V, 1 phase.An on/off selector switch incorporated in a 3 foot cord provides power to the unit. A side skirt toprotect items from getting into the rotating mechanism is standard. Rotation is clockwise.DC-25/UPS/FC-60115V 1-PHASE STD, OPTIONS ON PG. 43These turntables with powered height adjustment allow the operator to raise or lower turntable toan ergonomic height. Each unit has a 360° manual turntable. AC power, 115V, 1 Phase with handcontrol for height adjustment. Height is adjusted with an electric linear-actuatorLIST PRICEEACHDIAMETERTT-18-LA 18" 27" TO 42¾" 750 232 $1,499.00TT-24-LA 24" 27" TO 42¾" 750 267 1,595.00TT-30-LA 30" 27" TO 42¾" 750 295 1,625.00DC-25/FC-60model POW-CARmodel POW-CAR-LPCENTER KING PINLOW PROFILE DESIGNDOES NOT REQUIREAPPROACH RAMP FORPALLET TRUCK USE.model STPC-CDDVD or VIDEOAVAILABLEwww.vestil.com Phone (800) 348-0868PACKAGING EQUIPMENT
90PACKAGING EQUIPMENTA) TT-7/8 B) TT-4C) TT-PED D) TT-DPEDE) TT-CPED F) TT-CDPEDHeavy-Duty Manual TurntablesMaximize workspace and minimize wasteful motion. Bench top turntables allow workers to stayin one position and rotate items for access from all sides. No need to walk around the table toaccess areas out of view. Easy and smooth bearing rotation. Used in hundreds of applications;displays, paint spraying, assembly units, repairs, etc. Rugged ½" steel plate construction. Easy,smooth rotation won't jostle delicate parts. The double tier units, suffix DPED and CDPED,feature a stationary shelf for storing parts and tools. Series PED and DPED feature a turn knobheight adjustment operation while the CPED and CDPED feature a gas cylinder up and downmechanism (similar design as office chairs).MODELNUMBERHEIGHTRANGEUNIFORMCAPACITY (LBS)NET WT.(POUNDS)LIST PRICEEACHTYPEDIAMETERA TT-8-7/8 8" 7/8" 500 4 $65.00B TT-8-4 8" 4" 500 6 80.00A TT-12-7/8 12" 7/8" 500 11 $92.00B TT-12-4 12" 4" 500 13 106.00A TT-18-7/8 18" 7/8" 1,000 35 $185.00B TT-18-4 18" 4" 500 67 200.00C TT-18-PED 18" 21" TO 32" 300 60 206.00D TT-18-DPED 18" 25" TO 36" 300 95 250.00E TT-18-CPED 18" 20" TO 30" 300 50 246.00F TT-18-CDPED 18" 24" TO 34" 300 85 357.00A TT-24-7/8 24" 7/8" 1,000 75 $276.00B TT-24-4 24" 4" 500 90 295.00C TT-24-PED 24" 21" TO 32" 300 95 301.00D TT-24-DPED 24" 25" TO 36" 300 170 350.00E TT-24-CPED 24" 20" TO 30" 300 105 338.00F TT-24-CDPED 24" 24" TO 34" 300 165 398.00A TT-30-7/8 30" 7/8" 1,000 138 $316.00B TT-30-4 30" 4" 500 150 386.00G TT-30-PED 30" 21" TO 32" 300 160 428.00D TT-30-DPED 30" 25" TO 36" 300 280 587.00DC-25/UPS/FC-60G) TT-30-PEDThin Spins - pallet truck loadable carouselWhen confronted with minimum floor space and only a hand pallet truck, the Thin Spin lowprofilecarousel is ideal for loading and unloading pallet applications. The Thin Spin is pallettruck loadable because of its sleek ⅞" overall height. The effective ramping length is 4⅜"; slope isa mere 11°. A detent lock restricts carousel rotation when not in use. Units require a starting forceof approximately 35 pounds and a maintaining force of 25 pounds. Stainless Steel Thin Spins areconstructed of type 304 stainless steel mill finish.MODELNUMBERUSABLEDIAMETEROVERALLDIAMETERUNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHHEIGHTLP-4000T 51" 60" 7/8" 4,000 268 $1,113.00LP-4000T-45 45" 54" 7/8" 4,000 281 1,056.00LP-4000T-39 39" 48" 7/8" 4,000 189 1,007.00STAINLESS STEELLP-4000T-SS 51" 60" 7/8" 4,000 268 $4,361.00LP-4000T-45-SS 45" 54" 7/8" 4,000 281 3,988.00LP-4000T-39-SS 39" 48" 7/8" 4,000 189 3,725.00DC-25/FC-60Pallet Cart & CarouselCart is used to transport products to where they are needed. Then, once at desired location, pull pin onthe casters will allow the cart to manually rotate 360° like a carousel for easy unloading and improvedefficiency. The cart features a 48" diameter round platform with a ¼" thick tread plate deck. Removablehandle allows for full deck access from any position. Includes four swivel casters with swivel locks.MODELNUMBERPLATFORMHEIGHTUNIFORMCAPACITYCASTERTYPENET WT.(LBS.)LIST PRICEEACHDIAMETERCC-48 48" 10" 2,000 8" x 2" PHENOLIC 336 $492.00DC-25/FC-70Phone (800) 348-0868www.vestil.com
91Manual CarouselsThe Carousel rotates materials 360° with the assistance of an operator. Now loading and unloadingoperations can be done more efficiently; minimizes fatigue and risk of back injury. The carousel maybe added to an existing work bench, scissor table, or simply placed on the floor. Constructed fromtwo pieces of rolled structural angle (3/16" thick). A series of sealed ball bearings transfer the loadsmoothly and evenly to the supporting surface. Four guide rollers keep the rings aligned.MANUAL CAROUSELSMODELOUTERNUMBER DIAMETERUNIFORMCAPACITYOVERALLHEIGHTSHIPSVIANET WT.(POUNDS)LIST PRICEEACHCA-18-2 18" 2,000 2" UPS 20 $284.00CA-24-2 24" 2,000 2" UPS 26 $311.00CA-24-4 24" 4,000 2" UPS 30 355.00CA-30-2 30" 2,000 2" UPS 36 $351.00CA-30-4 30" 4,000 2" UPS 40 386.00CA-36-2 36" 2,000 2" UPS 43 $358.00CA-36-4 36" 4,000 2" UPS 47 404.00CA-40-2 40" 2,000 2" UPS 48 $368.00CA-40-4 40" 4,000 2" UPS 53 410.00CA-40-6 40" 6,000 2" UPS 58 463.00CA-48-2 48" 2,000 2" TRUCK 58 $517.00CA-48-4 48" 4,000 2" TRUCK 64 557.00CA-48-6 48" 6,000 2" TRUCK 69 610.00CA-60-2 60" 2,000 2" TRUCK 73 $561.00CA-60-4 60" 4,000 2" TRUCK 79 612.00CA-60-6 60" 6,000 2" TRUCK 81 678.00CA-72-2 72" 2,000 2" TRUCK 86 $688.00CA-72-4 72" 4,000 2" TRUCK 92 737.00CA-72-6 72" 6,000 2" TRUCK 99 802.00STEEL TREAD PLATE TOP PLATES FOR CAROUSEL (Smooth plate available, contact factory)MODELNUMBERSTYLEOVERALLSIZE THICKNESSUSE WITHCAROUSEL DIA.NET WT.(POUNDS)LIST PRICEEACHCA-TP-18-R-TP ROUND 18" DIA. ¼" 18" 25 $70.00CA-TP-24-R-TP ROUND 24" DIA. ¼" 24" 45 125.00CA-TP-30-R-TP ROUND 30" DIA. ¼" 30" 70 194.00CA-TP-36-R-TP ROUND 36" DIA. ¼" 36" 101 279.00CA-TP-40-R-TP ROUND 40" DIA. ¼" 40" 125 345.00CA-TP-48-R-TP ROUND 48" DIA. ¼" 48" 180 495.00CA-TP-60-R-TP ROUND 60" DIA. ¼" 60" 282 775.00CA-TP-72-R-TP ROUND 72" DIA. ¼" 72" 405 1,115.00CA-TP-18-S-TP SQUARE 18"W x 18"L ¼" 18" 25 $63.00CA-TP-24-S-TP SQUARE 24W" x 24"L ¼" 24" 45 113.00CA-TP-30-S-TP SQUARE 30"W x 30"L ¼" 30" 70 176.00CA-TP-36-S-TP SQUARE 36"W x 36"L ¼" 36" 101 253.00CA-TP-40-S-TP SQUARE 40"W x 40"L ¼" 40" 125 313.00CA-TP-48-S-TP SQUARE 48"W x 48"L ¼" 48" 180 450.00CA-TP-60-S-TP SQUARE 60"W x 60"L ¼" 60" 282 704.00CA-TP-72-S-TP SQUARE 72"W x 72"L ¼" 72" 405 1,013.00DO NOT EXCEED THE DIAMETER OF CAROUSEL WHEN ORDERING TOP PLATESDC-25/UPS/FC-60CAROUSEL OPTIONSMODELNUMBERNET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONCA-BASE-12* ELEVATED BASE - 40"W x 40"L x 12"H (MAX UNIFORM CAPACITY 4,000 lbs.) 345 $497.00CA-BASE-24* ELEVATED BASE - 40"W x 40"L x 24"H (MAX UNIFORM CAPACITY 4,000 lbs.) 460 654.00CA-S-STEEL STAINLESS STEEL RINGS (40" DIAMETER ONLY) 54 $291.00CA-HBK MANUAL BRAKE (FIELD INSTALLED) 5 $94.00CA-HOD HAND OPERATED LOCKING DETENT (FACTORY INSTALLED) 10 132.00CA-FTK FOOT OPERATED LOCKING DETENT (FACTORY INSTALLED) 11 178.00*CONTACT FACTORY FOR ADDITIONAL SIZES & STAINLESS STEEL OPTIONSDC-25/UPS/FC-60Parts ScalesMODELNUMBER115V 1-PHASE STANDARDThese scales capture a stable weight reading in less than one second. Features a rugged aluminumhousing, stainless steel weighing pan, and a simple keyboard. Switches between pounds and kilograms.DESCRIPTIONPLATFORMSIZE (W x L)UNIFORMCAPACITYRESOLUTION(POUNDS)NET WT.(POUNDS)LIST PRICEEACHSSDSC-6* STAINLESS STEEL 7½" x 9" 6.6 0.002 9 $330.00SSDSC-13* STAINLESS STEEL 7½" x 9" 13 0.005 9 330.00SSDSC-66* STAINLESS STEEL 7½" x 9" 66 0.02 9 330.00PTDSC-66* PLASTIC 7½" x 9" 66 0.02 6 $297.00BDSC-26 WEIGHING SCALE 7½" x 7 7 /8" 26 0.004 6 $188.00CDSC-30 COUNTING SCALE 10" x 12" 30 0.001 9 $377.00*WATERPROOFDC-25/UPS/FC-70CAROUSEL IS SHOWN WITH RINGSSEPARATED TO ILLUSTRATE BEARINGSHAND OPERATEDLOCKING DETENTCAROUSEL BASESQUARETOP PLATEDVD or VIDEOAVAILABLEHAND OPERATED SPRING LOCKING DETENTLOCKS CAROUSEL EVERY 90°model CA-HODHAND OPERATED MANUAL BRAKELOCKS CAROUSEL IN ANY POSITION(cannot be used with square top plate)model CA-HBKFOOT OPERATED LOCKING DETENTLOCKS CAROUSEL EVERY 90°(cannot be used with square top plate)model CA-FTKSDSC-30www.vestil.com Phone (800) 348-0868NewSSDSCBDSC-26PTDSC-66Operates on 115V AC.Other capacities available, contact factory.PACKAGING EQUIPMENT
92PACKAGING EQUIPMENTNewNewmodelSCALE-S-44-5KElectronic Digital Floor ScaleLow-profile scale is only 3½" off the floor, allowing easy loading and unloading of heavy equipment.Rugged design has a tread plate top surface. The digital display stands 42" high. Optional ApproachRamp for pallet truck accessibility - order two for drive-on, drive-off convenience. Color may vary.MODELNUMBEROVERALL SIZE(W x L x H)UNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONSCALE-S-44-5K SCALE 48" x 48" x 3½" 5,000 225 $1,537.00SCALE-S-55-5K SCALE 60" x 60" x 3½" 5,000 340 1,662.00SCALE-S-44-10K SCALE 48" x 48" x 3½" 10,000 225 $1,637.00SCALE-S-55-10K SCALE 60" x 60" x 3½" 10,000 340 1,762.00LEGAL FOR TRADE (NTEP)SCALE-S-CFT-44-5K SCALE 48" x 48" x 3½" 5,000 225 $1,662.00SCALE-S-CFT-55-5K SCALE 60" x 60" x 3½" 5,000 340 1,812.00SCALE-S-CFT-44-10K SCALE 48" x 48" x 3½" 10,000 225 $1,762.00SCALE-S-CFT-55-10K SCALE 60" x 60" x 3½" 10,000 340 1,912.00SCALE OPTIONSSCALE-R-CS-44 RAMP 48" x 48" x 3½" 10,000 150 $504.00SCALE-R-CS-54 RAMP 60" x 48" x 3½" 10,000 190 $554.00SCALE-S-PRINTER DIGITAL PRINTER 15 $295.00SCALE-S-DC INTERNAL BATTERY PACK W/CHARGER 3 $120.00DC-25/FC-70"U" Shaped Platform ScaleDC POWER WITH 115V 1-PHASE CHARGERDC POWER WITH 115V 1-PHASE CHARGEROur VPC U-Shaped Platform scales are constructed of heavy duty steel to withstand the mostdemanding industrial environments. U-Frame scales are designed specially to handle pallets, and theyare easy to move and store. Ideal for moving around the work place where there is not enough roomfor fixed scale. U-Shapped scales are suitable for weighing in a warehouse, storehouse or general use.U-Frame scales are light weight and can be easily moved by one person with two wheels and a handle.The scales comes equipped with four heavy duty load cells and a deluxe stainless steel indicator head.NewMODELNUMBERUNIFORMCAPACITYINDEXINGACCURACY(POUNDS)SENSORCAPACITY(POUNDS)SENSORNUMBERRESOLUTIONSTEP(POUNDS)NET WT.(LBS.)LIST PRICEEACHHEIGHTVPU-1 1,000 1 1,000 4 9 4¾" 85 $925.00VPU-2 2,000 2 2,000 4 22 4¾" 85 935.00VPU-4 4,000 4.5 4,000 4 44 4¾" 85 945.00VPU-6 6,000 6.6 4,000 4 44 4¾" 85 945.00DC-25/FC-70Portable Floor ScalesDC POWER WITH 115V 1-PHASE CHARGERPortable Floor Scales are ideal for easy transportation and weighing of goods at multiple locations.Non-slip diamond plate surface. Fold down low gradual ramps are fixed to the platform. Rampsmake the scale ideal for wheeling pallet trucks, dollies, carts and containers on and off the platform.Four alloy steel load cells and deluxe stainless steel indictor head. Supplier flat pack for easy assembly.Indexing accuracy is 1.1 pounds.Phone (800) 348-0868NewSHOWN WITH TWO APPROACH RAMPSAPPROACH RAMPS SOLD EACHMODELNUMBERUNIFORMCAPACITYPLATFORMSIZE(W x L)OVERALL SIZEWITH SLOPES(W x L x H)SENSORCAPACITY(POUNDS)SENSORNUMBERNET WT.(LBS.)LIST PRICEEACHVPFS-3B 3,000 48" x 40" 60" x 78¾" x 2 3 /8" 4,000 4 450 $2,310.00VPFS-3C 3,000 60" x 60" 71" x 98½" x 2 3 /8" 4,000 4 620 2,676.00DC-25/FC-70Low Profile Floor ScalesLow Profile Floor Scales are ideal for shipping and receiving areas. Industrial grade heavy duty mildsteel platform scales ensure durability that will withstand years of daily use. Features an anti-sliprugged steel diamond plate surface with heavy duty welded channel support. Powder coat finish.Overload protection to 150% of capacity and adjustable leveling feet standard. Can be pit mounted orfree standing. 6 digit 7 segment display, bidirectional RS232 port, and operator controls for Zero, Tar,Unit, Net/Gross and Print. Converts to pounds or kilograms. Deluxe stainless steel indicator. 110VAC power supply.MODELNUMBERUNIFORMCAPACITYPLATFORM SIZE(W x L x H)115V 1-PHASE STANDARDINDEXING SENSORACCURACY (LBS.) CAPACITY (LBS.)NET WT.(LBS.)LIST PRICEEACHVLPFS-2 2,000 36" x 36" x 2¾" 0.50 2,000 170 $995.00VLPFS-4A 4,000 48" x 48" x 2¾" 1 4,000 325 1,098.00VLPFS-4B 4,000 60" x 60" x 2¾" 1 4,000 400 1,342.00VLPFS-R-3636 APPROACH RAMP 36"L x 36"W, 4.45° ANGLE 65 $272.00VLPFS-R-3648 APPROACH RAMP 36"L x 48"W, 4.45° ANGLE 80 462.00VLPFS-R-3660 APPROACH RAMP 36"L x 60"W, 4.45° ANGLE 90 555.00DC-25/FC-70www.vestil.com
93Hand Held Stretch WrappersThese hand held, lightweight, freewheeling dispensers maintain precision tension control assuringa tight, smooth application. The ergonomically bent, foam covered handle reduces both bendingand fatigue, while allowing operators to apply the bottom row of wrap just as tight as the top.Accommodates rolls up to 8" in diameter.The compact Stretch Wrap Knife is small enough to fit in your pocket. Specially angled cuttinghead easily slices through stretch wrap material without sticking or binding. Safety design will notcut user or products. Made of high-density plastic. Replacement blades available.MODELNUMBERDESCRIPTIONROLLHEIGHTSCORESIZENET WT.(POUNDS)LIST PRICEEACHSW-HAND-R ROUND STYLE 12" TO 20" 2" & 3" 6 $43.00SW-HAND-BG ERGO STYLE 12" TO 20" 1/2", 2" & 3" 6 39.00MODELNUMBERNET WT.(LBS.)LIST PRICEEACHDESCRIPTIONSW-KNIFE STRETCH WRAP FILM KNIFE 1 $4.00SW-RB REPLACEMENT BLADES (BOX OF 100 BLADES) 6 28.00SRF-18 FILM FOR HAND HELD WRAPPER 46 $98.0018" WIDE x 1,500 FEET (80 gauge) 4 ROLLS PER CASE per caseStretch Wrap DispenserDC-25/UPS/FC-55A) Easy to use fingertip units fit into core and allow for dispensing stretch wrap around yourproduct. Brake feature included for controlling film tension while dispensing. Sold in pairs.B) Hand held dispensing handles are made of plastic and allow for easy stretch wrap dispensingwith spin handle.C) Slip over extended core rolls of stretch wrap. Squeeze grip to control film tension whilewrapping. PVC construction allows for comfortable grip. Only sold in pairs.NewSW-HAND-RSW-KNIFESW-HAND-BGmodel SWD-1PACKAGING EQUIPMENTMODELNUMBERMODELNUMBERSTRAPPINGIT ACCEPTSMAXIMUMCOIL WIDTHMAXIMUMSTRAP WIDTHCOREDIAMETERUSABLECORE SIZENET WT.(POUNDS)NET WT.(POUNDS)LIST PRICEEACHITEMTAPE WIDTHA SWD-1 ANY 3" 1 $7.80B SWD-2/1.5 5" 1½" 1 $4.60B SWD-2/2 5" 2" 1 4.70B SWD-2/3 5" 3" 1 4.80C SWD-3 ANY 1½" 1 $9.60DC-25/UPSCuttersA) Works conveniently, safely and quickly on straps, cardboard and tape. Includes pocket clip.B) Designed to cut bubble wrap, foam, film, twine and similar materials. Hand formed grip forconvenience.C) Multi-function package opener quickly cuts strapping, film, rope, tape. The heavy-dutyretractable claw removes staples.D) Recycle boxes with this easy to use box sizer. Post has printed scale to expedite accuracy andconvenience to score the box so that it can be folded over neatly to change the depth.MODELNUMBERNET WT.(POUNDS)LIST PRICEEACHITEMDESCRIPTIONA CUT-D-1 DOUBLE ENDED CUTTER .05 $2.40B CUT-2 CUTTER FOR THICK MATERIAL .05 $2.10C MPO-3 MULTI-FUNCTION PACKAGE OPENER .25 $7.90D SIZER-4 BOX SIZER 1 $15.80DC-25/UPSPallet WandAllows for easy guidance of strapping through pallets. Decrease the time in takes to manuallystrap pallets. Flexible black fiberglass construction. Steel spring clip securely hold strapping.MODELNUMBEROVERALL SIZE(W x L )WANDTHICKNESSNET WT.(POUNDS)LIST PRICEEACHWAND-3 7/8" x 53" 1/8" 1 $39.00DC-25/UPSPoly Strapping DispenserDesigned for dispensing rolls of poly strapping. Handy lightweight and easy to use design.Handle includes strap retainer for convenience. Storage bin for buckles and other tools. Steelconstruction with painted finish.LIST PRICEEACHSTRAP-P POLY 6¼" 1½" 3" DIAMETER 25 $128.00DC-25/UPS/FC-100model SWD-3STRAP-Pwww.vestil.com Phone (800) 348-0868CUT-2SIZER-4WAND-3NewNewNewCUT-D-1MPO-3series SWD-2
PACKAGING EQUIPMENT94Phone (800) 348-0868STRAP-SStrapping CartThis universal strapping cart is designed for use with both Poly and Steel strapping. Now you only needone cart for both types of strapping. Unique multi-tier discs allow for use with strapping core sizes of16" x 3", 16" x 6" and 8" x 8". Cart includes storage tray for holding clips, seals and tools. Heavy-dutywheels for portability. Steel construction with powder coat finish.MODELNUMBERMODELNUMBERMODELNUMBEROVERALL SIZE(W x D x H)OVERALLDIMENSIONSFEED STRAPHEIGHTSTRAPPINGWIDTHSTANDARDMATERIALPOWERSUPPLYSTRAPPINGIT ACCEPTSCASTERSIZENET WT.(LBS.)NET WT.(POUNDS)LIST PRICEEACHSTRAP-VH 27" x 27" x 42" 8" TO 28" 24" MAX. DIA. STEEL & POLY 183 $549.00DC-25/FC-100MODELNUMBERARMLENGTHMAXIMUMDIAMETERSTRAPPINGIT ACCEPTSNET WT.(POUNDS)LIST PRICEEACHSTRAP-P2 40" 24" POLYPROPYLENE 110 $511.00DC-25/FC-100MODELNUMBEROVERALL SIZE(W x D x H)STRAPPINGIT ACCEPTSFEED STRAPHEIGHTOVERALL SIZE(W x D x H)TENSION(POUNDS)NET WT.(POUNDS)NET WT.(POUNDS)LIST PRICEEACHSTRAP-PS-HD STEEL & POLY 25" x 20¼" x 40¼" 70 $218.00DC-25/FC-100Vertical/Horizontal Strapping CartThis unique cart allows the operator to apply strapping both vertically and horizontally around the load.For use with both steel and poly strapping. For use with 16" diameter core x 3" strapping material. Touse, simply engage outer detents (disengaging inner) and turn the removable handle until strap is in thehorizontal position. Once in the horizontal position, disengage the outer detents and engage the innerdetents. The strap can now be raised and lowered from 28" down to 8" with the same turn handle. Eachunit comes standard with 10" x 2½" semi-pneumatic wheels. The equipment tray measures 13½"W x4½"L x 5"D. Strapping is not included.Manual Pallet Probe Strapping Cart• Increase Productivity • Economical, Fast, Easy • Low MaintenanceThe Manual Pallet Probe is a quick and simple answer to a long time dilemma - getting poly strappingthrough your pallet. To use, simply transport cart to your loaded pallet, extend arm, and run strappingto end clip. After strapping is secure, roll cart probe into pallet along center stringer. The strapping armwill then protrude out the other end allowing the operator to pull the strapping up and over pallet. Unitaccepts polypropylene strapping. Tray size is 19"W x 5¾"D. The maximum core width is 5", while theminimum core width is 2½". Overall material diameter is 16" with a minimum of 13¾". Strapping isnot included.Semi-Automatic Pallet Probe Strapping Machine• User Friendly• Tension up to 175 lbs.LIST PRICEEACHDBA-130 22" x 71" x 59" 53½" 175 350 $3,715.00DC-20/FC-100Semi-Automatic Strapping Machine• Minimize Packaging Time• User Friendly Controls• Portable for Convenience• 40" Foldable Pallet Probe• Uses 3/8", 1/2" and 5/8" Poly Strapping115V 1-PHASE STANDARD• Secure Contents Effectively• Stainless Steel Strapping Surface• Easy Access for Reloading Strapping115V 1-PHASE STANDARDEliminate hand strapping and speed up the process of pallet strapping with this Semi-Automatic PalletStrapper. Unit automatically feeds the desired polypropylene strap through the pallet, tightens, and sealsthe strap around the pallet. 115V power supply.Operation: (a) Unfold pallet probe, (b) Push pallet probe into pallet, (c) Feed polypropylene strap,(d) Insert tip of strap into strapway, (e) Adjust tension, pulling automatically into heat seal, (f) Strip isthen cut off to feed the strap out, (g) One-cycle automatically complete, (h) Remove machine and insertinto next pallet. Strapping is not included.DVD or VIDEOAVAILABLEThis fully portable strapping machine dispenses, tightens, and seals economical polypropylene strappingaround packages or bundles greater than 3". Unit automatically tensions strap and joins the ends witha secure heat weld. The motor automatically switches off when not in use. As the strap is inserted, themotor automatically restarts. Wall plug is standard 115V single phase 15 amp.LIST PRICEEACHS-2001 22½"W x 35"L x 29"H ½" 115V 3" x 1¼" 300 $1,012.00DC-20/FC-100www.vestil.com
95High Speed Strapping Machine• Dispenses 3/8" or 1/2" polypropylene strapping• Heat welded polypropylene strapping• Strap tension is adjustable 15 lbs. to 150 lbs.• Strapping core size is 6" to 9"MODELNUMBERMAXIMUM PACKAGESIZE (W x H)TABLE TOPHEIGHTOVERALL SIZE(W x D x H)NET WT.(POUNDS)LIST PRICEEACHASM-3123 31½" x 23½" 31½" 49" x 23" x 58" 425 $5,580.00DC-20/FC-100Propane Powered Shrink Wrap Heat Gun115V 1-PHASE STANDARD• Automatic strapping operation• Up to 30 cycles per minute• User friendly controls• Easy access for reloading strappingThe High Speed Strapping Machine is a productive solution to most polypropylene strapping tasks.This automatic Arch Strapping Machine features the "Auto-Feeding" function that automaticallyfeeds polypropylene strapping to arch and is ready for each application. The "Auto-Positioning"system automatically positions a secures the polypropylene strapping efficiently for each cycle. The"Jam-Free" feature ejects missed strap cycles, and resets the unit.User friendly controls allow operator to chose between panel mounted controls, foot pedal, or tabletop ball switch. Cycle rate: Up to 30 straps per minute. Actual production will vary dependingon package size, chute size and operator dexterity. Portable for convenience. 115V, 1phase powerrequired. Polypropylene strapping is sold separately.Lightweight and easy to use. Features adjustable regulator so power is controllable to suit all types offilm. The 26 ft. hose comes with a swivel connector so it does not become twisted. A two positionstainless steel nozzle rotates from vertical to horizontal and remains cool so there is no risk of burns.Comes in its own storage case. Propane container not included. Shrink wrap film not included.NewPACKAGING EQUIPMENTMODELNUMBER DESCRIPTION TEMPERATURE SETTINGMODELNUMBERTEMPERATURESETTINGNET WT.(POUNDS)NET WT.(POUNDS)LIST PRICEEACHSH-GUN-P PROPANE HEAT GUN 125,000 BTU/HOUR 12 $1,125.00DC-25/UPSElectric Shrink Wrap Heat GunThis lightweight easy to use Shrink Wrap Heat Gun is great for packaging small items. Idealfor use in shipping areas, parts departments, and printing plants. 115V, single phase standardwith a 5 foot cord and plug. Shrink wrap film not included.LIST PRICEEACHDESCRIPTIONVOLTAGESH-GUN-E ELECTRIC HEAT GUN 700° & 900° 115V 4 $34.00DC-25/FC-UPSPoly and Steel Strapping Tools115V 1-PHASE STANDARDHere are all the tools and supplies you need to cut and seal strapping. Cutter cuts up to ⅝" wide strapping. Tensioner features ratchet action thatapplies maximum tension instantly, pulling and cutting ¾" strapping with little effort.model PKG-ST model PKG-SS-SM model PKG-SS-LG model PKG-C-1model PKG-C-125model PKG-C-2model PKG-PTCmodel PKG-PSMODELNUMBERDESCRIPTIONSTRAPPING ITACCOMMODATESSTRAPPINGWIDTHNET WT.(LBS.)LIST PRICEEACHPKG-ST TENSIONER STEEL 3/8" to ¾" 5 $96.00PKG-SS-SM SEALER STEEL 3/8" & ½" 5 48.00PKG-SS-LG SEALER STEEL 5/8" & ¾" 5 50.00PKG-C-1 CUTTER STEEL 3/8" to 1" 2 35.00PKG-C-125 CUTTER STEEL 3/8" to 1¼" 2 39.00PKG-C-2 CUTTER STEEL 3/8" to 2" 3 55.00PKG-PTC TENSIONER & CUTTER POLY 3/8" to ¾" 3 $66.00PKG-PS SEALER POLY 5/8" 3 37.00PKG-PS-12 SEALER POLY ½" 3 44.00DC-25/UPSwww.vestil.com Phone (800) 348-0868
PACKAGING EQUIPMENT96WORKS WITHSTRAP-VH, STRAP-P2 & STRAP-PS-HDWORKS WITHDBA-130 & S-2001NewWORKS WITHSTRAP-VH & STRAP-P2Phone (800) 348-0868NewHeavy-Duty Poly Strapping & SealsPolypropylene strapping is the most commonly used strapping material. It is lightweight andeasy to handle. Polypropylene strapping is an excellent choice for light duty palletizing, cartonclosing, and bundling. Tensil strength is 300 pounds. It can be used with the following strappingmachines; STRAP-VH, STRAP-P2, STRAP-PS-HD.MODELNUMBER DESCRIPTION QUANTITYMODELNUMBER DESCRIPTION QUANTITYMODELNUMBERMODELNUMBERCOLORSTRAPPINGWIDTHFEETPER ROLLSEALINGWIDTH VOLTAGE WATTSNET WT.(POUNDS)LIST PRICEEACHISEAL-TT 12" 115 510 10 $78.00DC-25/FC-UPSMODELNUMBERDESCRIPTIONNET WT.(POUNDS)LIST PRICEEACHSTAPLE-58 MANUAL STAPLER FOR 5/8" STAPLES 5 $129.00STAPLE-34 MANUAL STAPLER FOR 3/4" STAPLES 5 129.00STAPLE-BX-58 5/8" STAPLES / 2,000 PIECES PER BOX 5 $8.75STAPLE-BX-34 ¾" STAPLES / 2,000 PIECES PER BOX 5 9.75DC-25/FC-UPSCORESIZETENSILESTRENGTHNET WT.(POUNDS)NET WT.(POUNDS)NET WT.(LBS.)LIST PRICEEACHST-12-8X8-BL 1/2" STRAPPING (8" x 8" CORE) 9,000 FEET 8 $92.00ST-12-16X3-BL 1/2" STRAPPING (16" x 3" CORE) 4,500 FEET 12 38.00ST-12-16X6-BL 1/2" STRAPPING (16" x 6" CORE) 9,000 FEET 23 61.00PSEAL-12 1/2" SEALS FOR POLY STRAPPING 1000 PCS. 12 $37.00DC-25/UPS/FC-65High Strength Steel StrappingProvides strong reinforcement for those demanding jobs. Ideal for general packaging, bundling,and palletizing. Black in color. Works with model STRAP-VH and STRAP-P2.LIST PRICEEACHSS-12-HS 1/2" STRAPPING 2,540 FEET 107 $205.00SS-58-HS 5/8" STRAPPING 2,340 FEET 107 207.00SS-34-HS 3/4" STRAPPING 1,940 FEET 107 205.00SSEAL-12 1/2" SEALS FOR STEEL STRAPPING 1000 PCS. 14 $33.00SSEAL-58 5/8" SEALS FOR STEEL STRAPPING 1000 PCS. 22 37.00SSEAL-34 3/4" SEALS FOR STEEL STRAPPING 1000 PCS. 25 41.00DC-25/UPS/FC-50Polypropylene StrappingThe Polypropylene Strapping has a smooth uniform texture that resists splitting. The core size is9" x 8". Absorbs shock loading. Works only with model DBA-130 and model S-2001.LIST PRICEEACHST-38-9X8-YL YELLOW 3/8" 12,900 9" x 8" 242 lbs. 39 $86.00ST-38-9X8-WH WHITE 3/8" 12,900 9" x 8" 242 lbs. 39 86.00ST-38-9X8-NA CLEAR 3/8" 12,900 9" x 8" 242 lbs. 39 86.00ST-12-9X8-YL YELLOW ½" 9,900 9" x 8" 308 lbs. 36 $89.00ST-12-9X8-WH WHITE ½" 9,900 9" x 8" 308 lbs. 36 89.00ST-12-9X8-NA CLEAR ½" 9,900 9" x 8" 308 lbs. 36 89.00DC-25/UPS/FC-65Pneumatic Strap SealerThis tool is a pressure type sealer which tightens, and seals economical polypropylene strappingaround packages or bundles. The overlapped polyester band is welded by heat pressure inapproximately 2 to 5 seconds. Uses a ¾" to 1" wide strap with thickness of .02" to .04". Requiresan air-filter-regulator, a minimum hose inside diameter of 1/4" and air pressure of 72 to 100 PSI.MODELNUMBEROVERALL SIZE(W x L x H)REQUIREDAIR PRESSURENET WT.(POUNDS)LIST PRICEEACHPN-ST-1 5.89" x 10.96" x 6.81" 72-100 PSI 8 $1,599.00DC-25/UPSImpulse Bag SealerThis lightweight table top Impulse Bag Sealer is ideal for packaging bulk mail, literature, catalogsor small parts. Easy to operate. A heat weld closes each bag tight. 115V, single phase with cordand plug. Poly bags are not included.Carton & Box Stapler115V 1-PHASE STANDARDManually operated stapler to close/seal cardboard boxes. Lightweight and easy to operate. Twoadjustable functions for adjusting staple clamping force and depth. Stapler will hold to 100staples. Staple width is 1⅜". Staples sold separately.www.vestil.com
AEdge GuardsRubber for Cargo Straps - These ¼" thick strap guards stay in place even if cargo shifts.Steel for Chain and Cargo Straps - Great for sharp and rugged edges.Used on crates to increase sturdiness.Plastic for Carton Straps and Cargo Straps - These carton straps prevent plastic strappingfrom "cutting" into cardboard cartons. The cargo strap guard is an economical way toprotect cargo and strap damage.MODELNUMBERSIZE(W x L)PIECES PERPACKAGENET WEIGHT(PER PKG. LBS.)LIST PRICEPER PKG.TYPECONSTRUCTIONA EDGE-R12 RUBBER 5¾" x 12" 50 46 $84.60B EDGE-R6 RUBBER 5" x 6" 100 31 102.00C EDGE-S7 STEEL 7½" x 4" 10 15 $61.60D EDGE-S6 STEEL 6" x 4" 10 12 33.60E EDGE-P2 PLASTIC 2½" x 1¾" 1,000 30 $137.30F EDGE-P5 PLASTIC 5½" x 4" 100 16 52.30F EDGE-N1 NYLON 5½" x 4" 100 20 86.10G EDGE-P1 PLASTIC 1 3 /8" x 1¼ 1,000 10 85.00DC-25/UPS/FC-70Cargo ProtectorsDesigned to protect product corners/edges from strapping damage. Angle board configurationis 3" x 3" x 0.225" thickness. Works well with steel or plastic strap. Helps stabilizes loads andis for use with stretch wrap. Corner protector folds and helps protect product corners. Cornerprotector measures 1½" x 1½" x 3"L.BCDFEGE D FCEP-3-WNew97PACKAGING EQUIPMENTMODELNUMBER TYPE LENGTHPIECES PERPACKAGENET WEIGHT(PER PKG. LBS.)LIST PRICEPER PKG.CEP-3-W EDGE 3" 200 22 $18.00CEP-24-W EDGE 24" 50 48 30.00CEP-36-W EDGE 36" 50 69 45.00CEP-48-W EDGE 48" 50 94 60.00CEP-C-W CORNER 2" 300 20 $43.00DC-25/UPSFC-70CEP-24-WCEP-C-WNewPallet Bands - jumbo rubber bandsMinimize carton shifting to reduce product damage in transit. Easy to use without any need forspecial equipment. Cost effective and environmentally friendly. Moisture will not get trappedunder rubber band. Packaged 50 pieces per carton.MODELNUMBER ACCOMMODATES WIDTHNET WEIGHT(PER PKG. LBS.)LIST PRICEPER PKG.BAND-92 Pallets 40" x 48" min. to 48" x 48" max. 3/4" 12 $188.00BAND-34 55 gallon drums to secure drum liners 1/2" 10 61.00DC-25/UPSHook & LoopThese black straps are quick and easy to fasten and unfasten. Reusable for a variety of applications.ABAND-92BAND-34MODELNUMBERLOOPSTYLESIZE(W x L)PIECES PERPACKAGENET WEIGHT(PER PKG LBS.)LIST PRICEPER PKG.TYPEA STRAPA-16 STEEL 1¼" x 16" 25 1 $92.00B STRAPB-8 PLASTIC 1" x 8" 100 2 82.00C STRAPC-8 NONE ¾" x 8" 150 2 68.00D STRAPD-8 INTEGRAL ½" x 8" 200 1 59.00DC-25/UPSShop Ticket HoldersKeep shop work orders, picking tickets and similar documents clean and readable. Each ticketholder is sized for use with standard paper of 8½" x 11". Taped and stitched heavy weight vinylprovides protection and durability. Packaged and sold in carton quantities only.BCDNewNewMODELNUMBER STYLE LOADINGQTY. PERPACKAGENET WT.(LBS.)LIST PRICEPER PACKAGESHOPT-N NEON TOP 25 16 $89.00SHOPT-M MAGNETIC TOP 15 28 $108.00SHOPT-Z ZIP SEAL TOP 15 16 74.00SHOPT-P STANDARD TOP 50 24 70.00SHOPT-T HANGING EYELET TOP 25 14 $52.00SHOPT-S HANGING EYELET SIDE 25 14 46.00SHOPT-HS HANGING STRAP TOP 15 14 63.00DC-25/UPSwww.vestil.com Phone (800) 348-0868NEONMAGNETICZIP SEALSTANDARDHANGING EYELETHANGING STRAP
PACKAGING EQUIPMENT98NewNewFOLDEDWANDWANDNewmodelMPPB-4794ships unassembledPolypropylene Woven Parts BagsChoose woven polypropylene bags for the toughest packaging applications. Each bag has a tiestring. Manufactured from high puncture, tear and water resistant 2 mil polypropylene. Bagsare reusable, economical, durable, flexible, and sturdy.MODELNUMBERMODELNUMBERMAXIMUM ROLLDIAMETERSIZE(W x L) COLORMAXIMUM ROLLWIDTH (MT'L WIDTH)QUANTITYPER PACKAGEMAXIMUM STRAPPINGDIAMETERPACKAGENET WT. (LBS.)NET WT.(LBS.)LIST PRICEPER PACKAGEPWB-68-B 6" x 8" BLUE 200 10 $39.00PWB-812-B 8" x 12" BLUE 200 20 47.00PWB-SAND-B 14" x 26" BLUE 200 35 83.00PWB-68-Y 6" x 8" YELLOW 200 10 $39.00PWB-812-Y 8" x 12" YELLOW 200 20 47.00PWB-SAND-Y 14" x 26" YELLOW 200 35 83.00PWB-68-W 6" x 8" WHITE 200 10 $39.00PWB-812-W 8" x 12" WHITE 200 20 47.00PWB-SAND-W 14" x 26" WHITE 200 35 83.00DC-25/UPSBlue Silica Gel - absorb shipping container moistureBlue silica gel in clear packets. Unique color changing characteristics. Color is blue when dry.Color turns red when saturated. Ships in sealed cartons.MODELNUMBERINDIVIDUAL PACKETSIZE (W x L)INDIVIDUALPACKET WEIGHTPACKAGESPER CARTONNET WEIGHT(PER PKG. LBS.)LIST PRICEPER PKG.BSG-2G 1.18" x 1.77" 2 grams 3000 18 $78.00BSG-5G 1.85" x 2.56" 5 grams 1250 18 81.00BSG-10G 1.85" x 2.75" 10 grams 600 18 83.00DC-25/UPSMulti-Task Packaging CartMinimize packaging time and costs by having wrapping and strapping components organizedand readily available. Cart has dispensing ability for one steel and one poly strapping roll. Eachstrapping compartment includes a tensioner for controlled strap dispensing. Compartmentdoors also serve as ramps to easily roll strapping up into cart. Steel strapping compartment is 3¼"wide. Poly strapping compartment is 6¼" wide. Detachable pallet wand is included for use withpoly strapping (max. ⅝" wide). Wand folds so it can be stored vertically in cart. The top of cartincludes tray for storage for miscellaneous tools. Cart is portable with (2) rigid and (2) swivel 4"x 1¼" poly-on-poly wheels and push handle. Steel construction with powder coat finish.LIST PRICEEACHPKG-CART 11" 26" 22" 250 $590.00ADDITIONAL PALLET WAND, MODEL PKG-WAND, $44.00 LISTDC-25/FC-70Multi-Purpose Packaging BenchMulti-purpose work bench is great for all your packaging needs! Wooden surface is durableand soft so it will not damage your products. Includes elevated tower for holding two rolls ofpackaging paper or bubble wrap. Maximum roll width is 44". Maximum roll diameter is 20".Height of the three roll axles are 59", 47" and 16". Extra roll of material may be stored undertable. Lower storage shelf for holding boxes, tape, tools and other items. Steel construction.Phone (800) 348-0868NewMODELNUMBERTOP TABLE(W x L x H)BOTTOM TABLE(W x L x H)OVERALLHEIGHTNET WT.(POUNDS)LIST PRICEEACHMPPB-4794 48" x 72" x 34" 24" x 48" x 16½" 60" 211 $380.00DC-25/FC-70Paper Dispenser StandsDesigned to conveniently hold rolls of paper and allows for easy horizontal dispensing. Choosefrom either double-tier or triple-tier design. Holds rolls of paper up to 9" in diameter. Steelconstruction with painted finish. Ships knock-down in cardboard box.MODELNUMBERROLLWIDTHOVERALL SIZE(W x H)NET WEIGHT(POUNDS)LIST PRICEEACHTIERSPDS-2-24 24" 2 29" x 30" 20 $126.00PDS-2-30 30" 2 35" x 30" 22 135.00PDS-2-36 36" 2 41" x 30" 25 142.00PDS-2-48 48" 2 53" x 30" 31 194.00PDS-3-24 24" 3 29" x 44" 27 $167.00PDS-3-30 30" 3 35" x 44" 31 178.00PDS-3-36 36" 3 41" x 44" 36 189.00PDS-3-48 48" 3 53" x 44" 42 289.00DC-25/UPS/FC-70www.vestil.com
99Portable Carton CartsPortable steel cart is designed to store, organize, and transport your empty cardboardboxes. Chrome plated uprights and frame dividers with powder coated black shelves. Shipsknockdown. Model CTC-1856-B features two adjustable-height shelves with adjustablebox dividers ideal for small boxes. Four swivel casters for easy maneuverability are standard.Model CTPT-1844-CK has adjustable box dividers ideal for oversized boxes and 5" x 1¼poly-on-poly casters.MODELNUMBEROVERALL SIZE(D x L x H)NUMBER OFDIVIDERSDISTANCEBETWEEN DIVIDERSUNIFORMCAPACITYNET WT.(LBS.)LIST PRICEEACHCTC-1856-B 18" x 56" x 50" 8 4" 400 100 $299.00CTPT-1844-CK 18" x 44" x 30" 5 17"W x 22"H 400 55 149.00DC-25/FC-100Nestable Presswood PalletsNestable presswood pallets are great for hundreds for applications. Special nestabledesign allows for stacking - 50 pallets only 86" high. Meets ISPM 15 exportspecifications. Rounded corners increase life expectancy. Lightweight design weighs 60%less than conventional wood pallets. Does not contain any nails or staples. Manufacturedfrom recycled wood materials. Environmentally responsible.NewmodelCTC-1856-BmodelCTPT-1844-CKPACKAGING EQUIPMENTMODELNUMBEROVERALL SIZE(W x D x H)UNIFORM SUPPORTED WEIGHT CAPACITYFLOOR FORK UNSUPPORTED(STATIC) (DYNAMIC) PALLET RACKNET WT.(LBS.)LIST PRICEEACHPWP-4242 42" x 42" x 5.6" 2,000 NOT RATED NOT RATED 40 $16.80PWP-4840 48" x 40" x 5.6" 2,000 NOT RATED NOT RATED 42 17.50DC-25/FC-100Steel Pallets with Galvanized FinishedHeavy-duty non-reversible welded steel pallets. Usable fork openings are 3.9" high.Model SPL-3636 has 4-way entry allowing for access for both fork and pallet trucks.Models SPL-4048, SPL-4248 and SPL-4848 have 2-way entry and allow access for forktrucks only. Galvanized finish is used for rust resistance.NewMODELNUMBEROVERALL SIZE(W x D x H)UNIFORM SUPPORTED WEIGHT CAPACITYFLOOR FORK UNSUPPORTED(STATIC) (DYNAMIC) PALLET RACKNET WT.(LBS.)LIST PRICEEACHSPL-3636 36" x 36" x 4¾" 8,000 4,000 2,200 43 $97.00SPL-4048 40" x 48" x 4¾" 8,000 4,000 2,200 66 129.00SPL-4248 42" x 48" x 4¾" 8,000 4,000 2,200 69 135.00SPL-4848 48" x 48" x 4¾" 8,000 4,000 2,200 80 154.00DC-25/FC-100model SPL-3636Solid Deck Steel PalletHeavy-duty non-reversible welded steel solid deck pallet. Ideal to transport and storeyour products within your facility and/or to transport them between different facilities.Usable fork pockets are 8½"W x 2½"H. Open end usable size is 35"W x 3¾"H.Galvanized finish for rush resistance.NewUNIFORM SUPPORTED WEIGHT CAPACITYMODELNUMBEROVERALL SIZE(W x D x H)FLOOR(STATIC)FORK(DYNAMIC)UNSUPPORTEDPALLET RACKNET WT.(LBS.)LIST PRICEEACHSDSP-4048 40" x 48" x 6" 4,000 3,500 2,500 63 $139.00Galvanized Welded Wire PalletsDC-25/FC-100Welded wire pallets will stand up to heavy-duty use. Design allows for stacking. Four-wayaccess with pallet truck and fork trucks. Open decking features 2" x 4" grid pattern. Usableheight on open end is 3". Usable eight on stringer end is 2¾". Understructure supportsare made from 12 gauge steel. Decking is made from welded steel wire. Welded steelconstruction with galvanized finish.UNIFORM SUPPORTED WEIGHT CAPACITYMODELNUMBEROVERALL SIZE(W x D x H)FLOOR(STATIC)FORK(DYNAMIC)UNSUPPORTEDPALLET RACKNET WT.(LBS.)LIST PRICEEACHWMP-4048 40" x 48" x 4" 4,000 2,500 NOT RATED 47 $76.00WMP-4848 48" x 48" x 4" 4,000 2,500 NOT RATED 54 84.00NR - NOT RATED FOR USEDC-25/FC-100www.vestil.com Phone (800) 348-0868New
PACKAGING EQUIPMENT100NewPALLET/SKIDmodel PLPS-4840vestilgreenNewvestilgreenNON-SKID GROMMETON PLPS-4840NewWASHDOWNmodel PLPS-WDvestilgreenAluminum PalletsThis is the pallet the food and chemical industries have always wanted. Easy to clean with apower washer. Stands up to high-power steam, brushes, or pads. Features a non-skid surfacefor easy transportation of all products. Top boards are 4¾" wide. Two-way entry for palletand fork truck use. Durable and re-usable. Heavy-duty welded aluminum construction.MODELNUMBERMODELNUMBEROVERALL SIZE(W x D x H)OVERALL SIZE(W x L x H)UNIFORM SUPPORTED WEIGHT CAPACITYFLOOR FORK UNSUPPORTED(STATIC) (DYNAMIC) PALLET RACKUNIFORMED SUPPORTED WEIGHT CAPACITYFLOOR FORK UNSUPPORTED(STATIC) (DYNAMIC) PALLET RACKNET WT.(LBS.)NET WT.(LBS.)LIST PRICEEACHAP-4048 40" x 48" x 6" 6,000 4,000 6,000 30 $269.00AP-4248 42" x 48" x 6" 6,000 4,000 6,000 40 278.00AP-4848 48" x 48" x 6" 6,000 4,000 6,000 50 298.00Plastic Pallet/SkidDC-25/FC-100This innovative design unites two essential product features; capacity and versatility. Pallet/Skid entry provides 4-way entry, 2-way by pallet truck and 4-way by a fork truck. The forkopening is 11¾"W x 3¼"H. The skid opening is 10½"W x 3¾"H. Features anti-slidegrommets which prevent the pallets from sliding off the forks and each other during transit.LIST PRICEEACHPLPS-4840 40" x 48" x 6" 8,800 2,200 1,760 44 $88.00SAME AS ABOVE EXCEPT RACKABLE & SOLID TOP (HYGENIC)PLPS-H 40" x 48" x 6" 8,800 3,300 3,300 52 $141.00SOLID TOP & BOTTOM (WASH-DOWN)PLPS-WD 40" x 48" x 6" 8,800 3,300 NOT RATED 40 $123.00Plastic Pallets and SkidsDC-25/FC-100Stackable for efficient storage. Made of high-density virgin polyethylene for longer life(except PLPS-4840). Pallets are maintenance free and safer to handle than wooden pallets.Feature four-way entry. Serrated deck with holes for drainage. Plastic pallets are ideal forexport, pharmaceutical, medical, and food applications. Model PLPS-4840-9L is a hygieniceasy to clean solid deck skid.series PLP2AVAILABLE IN GREEN, BLUE, YELLOW,ORANGE, BLACK AND REDSTANDARD DUTYmodel PLPG-4848HEAVY DUTYmodel PLPG-4848-HDFOR UNSUPPORTED RACKmodel PLPB-4840FOR UNSUPPORTED RACKmodel PLPR-4840SOLID TOPFOR UNSUPPORTED RACKmodel PLPR-4840-STUNIFORMED SUPPORTED WEIGHT CAPACITY (LBS.) FORKMODELNUMBEROVERALL SIZE(W x L x H)FLOOR(STATIC)FORK(DYNAMIC)UNSUPPORTEDPALLET RACKOPENINGS(W x H) COLORNET WT.(POUNDS)LIST PRICEEACHPLP2-4840-GREEN 48" x 40" x 6" 6,600 2,200 NOT RATED 9¾" x 4" GREEN 38 $94.00PLP2-4840-BLUE 48" x 40" x 6" 6,600 2,200 NOT RATED 9¾" x 4" BLUE 38 94.00PLP2-4840-YELLOW 48" x 40" x 6" 6,600 2,200 NOT RATED 9¾" x 4" YELLOW 38 94.00PLP2-4840-ORANGE 48" x 40" x 6" 6,600 2,200 NOT RATED 9¾" x 4" ORANGE 38 94.00PLP2-4840-BLACK 48" x 40" x 6" 6,600 2,200 NOT RATED 9¾" x 4" BLACK 38 94.00PLP2-4840-RED 48" x 40" x 6" 6,600 2,200 NOT RATED 9¾" x 4" RED 38 94.00PLPG-4848 48" x 48" x 6" 6,600 2,200 NOT RATED 12½" x 3½" GREY 65 $158.00PLPG-4848-HD * 48" x 48" x 6" 8,800 2,200 NOT RATED 12½" x 3½" GREY 72 164.00PLPB-4840 * 48" x 40" x 5½" 8,800 2,200 1,320 8½" x 3½" BLACK 38 120.00PLPR-4840 48" x 40" x 6" 4,400 3,960 2,200 8¾" x 3¼" GREY 55 $144.00PLPR-4840-ST9¾" x 4½"40" x 48" x 6½" 13,200 3,960 3,300(Rackable)11 3 /8" x 3"BLUE 50 $102.00PLPS-4840-9L13" x 3½"40" x 48" x 5½" 8,800 2,200 NOT RATED(Hygenic)12 1 /8" x 3½"BLUE 35 $97.00PLPS-4848 48" x 48" x 5" 4,400 1,650 NOT RATED 10¾" x 3½" GREY 32 $102.00SKID-20 48" x 40" x 5½" 3,300 660 NOT RATED 12" x 3¾" RED 22 43.00SKID-17 48" x 40" x 5¾" 2,200 660 NOT RATED 12½" x 4 1 /8" BLACK 17 31.00*NOT PALLET TRUCK USABLE (NOT SHOWN) / NR - NOT RATED FOR USEPhone (800) 348-0868SANITARY / EASY WASHmodel PLPS-4840-9L48" x 48"model PLPS-484840" x 48"model SKID-20model SKID-17DC-25/FC-200 (4 PIECES OR LESS) /FC-100www.vestil.com
101Adjustable Steel Gantry CranesADJUSTABLE HEIGHT STEEL GANTRY CRANESMODELNUMBERUNIFORMCAPACITYOVERALL BEAMLENGTH / HEIGHTFLANGEWIDTHUNDER I-BEAMUSABLE HEIGHTBASEWIDTHNET WT.(POUNDS)LIST PRICEEACHAHS-2-10-12 2,000 10' / 6" 3" 7'6" to 12' 77" 890 $1,794.00AHS-2-10-14 2,000 10' / 6" 3" 8'6" to 14' 89" 996 1,980.00AHS-2-10-16 2,000 10' / 6" 3" 10'6" to 16' 89" 1110 2,388.00AHS-2-15-7 2,000 15' / 6" 3" 5' to 7' 47" 808 $1,597.00AHS-2-15-9 2,000 15' / 6" 3" 6' to 9' 59" 884 1,658.00AHS-2-15-10 2,000 15' / 6" 3" 6'6" to 10' 65" 924 1,717.00AHS-2-15-12 2,000 15' / 6" 3" 7'6" to 12' 77" 978 1,973.00AHS-2-15-14 2,000 15' / 6" 3" 8'6" to 14' 89" 1084 2,109.00AHS-2-15-16 2,000 15' / 6" 3" 10'6" to 16' 89" 1199 2,516.00AHS-2-20-12 2,000 20' / 8" 6" 7'6" to 12' 77" 1066 $2,090.00AHS-2-20-14 2,000 20' / 8" 6" 8'6" to 14' 89" 1172 2,278.00AHS-2-20-16 2,000 20' / 8" 6" 10'6" to 16' 89" 2452 2,687.00AHS-4-10-12 4,000 10' / 8" 6" 7'6" to 12' 77" 967 $1,921.00AHS-4-10-14 4,000 10' / 8" 6" 8'6" to 14' 89" 1071 2,081.00AHS-4-10-16 4,000 10' / 8" 6" 10'6" to 16' 89" 1175 2,489.00AHS-4-15-7 4,000 15' / 8" 6" 5' to 7' 47" 853 $1,723.00AHS-4-15-9 4,000 15' / 8" 6" 6' to 9' 59" 930 1,789.00AHS-4-15-10 4,000 15' / 8" 6" 6'6" to 10' 65" 970 1,852.00AHS-4-15-12 4,000 15' / 8" 6" 7'6" to 12' 77" 1059 2,105.00AHS-4-15-14 4,000 15' / 8" 6" 8'6" to 14' 89" 1264 2,458.00AHS-4-15-16 4,000 15' / 8" 6" 10'6" to 16' 89" 1398 2,865.00AHS-4-20-12 4,000 20' / 10" 5" 7'6" to 12' 77" 1291 $2,602.00AHS-4-20-14 4,000 20' / 10" 5" 8'6" to 14' 89" 1395 2,773.00AHS-4-20-16 4,000 20' / 10" 5" 10'6" to 16' 89" 1501 3,181.00AHS-6-10-12 6,000 10' / 8" 6" 7'7" to 12'1" 78" 998 $1,983.00AHS-6-10-14 6,000 10' / 8" 6" 8'7" to 14'1" 90" 1101 2,142.00AHS-6-10-16 6,000 10' / 8" 6" 10'7" to 16'1" 90" 1208 2,622.00AHS-6-15-7 6,000 15' / 10" 5" 5'1" to 7'1" 48½" 1015 $1,926.00AHS-6-15-9 6,000 15' / 10" 5" 6'1" to 9'1" 60½" 1092 1,979.00AHS-6-15-10 6,000 15' / 10" 5" 6'7" to 10'1" 66½" 1132 2,048.00AHS-6-15-12 6,000 15' / 10" 5" 7'7" to 12'1" 78" 1195 2,322.00AHS-6-15-14 6,000 15' / 10" 5" 8'7" to 14'1" 90" 1298 2,525.00AHS-6-15-16 6,000 15' / 10" 5" 10'7" to 16'1" 90" 1406 3,004.00AHS-6-20-12 6,000 20' / 10" 5" 7'7" to 12'1" 78" 1322 $2,576.00AHS-6-20-14 6,000 20' / 10" 5" 8'7" to 14'1" 90" 1425 2,780.00AHS-6-20-16 6,000 20' / 10" 5" 10'7" to 16'1" 90" 1538 3,261.00AHS-8-10-12 8,000 10' / 10" 5" 7'7" to 12'1" 77" 1103 $2,194.00AHS-8-10-14 8,000 10' / 10" 5" 8'7" to 14'1" 90" 1206 2,345.00AHS-8-10-16 8,000 10' / 10" 5" 10'7" to 16'1" 90" 1319 2,880.00AHS-8-15-7 8,000 15' / 10" 5" 5' to 7' 46" 992 $2,136.00AHS-8-15-9 8,000 15' / 10" 5" 6' to 9' 58" 1084 2,195.00AHS-8-15-10 8,000 15' / 10" 5" 6'6" to 10' 64" 1132 2,268.00AHS-8-15-12 8,000 15' / 10" 5" 7'7" to 12'1" 77" 1230 2,412.00AHS-8-15-14 8,000 15' / 10" 5" 8'7" to 14'1" 90" 1333 2,614.00AHS-8-15-16 8,000 15' / 10" 5" 10'7" to 16'1" 90" 1456 3,149.00AHS-8-20-12 8,000 20' / 12" 6" 7'7" to 12'1" 77" 1485 $2,996.00AHS-8-20-14 8,000 20' / 12" 6" 8'7" to 14'1" 90" 1588 3,183.00AHS-8-20-16 8,000 20' / 12" 6" 10'7" to 16'1" 90" 1699 3,718.00AHS-10-15-10 10,000 15' / 12" 6" 6'6" to 10' 64½" 1541 $3,852.00USABLE DISTANCE BETWEEN UPRIGHTS IS OVERALL BEAM LENGTH MINUS 11"USABLE TROLLEY TRAVEL LENGTH IS OVERALL BEAM LENGTH MINUS 30"STEEL GANTRY CRANE OPTIONSMODELNUMBERDC-20/FC-70LIST PRICEEACHDESCRIPTIONAHS-2/4-TLC TOTAL LOCKING CASTERS (2,000 & 4,000 LBS. CAPACITY CRANES ONLY) (SET OF 4) $140.00AHS-6/8-TLC TOTAL LOCKING CASTERS (6,000 & 8,000 LBS. CAPACITY CRANES ONLY) (SET OF 4) 509.00AHS-2/4-V 8" x 2" V-GROOVE CASTERS FOR 2,000 & 4,000 LBS. UNITS (SET OF 4) $227.00AHS-6/8-V 8" x 3" V-GROOVE CASTERS FOR 6,000 & 8,000 LBS. UNITS (SET OF 4) 659.00AHS-KIT (2) COME-A-LONGS FOR HEIGHT ADJUSTMENT (NOT FOR LIFTING) $89.00www.vestil.com Phone (800) 348-0868NewIndustrial Steel Gantry Cranes are designed for transporting and positioning materials along the beams length.Solid steel construction will provide years of service. Large 8" diameter 4 position locking swivel casters with rollerbearings will facilitate easy mobility from one area to another. More economical and flexible than permanent cranes.Features quick setup design. Order optional Lever Ratchet for easy one person height adjustment. Height is adjustablein 6" increments. Do not move units while loaded. Blue finish. Hoist and trolley can be ordered separately.ADJUSTABLE HEIGHTGANTRY CRANE • series AHSNote: All products should beinspected frequently to insuresafe operation. Final testingand inspection is left to end userafter final assembly has beencompleted. For further detailssee ASME B30.17.Steel GantryCranes areadjustableleft and rightand up/down.4-POSITION 8" SWIVELCASTERS (standard)TOTAL LOCKING CASTERSmodel AHS-2/4-TLC(FOR 2,000 AND 4,000 LB.CAPACITY CRANES ONLY)model AHS-6/8-TLC(FOR 6,000 AND 8,000 LB.CAPACITY CRANES ONLY)V-GROOVE CASTERSmodel AHS-2/4-V(FOR 2,000 AND 4,000 LB.CAPACITY CRANES ONLY)model AHS-6/8-V(FOR 6,000 AND 8,000 LB.CAPACITY CRANES ONLY)GANTRY AND JIB CRANES
102GANTRY AND JIB CRANESNewPhone (800) 348-0868FIXED HEIGHT STEELGANTRY CRANEseries FHSFixed Steel Gantry CranesIndustrial Steel Gantry Cranes are designed for transporting and positioning materials along the beamslength. Solid steel construction will provide years of service. Choose from a variety of sizes. Large 8"diameter 4 position locking swivel casters with roller bearings will facilitate easy mobility from one areato another. More economical and flexible than permanent cranes. Features quick setup design. Do notmove units while loaded. Blue finish. Hoist and trolley can be ordered separately, see pages 105-108.MODELNUMBERMODELNUMBERUNIFORMCAPACITYOVERALL BEAMLENGTH / HEIGHTFLANGEWIDTHUNDER I-BEAMTO GROUNDBASEWIDTHNET WT.(POUNDS)LIST PRICEEACHFHS-50 500 8' / 4" 2.66" 5'9" 46½" 530 $941.00FHS-2-10 2,000 10' / 6" 3" 10' 64½" 655 $933.00FHS-2-15 2,000 15' / 6" 3" 10' 64½" 710 1,043.00FHS-2-20 2,000 20' / 8" 6" 10' 64½" 890 1,311.00FHS-4-10 4,000 10' / 8" 6" 10' 64½" 815 $1,088.00FHS-4-15 4,000 15' / 8" 6" 10' 64½" 903 1,241.00FHS-4-20 4,000 20' / 10" 5" 10' 64½" 1142 1,826.00FHS-6-10 6,000 10' / 8" 6" 10'1" 65 5 /8" 888 $1,279.00FHS-6-15 6,000 15' / 10" 5" 10'1" 65 5 /8" 1013 1,791.00FHS-6-20 6,000 20' / 10" 5" 10'1" 65 5 /8" 1209 2,077.00FHS-8-10 8,000 10' / 10" 5" 10' 76" 1102 $1,915.00FHS-8-15 8,000 15' / 10" 5" 10' 76" 1190 2,033.00FHS-8-20 8,000 20' / 12" 6" 10' 76" 1350 2,580.00FHS-10-10 10,000 10' / 10" 5" 10' 64½" 1310 $2,251.00FHS-10-15 10,000 15' / 12" 6" 10' 64½" 1480 2,889.00Steel Gantry Crane Power Traction Drive OptionsDC-20/FC-70LIST PRICEEACHDESCRIPTIONGPTD-2 2,000 TO 4,000 LBS. UNIFORM CAPACITY/STD. WITH 3 BUTTON HAND CONTROL $7,424.00GPTD-4 6,000 TO 8,000 LBS. UNIFORM CAPACITY/STD. WITH 3 BUTTON HAND CONTROL 8,844.00V-TRACK 10 FOOT SECTION OF V-GROOVE TRACK $123.00ADDITIONAL BUTTONS ON HAND CONTROL FOR HOIST & TROLLEY AVAILABLE, CONTACT FACTORYDC-20Festoon SystemDesigned to keep power cords out of danger when using electric trollies and/or hoists. Easily retrofitsto any gantry or jib crane up to 240" (20 ft.) in length. Includes 22 feet of wire rope. 115V AC cordsupplied. Works with both Steel and Aluminum Gantry Cranes.MODELNUMBERNET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONFES-KIT KEEPS POWER CORDS OUT OF DANGER 15 $122.00DC-20/FC-70Work Area Portable Steel Gantry CranesDesigned to maximize material handling requirements in light-duty lifting applications. Lightweightfixed height design allows for easy mobility. Includes (4) 5" x 2" poly-on-steel swivel casters with brake.The straddle width is 68". Overall I-beam length is 80" with a usable length of 70". Do not move unitswhile loaded. Steel construction with powder coat finish. Bolt together installation. Hoist and trolley soldseparately, see pages 105-108.MODELNUMBERUNDER I-BEAMTO GROUNDI-BEAM(FLANGE x HEIGHT)BASEWDITHUNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHFPG-3 90" 2.66" x 4" 48" 300 288 $700.00FPG-6 90" 2.66" x 4" 48" 600 300 725.00FPG-10 90" 2.66" x 4" 48" 1,000 329 956.00FPG-20 90" 2.66" x 4" 48" 2,000 340 1,219.00DC-20/FC-70Mini Overhead Cantilever JibsUtilize this unique jib in work cells and work areas. Unique fixed-height design allows for the 40" longoutriggers to be mounted underneath a work bench. Easily lift product from cart to workbench. Straddlewidth is 48" (ID). Hoist and trolley can be ordered separately, see pages 105-108. Steel construction.MODELNUMBERUNDER I-BEAMTO GROUNDOVERALLHEIGHTI-BEAM USABLELENGTHI-BEAM(FLANGE x HEIGHT)UNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHCJIB-3 84" 106¾" 54" 2.66" x 4" 300 248 $502.00CJIB-6 84" 106¾" 54" 2.66" x 4" 600 248 532.00CJIB-10 78½" 103¾" 54" 3.00" x 6" 1,000 440 674.00CJIB-20 78½" 103¾" 54" 3.00" x 6" 2,000 440 755.00DC-20/FC-70www.vestil.com
103Extra Travel Tri-Post JibsThis unique jib was designed for use in workstations. Place over the top of your workbench. Extra travelfixed-height I-beam overhangs workbench to allow lifting of products from cart to bench. Straddle widthis 39" (ID). Usable I-beam length is 80". Hoist and trolley can be ordered separately, see pages 105-108.Not compatible with the Eye Manual Trollies. Steel construction.MODELNUMBERUNDER I-BEAMTO GROUNDOVERALLHEIGHTOVERALLLENGTHI-BEAM(FLANGE x HEIGHT)UNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHTJIB-3 76½" 83" 85½" 2.66" x 4" 300 276 $514.00TJIB-6 76½" 83" 85½" 2.66" x 4" 600 286 543.00TJIB-10 76" 83" 85¾" 2.66" x 4" 1,000 315 678.00TJIB-20 76" 83½" 86" 2.66" x 4" 2,000 358 722.00DC-20/FC-70Floor Mounted JibsThis fixed height floor mounted jib adapts well to many applications. Full 360° rotation allowspersonnel to completely utilize their workstation. Solid steel construction will assist workers in liftingawkward material. The overall I-beam length is 80" with a usable length of 70". Requires reinforcedconcrete pad for installation. Hoist and trolley can be ordered separately, see pages 105-108.NewMODELNUMBERMODELNUMBERUNDER I-BEAMFLOORUNDER I-BEAM TOBOTTOM FRAMEI-BEAM(FLANGE x HEIGHT)I-BEAM(FLANGE x HEIGHT)OVERALLHEIGHTOVERALLHEIGHTUNIFORMCAPACITYUNIFORMCAPACITYNET WT.(POUNDS)NET WT.(POUNDS)LIST PRICEEACHJIB-FM-3 99¼" 2.660" x 4" 103¼" 300 405 $817.00JIB-FM-6 99¼" 3.000" x 6" 105¼" 600 443 994.00JIB-FM-10 99¼" 3.000" x 6" 105¼" 1,000 468 1,190.00JIB-FM-20 99¼" 6.000" x 8" 107¼" 2,000 609 1,288.00JIB-FM-40 99¼" 6.000" x 12" 111¼" 4,000 742 1,499.00DC-20/FC-70Wall Jibs (for low ceilings)Designed to assist workers in the maneuvering of materials as well as achieving maximum headroomwhere low ceilings are of concern. This cantilever style jib crane mounts to true vertical wall members.Increases personnel productivity by lifting awkward materials. The overall I-beam length is 88" witha usable length of 80". Overall length of jib is 96⅛". Unit rotates 180°. Hoist and trolley can beordered separately, see pages 105-108.LIST PRICEEACHJIB-LC-3 57" 2.660" x 4" 61" 300 170 $619.00JIB-LC-6 57" 3.000" x 6" 63" 600 230 637.00JIB-LC-10 57" 3.000" x 6" 63" 1,000 333 663.00JIB-LC-20 57" 6.000" x 8" 65" 2,000 378 776.00DC-20/FC-70Tie Rod Jibs (for high ceilings)Achieve maximum floor space and utilize wasted air space. Mount to walls or columns to increase hookcoverage over workstations. Unit rotates 180°. Usable I-beam length is 80". All steel construction providesyears of service. Hoist and trolley can be ordered separately, see pages 105-108.GANTRY AND JIB CRANESMODELNUMBEROVERALLLENGTHCABLE SUPPORTLENGTHOVERALLHEIGHTI-BEAM(FLANGE x HEIGHT)UNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHJIB-HC-3 86¼" 82¼" 45¼" 2.66" x 4" 300 144 $471.00JIB-HC-6 86¼" 82¼" 45¼" 2.66" x 4" 600 180 540.00JIB-HC-10 86¼" 82¼" 45¼" 2.66" x 4" 1,000 204 610.00JIB-HC-20 86¼" 76¾" 45¼" 2.66" x 4" 2,000 216 637.00DC-20/FC-70Pallet Truck HoistThe pallet truck hoist is an affordable and practical alternative for lifting and lowering loads to and fromelevated work stations. It provides workers with a mobile lifting jib that quickly secures to a standard 27"x 48" pallet truck. Fork pockets measure 7¾" x 2¾" ID. Once installed, the pallet truck can still be usedwith most pallets and skids allowing for transport of heavy pallet loads while retaining the ability to liftand lower loads to and from the pallet. It uses a clutchless cable winch with 80" of cable (88" with hookand shackle) for easy lifting and lowering. Steel construction with water-based enamel coat.NewMODEL OVERALL OVERALL BOOM HOOK FROM UNIFORM NET WT. LIST PRICENUMBER HEIGHT BASE WIDTH LENGTH UPRIGHT CAPACITY (POUNDS) EACHPJ-LIFT 76½" 30" 22¾" 19" 500 180 $496.00PALLET TRUCK NOT INCLUDEDDC-25/FC-70/92.5/175www.vestil.com Phone (800) 348-0868
GANTRY AND JIB CRANES1042,000 & 4,000 LB. UNITSSHIP KNOCK-DOWNADJUSTABLE HEIGHTADJUSTABLE SPANPNEUMATIC CASTERSmodel AHA-PNUPhone (800) 348-0868NewTOTAL LOCKING CASTERSmodel AHA-2/4-TLCNewNewNote: All products should beinspected frequently to insuresafe operation. Final testingand inspection is left to enduser after final assembly hasbeen completed. For furtherdetails see ASME B30.17.Adjustable Height Aluminum Gantry CranesThe Adjustable Height Aluminum Gantry Crane combines lightweight and rigid construction into oneunit. The all aluminum construction of this gantry crane makes it corrosion resistant and perfect for outdooruse. The lightweight I-beam allows height adjustment without the need of a hoist or fork truck. All pinnedconnections make it possible for two people to set up. Height is adjustable in 6" increments. Do not moveunits while loaded. Hoist and trolley can be ordered separately, , see pages 105-108.MODELNUMBERUNIFORMCAPACITYOVERALL BEAMLENGTH / HEIGHTFLANGEWIDTHUNDERI-BEAM RANGEBASEWIDTHNET WT.(POUNDS)LIST PRICEEACHAHA-2-8-8 2,000 8' / 6" 3.31" 5'8" to 8'2" 54" 271 $2,406.00AHA-2-8-10 2,000 8' / 6" 3.31" 7'8" to 10'2" 54" 280 2,512.00AHA-2-8-12 2,000 8' / 6" 3.31" 9'6" to 12' 54" 295 2,637.00AHA-2-10-8 2,000 10' / 6" 3.31" 5'8" to 8'2" 54" 283 $2,500.00AHA-2-10-10 2,000 10' / 6" 3.31" 7'8" to 10'2" 54" 294 2,607.00AHA-2-10-12 2,000 10' / 6" 3.31" 9'6" to 12' 54" 310 2,745.00AHA-2-12-8 2,000 12' / 8" 4" 5'8" to 8'2" 54" 303 $2,952.00AHA-2-12-10 2,000 12' / 8" 4" 7'8" to 10'2" 54" 325 3,065.00AHA-2-12-12 2,000 12' / 8" 4" 9'6" to 12' 54" 340 3,216.00AHA-2-15-8 2,000 15' / 8" 417" 5'8" to 8'2" 54" 353 $3,540.00AHA-2-15-10 2,000 15' / 8" 4.17" 7'8" to 10'2" 54" 364 3,663.00AHA-2-15-12 2,000 15' / 8" 417" 9'6" to 12' 54" 373 3,828.00AHA-4-8-8 4,000 8' / 8" 4" 5'8" to 8'2" 54" 324 $3,292.00AHA-4-8-10 4,000 8' / 8" 4" 7'8" to 10'2" 54" 360 3,452.00AHA-4-8-12 4,000 8' / 8" 4" 9'6" to 12' 54" 375 3,650.00AHA-4-10-8 4,000 10' / 8" 4.17" 5'8" to 8'2" 54" 388 $3,893.00AHA-4-10-10 4,000 10' / 8" 4.17" 7'8" to 10'2" 54" 405 4,030.00AHA-4-10-12 4,000 10' / 8" 4.17" 9'6" to 12' 54" 431 4,368.00AHA-4-12-8 4,000 12' / 8" 4.17" 5'8" to 8'2" 54" 352 $4,025.00AHA-4-12-10 4,000 12' / 8" 4.17" 7'8" to 10'2" 54" 421 4,272.00AHA-4-12-12 4,000 12' / 8" 4.17" 9'6" to 12' 54" 446 4,621.00AHA-4-15-8 4,000 15' / 10" 4.66" 5'8" to 8'2" 54" 475 $4,808.00AHA-4-15-10 4,000 15' / 10" 4.66" 7'8" to 10'2" 54" 498 5,025.00AHA-4-15-12 4,000 15' / 10" 4.66" 9'6" to 12' 54" 519 5,551.00AHA-6-8-8 6,000 8' / 8" 4.17" 6'2" to 8'2" 65" 474 $4,778.00AHA-6-8-10 6,000 8' / 8" 4.17" 8'2" to 10'2" 65" 510 5,068.00AHA-6-8-12 6,000 8' / 8" 4.17" 10'2" to 12'2" 65" 525 5,111.00AHA-6-10-8 6,000 10' / 10" 4.66" 6'2" to 8'2" 65" 538 $5,418.00AHA-6-10-10 6,000 10' / 10" 4.66" 8'2" to 10'2" 65" 555 5,520.00AHA-6-10-12 6,000 10' / 10" 4.66" 10'2" to 12'2" 65" 581 5,633.00AHA-6-12-8 6,000 12' / 12" 7" 6'2" to 8'2" 65" 502 $5,065.00AHA-6-12-10 6,000 12' / 12" 7" 8'2" to 10'2" 65" 571 5,652.00AHA-6-12-12 6,000 12' / 12" 7" 10'2" to 12'2" 65" 596 5,773.00AHA-6-15-8 6,000 15' / 12" 7" 6'2" to 8'2" 65" 605 $6,128.00AHA-6-15-10 6,000 15' / 12" 7" 8'2" to 10'2" 65" 628 6,258.00AHA-6-15-12 6,000 15' / 12" 7" 10'2" to 12'2" 65" 649 6,348.00USABLE DISTANCE BETWEEN UPRIGHTS IS OVERALL BEAM LENGTH MINUS 18"USABLE TROLLEY TRAVEL LENGTH IS OVERALL BEAM LENGTH MINUS 24"Adjustable Height Aluminum Gantry Craneswith Pneumatic <strong>Casters</strong>Four-way locking 12" x 3½" pneumatic casters included. Uniform capacity is 1,500 lbs.MODELNUMBEROVERALL BEAMLENGTH / HEIGHTFLANGEWIDTHUNDERI-BEAM RANGEBASEWIDTHNET WT.(POUNDS)DC-20/FC-70LIST PRICEEACHAHA-15-8-8-PNU 8' / 6" 3.31" 6' to 8'6" 54" 293 $2,670.00AHA-15-8-10-PNU 8' / 6" 3.31" 8' to 10'6" 54" 297 2,809.00AHA-15-8-12-PNU 8' / 6" 3.31" 9'10" to 12'6" 54" 312 2,932.00AHA-15-10-8-PNU 10' / 6" 3.31" 6' to 8'6" 54" 300 $2,764.00AHA-15-10-10-PNU 10' / 6" 3.31" 8' to 10'6" 54" 311 2,903.00AHA-15-10-12-PNU 10' / 6" 3.31" 9'10" to 12'6" 54" 327 3,042.00AHA-15-12-8-PNU 12' / 8" 4.00" 6' to 8'6" 54" 320 $3,216.00AHA-15-12-10-PNU 12' / 8" 4.00" 8' to 10'6" 54" 342 3,362.00AHA-15-12-12-PNU 12' / 8" 4.00" 9'10" to 12'6" 54" 357 3,513.00AHA-15-15-8-PNU 15' / 8" 4.17" 6' to 8'6" 54" 370 $3,804.00AHA-15-15-10-PNU 15' / 8" 4.17" 8' to 10'6" 54" 381 3,927.00AHA-15-15-12-PNU 15' / 8" 4.17" 9'10" to 12'6" 54" 390 4,092.00USABLE DISTANCE BETWEEN UPRIGHTS IS OVERALL BEAM LENGTH MINUS 16"USABLE TROLLEY TRAVEL LENGTH IS OVERALL BEAM LENGTH MINUS 24"DC-20/FC-70www.vestil.com
Aluminum Gantry Crane OptionsALUMINUM GANTRY CRANE OPTIONSMODELNUMBERLIST PRICEEACHDESCRIPTIONAHA-2/4-TLC TOTAL LOCKING CASTERS (2,000 & 4,000 LBS. UNIFORM CAPACITY CRANES ONLY) (SET OF 4) $134.00AHA-PNU-RF RETROFIT FOUR-WAY LOCK PNEUMATIC CASTERS (1,500 LBS. UNIFORM CAPACITY) $405.00AHA-2/4-V 8" x 2" V-GROOVE WHEELS (2,000 & 4,000 LBS. UNITS) (SET OF 4) $219.00AHA-2/4-V4 8" x 2" V-GROOVE WHEELS (2,000 & 4,000 LBS. UNITS) (W/4-POSITION LOCK) (SET OF 4) 279.00AHA-KIT (2) COME-A-LONG FOR HEIGHT ADJUSTMENT (NOT FOR LIFTING) $89.00Quick Install Manual TrolliesThese trollies are dependable, easy, and safe to use. Designed to easily adjust to the width ofvirtually any wide flange or S type I-beam. Width is adjusted with manual screw mechanism.Includes locking ring to prevent trolley width from changing accidentally. Manual screwmechanism may also be tightened to prevent trolley from moving (similar to a Beam Clamp). Eachtrolley includes four rollers with sealed bearings for long life. Steel construction and painted finish.105MODELNUMBERMODELNUMBERFITS BEAMFLANGE WIDTHI-BEAMFLANGEUNIFORM CAPACITY(POUNDS)UNIFORMCAPACITYNET WT.(LBS)NET WT.(LBS)LIST PRICEEACHHEADROOMQIT-1 3" to 5" 6.750" 1,000 15 $108.00QIT-2 3" to 5" 8.125" 2,000 20 117.00QIT-4 3" to 7½" 10.000" 4,000 25 164.00QIT-6 3" to 7½" 10.375" 6,000 45 213.00QIT-8 4" to 11¾" 13.875" 8,000 70 268.00QIT-10 4" to 11¾" 13.875" 10,000 75 335.00QIT-12 4" to 11¾" 14.000" 12,000 80 359.00DC-25/UPS/FC-70Low Profile Manual TrolliesThese trollies have been designed to quickly install on virtually any S type I-beam. The width of thetrolley is adjusted by rotating the center rod with lifting eye clockwise or counterclockwise. Oncehoist (sold separately) is attached, center rod cannot be rotated which prevents trolley width fromaccidentally changing. Choose either push trolley or geared trolley. Geared trolley is ideal for usewhen precise positioning of the trolley is required. Steel construction and painted finish. Height ismeasured from bottom of wheel to bottom of hooking eye.LIST PRICEEACHDESCRIPTIONHEADROOME-MT-1 PUSH 2" to 8 5 /8" 2 1 /2" 1,000 20 $88.00E-MT-2 PUSH 2 1 /4" to 8 5 /8" 2 5 /8" 2,000 25 123.00E-MT-4 PUSH 2 1 /2" to 8 5 /8" 3" 4,000 35 181.00E-MT-6 PUSH 3" to 8 5 /8" 3 3 /8" 6,000 60 270.00E-MT-8 PUSH 3 1 /2" to 8 5 /8" 4" 8,000 105 343.00E-MT-10 PUSH 3 1 /2" to 8 5 /8" 4" 10,000 105 436.00E-MT-1-C GEARED 2 1 /2" to 5 1 /2" 4 1 /2" 1,000 35 $133.00E-MT-2-C GEARED 2 1 /2" to 5 1 /2" 5" 2,000 45 171.00E-MT-4-C GEARED 3" to 6 1 /2" 6" 4,000 70 212.00E-MT-6-C GEARED 3" to 8" 7 3 /8" 6,000 100 291.00E-MT-8-C GEARED 3 1 /2" to 8" 8 5 /8" 8,000 155 408.00E-MT-10-C GEARED 3 1 /2" to 8" 8 5 /8" 10,000 155 571.00DC-25/UPS/FC-70Low Headroom Combination Chain Hoist/TrolleyUse this to gain additional raised hook height. Chain hoist hook travel is 10 feet. Anti dropstraps standard.MODELNUMBERBOTTOM OF ROLLERTO TOP OF HOOKI-BEAMFLANGEUNIFORMCAPACITYNET WT.(LBS)LIST PRICEEACHDESCRIPTIONLOW-1P PUSH 11¾" 2" - 6" 1,000 35 $255.00LOW-2P PUSH 13" 2½" - 8" 2,000 55 304.00LOW-4P PUSH 16¼" 3½" - 8" 4,000 110 433.00LOW-6P PUSH 18¼" 4" - 8" 6,000 140 670.00LOW-1G GEARED 11¾" 2" - 6" 1,000 45 $306.00LOW-2G GEARED 13" 2½" - 8" 2,000 65 353.00LOW-4G GEARED 16¼" 3½" - 8" 4,000 120 484.00LOW-6G GEARED 18¼" 4" - 8" 6,000 150 726.00DC-25/UPS/FC-70PUSH LOW PROFILEEYE MANUAL TROLLEYmodel E-MT-1NewGEARED LOW PROFILEEYE MANUAL TROLLEY(FEATURES 10 FT. OF CHAIN)model E-MT-1-CGANTRY AND JIB CRANESwww.vestil.com Phone (800) 348-0868
106Each unit comes standardwith a rugged storage bag.Additional bags are available,model BAG-12Professional Lever Hoists (disc brake)These versatile hoists are suitable for lifting, pulling and lashing the load in many applications.Ideal for confined spaces and can be used at any angle. 50% wider hardened ratchet gear, highimpact restraint gear case and brake cover. Free wheeling in neutral position serves to quicklyattach the load or pull the chain thru the hoist in both directions. Grade 100 alloy chain formore strength and less weight. Upper and lower swivel hooks with deformation indicators.Minimum braking load is 4 times of rated capacity. Fully enclosed brake system. Manufacturedto ISO9002 quality standard. Every unit is tested to 150% of the rated capacity and is issuedwith an individual test certificate.PROFESSIONAL LEVER HOISTseries PLH5 YEARWARRANTYMODELNUMBERUNIFORMCAPACITYSTANDARDLIFT (FEET)MINIMUM DISTANCEBETWEEN HOOKSHANDLELENGTHNET WT.(POUNDS)LIST PRICEEACHPLH-15-5 1,500 5 11" 11" 15 $139.00PLH-15-10 1,500 10 11" 11" 18 149.00PLH-15-20 1,500 20 11" 11" 22 175.00PLH-30-5 3,000 5 15½" 16" 23 $175.00PLH-30-10 3,000 10 15½" 16" 27 203.00PLH-30-20 3,000 20 15½" 16" 35 259.00PLH-60-5 6,000 5 22 7 /16" 16" 35 $333.00PLH-60-10 6,000 10 22 7 /16" 16" 42 346.00PLH-60-20 6,000 20 22 7 /16" 16" 49 379.00ADDITIONAL 12 POCKET TOOL STORAGE BAG, model BAG-12, $21.00 LISTDC-25/UPS/FC-85GANTRY AND JIB CRANESECONOMY LEVER HOISTseries ELHMIGHTY-MINI LEVER HOISTmodel ELH-05-51 YEARWARRANTYEach unit comes standardwith a rugged storage bag.Additional bags are available,model BAG-12Economy Lever Hoists (weston brake)Ideal for lifting and pulling applications. Features a completely enclosed Weston-Type automaticbrake system for precise load positioning. These hoists are constructed from cold-formedstamped steel, which confers great strength, impact resistance and long product life. Durablebaked enamel paint shields non-wearing parts from environmental damage. Single-Hand "freechaining" is simple and convenient allowing smooth, trouble-free operation in the vertical orhorizontal position. The lever handle can rotate in a complete 360° circle. Both the swivelhooks is include deformation indicators. Every chain hoist is operationally tested to 150% ofthe rated capacity and issued with an individual test certificate.MODELNUMBERUNIFORMCAPACITYSTANDARDLIFT (FEET)MINIMUM DISTANCEBETWEEN HOOKSHANDLELENGTHNET WT.(POUNDS)LIST PRICEEACHELH-05-5 500 5 9.45" 6" 5 $90.00ELH-15-5 1,500 5 12.8" 11" 18 $106.00ELH-15-10 1,500 10 12.8" 11" 21 114.00ELH-15-20 1,500 20 12.8" 11" 25 141.00ELH-30-5 3,000 5 15.0" 16" 30 $134.00ELH-30-10 3,000 10 15.0" 16" 35 153.00ELH-30-20 3,000 20 15.0" 16" 45 198.00ELH-60-5 6,000 5 19.0" 16" 52 $210.00ELH-60-10 6,000 10 19.0" 16" 59 229.00ELH-60-20 6,000 20 19.0" 16" 72 287.00ADDITIONAL 12 POCKET TOOL STORAGE BAG, model BAG-12, $21.00 LISTDC-25/UPS/FC-851 YEARWARRANTYHand Chain HoistsThese portable, lightweight hoists are durable and easy to operate. Compact design andlow headroom allow installation in confined areas. Enclosed double ratchet pawls withself adjusting disc brake standard. Designed with a safety factor 4 times the rated capacity.Individually tested at 150% of the rated capacity. Features grade 80 black chain tempered toISO 3077, galvanized pull chain, hardened two-stage gears, and forged steel upper and lowerhooks with safety latches. Constructed of high quality steel components ideal for industrialapplications. Meets ANSI B30.16-2003 requirements.HAND CHAIN HOISTseries HCHPhone (800) 348-0868MODELNUMBERUNIFORM CAPACITY(POUNDS)LIFT(FEET)HEADROOM(INCHES)NET WT.(POUNDS)LIST PRICEEACHHCH-1-10 1,000 10 11 22 $103.00HCH-1-15 1,000 15 11 26 120.00HCH-1-20 1,000 20 11 30 136.00HCH-2-10 2,000 10 12 26 $119.00HCH-2-15 2,000 15 12 34 136.00HCH-2-20 2,000 20 12 42 151.00HCH-4-10 4,000 10 14½ 45 $173.00HCH-4-15 4,000 15 14½ 54 197.00HCH-4-20 4,000 20 14½ 63 219.00DC-25/UPS/FC-85www.vestil.com
107Economy Chain Hoist with Chain ContainerThis compact hoist features a high efficiency motor with convenient 24V push-button operation.Single or three phase power available. Innovative design makes unit more resistant to dust andwater, load limit fitted, and features a 4:1 safety factor. Chain container included.MODELNUMBERUNIFORMCAPACITYFEET PERMINUTEMOTOROUTPUT (KW)HEADROOMLIFT(FEET)NET WT.(LBS.)LIST PRICEEACHPOWERH-1000-1 1,000 17.0 0.8 21 7 /16" 15 1 PHASE 90 $1,356.00H-2000-1 2,000 17.0 1.2 22 13 /16" 15 1 PHASE 105 1,472.00H-4000-1 4,000 8.5 1.2 21 7 /16" 15 1 PHASE 145 1,760.00H-1000-3 1,000 20.5 0.8 21 7 /16" 15 3 PHASE 90 $1,338.00H-2000-3 2,000 17.0 1.6 22 13 /16" 15 3 PHASE 105 1,461.00H-4000-3 4,000 16.0 1.6 21 7 /16" 15 3 PHASE 145 1,711.00DC-20/FC-85modelH-1000-1Electric Chain HoistsMODELNUMBERUNIFORMCAPACITYFEET PERMINUTE115V 1-PHASE & 460V 3-PHASE STANDARDRuggedly built with power to handle most industrial lifting applications. Includes push-buttonhand pendant with raise and lower functions. Single and three phase AC power available.Optional Chain Container stores surplus chain overhead to keep from interfering with operation.Additional lifting heights and speeds available, contact factory.HEADROOMLIFT(FEET)NET WT.(LBS.)LIST PRICEEACHPOWERECH-03 300 16 11 1 /16" 10 1 PHASE 26 $1,109.00ECH-06 600 8 11 1 /16" 10 1 PHASE 32 1,275.00ECH-10-1PH 1,000 15 14" 10 1 PHASE 86 2,077.00ECH-20-1PH 2,000 14 16" 10 1 PHASE 90 2,650.00ECH-40-1PH 4,000 7 22 1 /2" 10 1 PHASE 150 2,763.00ECH-60-1PH 6,000 3.5 29½" 10 1 PHASE 207 3,651.00ECH-10-3PH 1,000 15 14" 10 3 PHASE 86 $1,959.00ECH-20-3PH 2,000 14 16" 10 3 PHASE 90 2,077.00ECH-40-3PH 4,000 14 22" 10 3 PHASE 150 2,775.00ECH-60-3PH 6,000 17 26" 10 3 PHASE 269 4,067.00ECH-80-3PH 8,000 11 32" 10 3 PHASE 306 5,600.00ECH-100-3PH 10,000 11 32" 10 3 PHASE 315 5,774.00ECH-CC CHAIN CONTAINER (FITS 300 & 600 LBS. UNITS) 5 $98.00ECH-CC-K CHAIN CONTAINER (FITS 1,000 TO 4,000 LBS. UNITS) 5 102.00ECH-CC-6-K CHAIN CONTAINER (FITS 6,000 LBS. UNITS) 5 200.00ECH-CC-810-K CHAIN CONTAINER (FITS 8,000 TO 10,000 LBS. UNITS) 5 200.00Variable Speed Electric Chain Hoists1-PHASE STANDARDVariable Speed Electric Chain Hoist makes it easier and faster to lift your product. Theseadd exceptional value, since these hoist save on maintenance, repair, and downtime costsover its lifetime. Standard push button hand control with up and down controls, andvariable speed knob. Chain container included.DC-20/FC-85NewmodelECH-10-1PHGANTRY AND JIB CRANESMODELNUMBERUNIFORMCAPACITYVARIABLESPEED (FPM)HEADROOMLIFT(FEET)NET WT.(LBS.)LIST PRICEEACHVOLTAGEVS-ECH-2-1PH 250 0-49 18" 13 115 42 $1,810.00VS-ECH-5-1PH 500 0-49 18" 13 220 48 1,860.00VS-ECH-10-1PH 1,000 0-49 18" 13 220 55 2,010.00DC-20/FC-85STANDARDVARIABLE SPEEDHAND CONTROLmodelVS-ECH-2-1PHManipulator Style Control Electric Chain Hoist115V 1-PHASE STANDARDEngineered for maximum operator comfort and control. Features inline hand grip which allowsone handed operation and gives the operator a free hand to easily position the load. Easy touchrocker switch above hand grip allows quick selection between low and high speed control. A widerange of adjustable speeds and single phase power make this hoist the perfect solution for manydifficult product handling problems. Lightweight and compact die cast aluminum body. Chaincontainer comes standard.MODEL UNIFORM HIGH SPEED LOW SPEED HEAD LIFT NET WT. LIST PRICENUMBER CAPACITY F.P.M. F.P.M. ROOM (FEET) (LBS.) EACHECH-50M-6-1PH 525 44 10 37.8" 6 40 $3,617.00DC-20/FC-85modelECH-50M-6-1PHwww.vestil.com Phone (800) 348-0868
108High Speed Electric Chain Hoist115V 1-PHASE STANDARDThis high speed single phase electric chain hoist offers the ability to lift heavy loads with ease andprecision. Light, compact and powerful, this hoist can be easily installed, transported and offershigh lifting speed. Features include double braking system for added protection, heavy-dutymotor for industrial applications, high performance friction clutch to prevent overwinding andcorrosion-resistant nickel-plated load chain. Chain container comes standard.modelECH-ED-10-1PHMODEL UNIFORM FEET PER HEAD LIFTNET WT. LIST PRICENUMBER CAPACITY MINUTE ROOM (FEET) POWER (LBS.) EACHECH-ED-10-1PH 1,050 22 20½" 10 1 PHASE 46 $2,783.00DC-20/FC-85Air Chain HoistsHeavy-duty air chain hoist can be used as a workstation hoist or as a production line hoist.Lightweight, rugged, and compact design - for ease of portability - makes this hoist perfect formost air hoist lifting applications. Standard lift is 10 feet assuming 90 PSI air pressure. Variableflow, two lever pendant for precise load spotting.series ACHMODELNUMBERUNIFORMCAPACITYLIFTINGF.P.M.LIFT(FEET)NET WT.(LBS)LIST PRICEEACHACH-60 600 LBS. 16 10 34 $1,790.00ACH-100 1,000 LBS. 11 10 34 1,925.00ACH-CC-C CHAIN CONTAINER 2 $109.00DC-20/FC-85GANTRY AND JIB CRANESWALL-SWALL-DNewWall Mounted Hand WinchIndustrial winches are pulling devices that use a wire, rope, cable, strap or web to move heavy loads.Constructed of steel worm gear drives with zinc plated finish. Pinion gear shaft with lubricateddown bushings provide smooth operation and long life. Available in single or dual drum models.MODELNUMBERUNIFORMCAPACITYGEARRATIOHANDLELENGTHNET WT.(LBS.)LIST PRICEEACHTYPEWALL-S SINGLE 1,500 41:1 9.6" 12 $82.00WALL-D DOUBLE 1,500 41:1 6.6" 14 93.00DC-25/UPS/FC-70Hand WinchManual hand-operated gear drive winches, model HWG-600, are designed for many lifting,lowering and pulling applications. Equipped with a load pressure brake. This brake holdsthe load at any required height during hoisting and lowering and prevents and unintentionallowering of the load. Adjustable crank handle for fast lifting of smaller loads, resulting in lowestpossible handle effort and rapid winding of he rope. All rotating parts are maintenance-free.Suitable for operation in ambient temperatures of 14° through 120°F. Capacity 600 lbs.HWG-600NewWorm gear winch, model HWV-1000, allows for better load control and features a reinforcedframe, comfort-grip handle. Worm gear provides load holding capability when handle isreleased. Reel stops automatically, locking load in place whenever the handle is released. Highquality enamel paint finish, dipped and baked. Crank handle can be adjusted in length. Winchhousing and rope drum are made from robust steel plate. Capacity 1,000 lbs.HWV-1000MODELNUMBERWIREROPEDRUMCAPACITY (FT.)OVERALL SIZE(L x W x H)NET WT.(LBS.)LIST PRICEEACHGEAR TYPEHWG-600 MANUAL 3/16" 65 9½" x 7 7 /8" x 7 7 /8" 36 $148.00HWV-1000 WORM 1/4" 45 7" x 10¼" x 7" 36 163.00DC-20/UPS/FC-70Beam ClampsDesigned to reduce the I-beam flange stress by distributing loads away from the flange edges duringoverhead lifting applications. These versatile units can be interchanged from one gantry to another ina matter of seconds with its easy mechanical adjustment mechanism. A bar is located at the bottomof the beam clamp for attaching a hoist (sold separately). Steel construction and painted finish.Phone (800) 348-0868BEAM CLAMPSseries BCMODELNUMBERBEAM FLANGEWIDTHUNIFORMCAPACITY (LBS)NET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONBC-2 BEAM CLAMP 2½" - 8½" 2,000 18 $51.00BC-4 BEAM CLAMP 2½" - 9¼" 4,000 20 58.00BC-6 BEAM CLAMP 4½" - 8½" 6,000 28 95.00BC-8 BEAM CLAMP 4½" - 8½" 8,000 40 116.00DC-20/UPS/FC-70www.vestil.com
Positive Locking Plate ClampsGrips sheet until release ring is pulled. Serrated gripper is hardened tool steel. Forged head and gear.Safety factor is 2 to 1. Power coated finish. Designed to meet ASME B30.20 standards. Do not useplate clamps to lift loads less than 20% of rated capacity. Lift only one plate at a time. Plate must beclean and free of oil.BAILOPENING109MODELNUMBERMINIMUMPLATETHICKNESSMAXIMUMPLATETHICKNESSMIN UNIFORMPLATE WEIGHT(POUNDS)UNIFORMWORKINGLOAD LIMITTHROATDEPTHBALEOPENINGNET WT.(POUNDS)LIST PRICEEACHLPC-20 0 0.80" 400 2,000 2.30" 1.9" 12 $271.00LPC-40 0 1.1875" 800 4,000 2.95" 2.2" 25 356.00LPC-60 0 1.5625" 1,200 6,000 3.34" 1.9" 32 428.00DC-25/UPS/FC-70Vertical Plate Clamps with ChainDesigned for lifting plate material in a vertical position. Lifting eye includes chain for greaterversatility. Heavy-duty steel construction for years of reliable use. Meets ASME B30.20 specifications.Do not use plate clamps to lift loads less than 20% of rated capacity. Lift only one plate at a time.Plate must be clean and free of oil.MODELNUMBERMINIMUMPLATETHICKNESSMAXIMUMPLATETHICKNESSMIN UNIFORMPLATE WEIGHT(POUNDS)UNIFORMWORKINGLOAD LIMITTHROATDEPTHBALEOPENINGNET WT.(POUNDS)LIST PRICEEACHCPC-10 0 0.6" 200 1,000 1.25" 2.25" 9 $153.00CPC-20 0 0.8" 400 2,000 3" 3.00" 17 204.00CPC-40 0 1" 800 4,000 3" 3.75" 23 268.00CPC-80 0 1.1875" 1,320 6,600 3" 5.25" 35 416.00DC-25/UPS/FC-70Vertical Plate ClampsPivoting bail for easier and more versatile operation. Automatic serrated hardened steel cams and pads.Drop-forged steel case for maximum strength. Designed to meet ASME B30.20. Warning: Do notexceed the working load limit. Serious bodily injury or property damage may result. Do not use plateclamps to lift loads less than 20% of rated capacity. Lift only one plate at a time. Plate must be cleanand free of oil.MODELNUMBERMINIMUMPLATETHICKNESSMAXIMUMPLATETHICKNESSMIN UNIFORMPLATE WEIGHT(POUNDS)UNIFORMWORKINGLOAD LIMITTHROATDEPTHBALEOPENINGNET WT.(POUNDS)LIST PRICEEACHEPC-10 0 0.60" 200 1,000 1.6" 1.1" 8 $112.00EPC-20 0 0.75" 400 2,000 2.9" 2.3" 18 180.00EPC-40 0 1.00" 800 4,000 2.9" 2.3" 20 250.00EPC-80 0 1.10" 1,320 6,600 3.0" 2.3" 38 374.00DC-25/UPS/FC-70Horizontal Plate ClampsDesigned for lifting plate material in horizontal position. Heavy-duty steel construction for years ofreliable use. Meets ASME B30.20 specifications. Do not use plate clamps to lift loads less than 20%of rated capacity. Lift only one plate at a time. Plate must be clean and free of oil.MODELNUMBERMINIMUMPLATETHICKNESSMAXIMUMPLATETHICKNESSMIN UNIFORMPLATE WEIGHT(POUNDS)UNIFORMWORKING LOADLIMITBALEOPENINGNET WT.(POUNDS)LIST PRICEEACHHPC-20 0 0.8125" 200 2,000 1.2" 8 $123.00HPC-40 0 1.25" 400 4,000 1.2" 18 143.00HPC-80 0 1.375" 800 8,000 1.2" 20 189.00HPC-140 0 1.4375" 1,320 10,000 1.2" 38 333.00DC-25/UPS/FC-70Heavy-Duty Beam TongsDesigned for lifting I-beams with an overhead lifting device. The heavier the load the stronger thegrip. Includes lifting ring for easy use with overhead hoist. Loads need to be centered and guidedduring lifting operation. Manufactured to ASME B30.20 standards.BAILOPENINGPOSITIVE LOCKING PLATE CLAMPseries LPCVERTICAL PLATE CLAMPS WITH CHAINseries CPCBAILOPENINGBAILOPENINGVERTICAL PLATE CLAMPSseries EPCHORIZONTAL PLATE CLAMPSseries HPCGANTRY AND JIB CRANESMODELNUMBERUNIFORM WORKINGLOAD LIMIT (LBS.)MAXIMUMBEAM WIDTHNET WT.(POUNDS)LIST PRICEEACHBT-20 2,000 6" 15 $238.00BT-40 4,000 8" 18 284.00BT-60 6,000 10" 21 335.00DC-25/UPS/FC-70HEAVY-DUTY BEAM TONGSseries BTwww.vestil.com Phone (800) 348-0868
110Heavy-Duty Die Lifting TongsDesigned for lifting dies with overhead lifting devices. Includes lifting ring for easy use withoverhead hoist. Manufactured to ASME B30.20 standards.HEAVY-DUTYDIE LIFTING TONGSseries DLTMODELNUMBERUNIFORM WORKINGLOAD LIMIT (LBS.)MAXIMUMWIDTH OPENINGNET WT.(POUNDS)LIST PRICEEACHDLT-20 2,000 20" 67 $760.00DLT-25 2,500 28" 75 967.00DLT-30 3,000 38" 92 1,158.00DC-25/UPS/FC-70GANTRY AND JIB CRANESHEAVY-DUTY PIPE GRABSseries PG-COVERHEAD COIL HOOKSseries CHGALVANIZED TWO-SPEED CABLE PULLERmodel CABLE-P4Heavy-Duty Pipe GrabsDesigned for lifting pipe (cast iron or steel) with overhead lifting device. Automatic operationallows for easy use by anyone. Loads must be centered and guided during lifting operations.Heavy-duty steel construction with yellow powder coat finish.MODELNUMBERMODELNUMBERPIPE STYLESINGLE-LINEUNIFORM CAPACITYUNIFORM WORKINGLOAD LIMIT (LBS.)DOUBLE-LINEUNIFORM CAPACITYWORKS WITHPIPE 0.D.SINGLE-LINECABLE LENGTHNET WT.(POUNDS)NET WT.(POUNDS)LIST PRICEEACHPG-C-045 CAST IRON 450 3.50" TO 4.00" 19 $226.00PG-C-060 CAST IRON 600 4.50" TO 4.80" 19 244.00PG-C-100 CAST IRON 1,000 6.63" TO 6.90" 24 296.00PG-C-140 CAST IRON 1,400 8.63" TO 9.05" 36 326.00PG-C-200 CAST IRON 2,000 10.75" TO 11.10" 72 534.00PG-S-045 STEEL 450 3.50" TO 4.00" 19 $226.00PG-S-060 STEEL 600 4.50" TO 4.80" 19 244.00PG-S-100 STEEL 1,000 6.63" TO 6.90" 24 296.00PG-S-140 STEEL 1,400 8.63" TO 9.05" 36 326.00PG-S-200 STEEL 2,000 10.75" TO 11.10" 72 534.00DC-25/UPS/FC-70Overhead Coil HooksDesigned for lifting heavy coils with an overhead lifting device. Easily position coils fromhorizontal to vertical position. Steel construction with yellow powder coat finish.MODELNUMBERUNIFORM LIFTINGCAPACITY (LBS)MAXIMUMCOIL WIDTHMINIMUMCOIL RADIALMINIMUMINSIDE DIA.NET WT.(POUNDS)LIST PRICEEACHCH-10-6 1,000 6" 13" 9" 12 $621.00CH-10-12 1,000 12" 13" 13" 24 660.00CH-20-8 2,000 8" 16" 10" 29 670.00DC-25/UPS/FC-70Galvanized Two-Speed Cable PullerGreat for use in horizontal pulling applications such as positioning equipment, stringing lines, andemergencies. Can be used in both single and double-line pulling applications. Handle ratchetsto take up cable. When handle is rotated all the way back, the cable reel will free-wheel. Handlelength is 30". Minimum headroom is 24". Single-line cable length is ¼" x 120" (cable length is60" when used as a double-line). Not for use in vertical lifting applications.LIST PRICEEACHCABLE-P4 2,000 LBS. 4,000 LBS. ¼" x 120" 15 $34.60DC-25/UPS/FC-50Long Reach Cable Pullers/LiftersThis product is ideal for applications requiring pulling over long distances. Pull up to 60 feetwithout unhooking and resetting as required when using conventional lever or hand chainhoists. Works great for pulling horizontally. Not for use in vertical lifting applications.MODELNUMBERUNIFORMCAPACITY (LBS)STROKE(FEET)CABLE DIAMETER(APPROX. INCHES)NET WT.(POUNDS)LIST PRICEEACHCP-15 1,500 60 5/16 35 $217.00CP-30 3,000 60 7/16 60 304.00*MEETS CSIR FOR USE IN MINING INDUSTRYDC-25/UPS/FC-70Phone (800) 348-0868www.vestil.com
111Mini Cable Hoists115V 1-PHASE STANDARDCan be used in both single-line and double-line lifting applications. Cable length is 36 ft. whenused as a single-line -- 18 ft. when used as a double-line. Includes electric motor and hand-heldpush button controls. Motor operates on 115V AC power. The installation bracket will fit on1⅝" round pipe or 1⅝" square tubing.Optional Swivel Hook Plate must be ordered for attaching hoist to a trolley (trolley not included).MODELNUMBERUNIFORM SINGLE-LINECAPACITY (LBS.)UNIFORM DOUBLE-LINECAPACITY (LBS.)LIFTING SPEED(FEET PER MINUTE)NET WT.(LBS)LIST PRICEEACHMINI-2 100 200 30' 36 $171.00MINI-4 200 400 30' 48 245.00SWIVEL HOOK PLATE, MODEL MINI-SH, $151.00 LISTDC-25/UPS/FC-70Self-Supporting Bridge CranesThe system is composed of modular units so that the components can be reused when the layoutis changed. The system does not require any electrical power. The overall height is 14 feet.Festoon for electric hoist is not included. Contact factory for pricing.MODEL NUMBERRUNWAYLENGTHBRIDGELENGTHUNIFORM CAPACITY OF CRANESWEIGHT / LIST PRICE(FEET) (FEET) 500 LBS. 1,000 LBS. 2,000 LBS.B1020-(capacity) 20 10 1575 / CALL 1890 / CALL 2835 / CALLB1030-(capacity) 30 10 2289 / CALL 2467 / CALL 3412 / CALLB1520-(capacity) 20 15 1758 / CALL 2124 / CALL 3076 / CALLB1530-(capacity) 30 15 2478 / CALL 2709 / CALL 3685 / CALLB2020-(capacity) 20 20 2205 / CALL 2499 / CALL 2320 / CALLB2030-(capacity) 30 20 3150 / CALL 3475 / CALL 4389 / CALLDC-20/FC-70Air Balance Jib LiftersThe Air Balancers achieve high performance, excellent safety, and low cost in thehandling of heavy materials. Designed to effortlessly handle materials in a threedimensional work space. The push-button hand control operates the pneumaticcylinder, raising and lowering the cable, in turn, positioning the load. Threemounts available.MODELNUMBERUP/DOWNSTROKEMAXIMUMARM LENGTHUNIFORMCAPACITYARMROTATIONAIRPRESSURENET WT.(LBS.)model DSL-300-PLIST PRICEEACHFLOOR MOUNTDSJ-300 57½" 93" 250 360° 100 psi 670 $5,521.00DSL-300 47¼" 78¼" 250 360° 100 psi 695 9,495.00DSC-300 78¾" 86½" 350 360° 100 psi 710 12,532.00PORTABLEDSJ-300-P 57½" 93" 250 360° 100 psi 970 $6,721.00DSL-300-P 47¼" 78¼" 250 360° 100 psi 995 10,695.00DSC-300-P 78¾" 86½" 350 360° 100 psi 1010 13,732.00CEILING MOUNTDSJ-300-C 57½" 93" 250 360° 100 psi 650 $5,521.00DSL-300-C 47¼" 78¼" 250 360° 100 psi 675 9,495.00DSC-300-C 78¾" 86½" 350 360° 100 psi 690 12,532.00DC-20/FC-70modelDSC-300model DSJ-300NewGANTRY AND JIB CRANESMechanical & Pneumatic Hoist AttachmentsPneumatic Vacuum Lifter is designed to lift products with smooth, flat, and non-poroussurfaces. Push button to operate vacuum to grab product. Release button to release product.Positioning of product is provided by the Air Balance Jib Lifter.Scissor Action Lifter is designed to lift round cylindrical products like pipe and tubing. Mechanicaloperation only. Positioning of products is provided by the Air Balance Jib Lifter or Hoist.PNEUMATIC VACUUMmodel VAC-6Double Hook Lifter is designed to lift virtually any type of object, either small or large, long orshort, round or flat. Simple double-hook design with mechanical operation only. Positioning ofproduct is provided by the Air Balance Jib Lifter or Hoist.MODELNUMBERUNIFORM CAPACITY(POUNDS)NET WT.(LBS.)LIST PRICEEACHDESCRIPTIONVAC-6 PNEUMATIC VACUUM 250 32 $4,108.00LMEC-SA SCISSOR ACTION 250 19 1,016.00LMEC-DH DOUBLE HOOK 250 20 807.00DC-20/UPS/FC-70SCISSOR ACTIONmodel LMEC-SADOUBLE HOOKmodel LMEC-DHwww.vestil.com Phone (800) 348-0868
GANTRY AND JIB CRANES112New18"H base requires(41) 60 lbs. bags ofSakrete mix36"H base requires(82) 60 lbs. bags ofSakrete mixPhone (800) 348-086818"H base requires(41) 60 lb. bags ofSakrete mix36"H base requires(82) 60 lb. bags ofSakrete mixNewMulti-Station Transportable Jib CranesDesigned for use in multiple locations, includes jib crane and one base socket. Extra base socketsmay be purchased for use in other locations. Friction brake design allows positive locking andcontrolled rotation of heavy loads. 360° continuous rotation of heavy loads. Handles mostapplications up to 1,000 uniform lbs. and up to 120" radius reach. Standard 6" high I-beam with3" flange width. Rugged welded steel construction. Hoist and trolley sold separately.MODELNUMBEROVERALLHEIGHTUSABLEHEIGHTUNIFORMCAPACITYNET WT.(LBS.)LIST PRICEEACHSPANJIB-P-10-6-6 6' 7'1" 6' 1,000 578 $1,375.00JIB-P-10-6-8 6' 9'1" 8' 1,000 640 1,449.00JIB-P-10-6-10 6' 11'1" 10' 1,000 701 1,525.00JIB-P-10-8-6 8' 7'1" 6' 1,000 606 $1,412.00JIB-P-10-8-8 8' 9'1" 8' 1,000 677 1,488.00JIB-P-10-8-10 8' 11'1" 10' 1,000 720 1,566.00JIB-P-10-10-6 10' 7'1" 6' 1,000 632 $1,553.00JIB-P-10-10-8 10' 9'1" 8' 1,000 695 1,629.00JIB-P-10-10-10 10' 11'1" 10' 1,000 757 1,706.00JIB-P-B EXTRA BASE SOCKET, 32"H WITH 17" x 17" BASE 145 $490.00DC-20/FC-70Portable Jib Cranes with optional cement counterbalance baseUnique design allows for easy transportation of jib crane with a fork truck. Standard base includedwith jib crane is not filled with concrete (instructions included for proper filling). Base may beordered pre-filled with concrete for immediate use. Base measures 42¼" x 42¼" and includes built-infork tubes. Fork tubes are 7⅝"W x 2⅝"H usable. Fixed length I-beam will pivot 360° for completeaccess. Under I-beam clearance is 10'. Upright vertical column bolts to base. Steel construction withblue painted finish. Units ship knocked down. Not for use as a fork truck attachment.MODELNUMBERWTJ-2WTJ-4MODELNUMBERUNIFORMCAPACITYI-BEAMLENGTHI-BEAMHEIGHTI-BEAMFLANGE WIDTHBASEHEIGHTBOOMUNIFORMCAPACITYBOOMREACHLIFTRANGEMAXIMUMLIFTEXTENDED 500 49¼" 0 TO 105" 90"RETRACTED 1,000 32¾" 13" TO 90½" 106"EXTENDED 1,000 49¼" 0 TO 105" 90"RETRACTED 2,000 32¾" 13" TO 90½" 106"NET WT.(LBS.)NET WT.(POUNDS)LIST PRICEEACHJIB-CB-25-8-10 250 8' 6" 3.000" 18" 803 $2,911.00JIB-CB-25-10-10 250 10' 6" 3.000" 18" 823 4,303.00JIB-CB-50-8-10 500 8' 6" 3.000" 18" 803 $4,262.00JIB-CB-50-10-10 500 10' 8" 6.000" 36" 1106 5,666.00JIB-CB-100-8-10 1000 8' 8" 6.000" 36" 1156 $5,516.00JIB-CB-18-B OPTION TO FILL BASE WITH CONCRETE 18" 2815 $321.00JIB-CB-36-B OPTION TO FILL BASE WITH CONCRETE 36" 5630 413.00DC-20/FC-70Portable Offset Jib CranesOffset base design allows for larger usable work area beneath I-beam. Allows for easytransportation of jib crane with fork truck. Fixed length I-beam will pivot 360° for completeaccess. Standard base with jib crane is not filled with concrete. Base may be ordered pre-filled withconcrete for immediate use. Base size is 42¼"W x 42¼"L x 18"H or 36"H. Built-in fork tubes,measuring 7⅝"W x 2⅝"H usable, for transportation with fork truck. Steel construction with bluepainted finish. Units ship knocked down. Not for use as a fork truck attachment.MODELNUMBERUNIFORMCAPACITYI-BEAMLENGTH/HEIGHTI-BEAMFLANGE WIDTHBASEHEIGHTNET WT.(LBS.)LIST PRICEEACHJIB-CBX-25-8-10 250 8' / 6" 3" 18" 993 $2,934.00JIB-CBX-25-10-10 250 10' / 6" 3" 18" 1013 4,092.00JIB-CBX-50-8-10 500 8' / 6" 3" 18" 1143 $4,262.00JIB-CBX-50-10-10 500 10' / 8" 6" 36" 1185 5,666.00JIB-CBX-100-8-10 1,000 8' / 8" 6" 36" 1165 $5,061.00JIB-CBX-18-B OPTION TO FILL BASE WITH CONCRETE 18" HIGH $321.00JIB-CBX-36-B OPTION TO FILL BASE WITH CONCRETE 36" HIGH 413.00DC-20/FC-70Winch Operated Truck Jib CraneInstalled in your pick-up truck bed, this winch operated jib crane will help lift loads. Lift itemsfrom ground to truck bed height, then rotate into cargo area. Includes telescopic boom design withmanual hydraulic hand pump to pivot boom up and down. Manual 16' cable winch (with ¼" cablediameter) to lift and lower loads. Unit comes with one grab hook, one chain slot lock, and one slinghook with latch. Mounting plate is 10½" by 10½". Base height is 12½". Overall height is 56". Thecrane swivels on a 360° base. Painted safety yellow. Welded steel construction.LIST PRICEEACH125 $239.00150 $299.00DC-20/FC-70www.vestil.com
Lifter Jibs12V DC STANDARDLift items from the ground to van floor height, then rotate into cargo area. Hand crank winch isstandard, battery powered winch is optional. Battery powered winch includes 36" long leads witha speed of ¾" per second. Battery not included. Van floor to raised hook height is 38".Double-pivot arm for use in tight spaces. Overall height is 46½". Mounting plate measures8" x 8". Steel construction. Painted finish. model VAN-J-DC113MODELNUMBERMODELNUMBERSWING REACH(MIN x MAX)UNIFORMCAPACITYBOOMREACHUSABLE CABLELENGTH (FT.)UNIFORMCAPACITYBOOMHEIGHTMODELNUMBERUNIFORMCAPACITY (LBS)BOOMLENGTHBOOMHEIGHTFOLDING DESIGN FOR STORAGE (33½"W x 44"L x 60½"H) -- (FOLDABLE LEGS)2,000 35¼" 13¾" to 73¼"EHN-20-C1,500 38¾" 10½" to 76"1,000 42½" 7¼" to 79"500 46" 4" to 82¼"4,000 40" 21" to 75½"EHN-40-C3,000 47" 15" to 81"2,000 54" 9" to 86 3 /8"1,000 61¼" 3" to 91 13 /16"FIXED - WILL NOT FOLD FOR STORAGE -- (TELESCOPIC LEGS)4,000 47½" 35¼" to 85¼"EHN-40-T3,000 56½" 31½" to 88½"2,000 65½" 27½" to 93¾"1,000 76½" 23¾" to 99"6,000 52" 22" to 84"EHN-60-T4,000 60" 16¾" to 88"3,000 68" 11½" to 92½"2,000 76¼" 6¼" to 96¾"NET WT.(LBS.)NET WT.(LBS.)NET WT.(LBS.)LIST PRICEEACHDESCRIPTIONVAN-J MANUAL 0" to 38½" 14 400 160 $442.00VAN-J-DC* DC POWERED 0" to 38½" 46 400 195 718.00WINCH-AC-HHPB HANDHELD PUSH-BUTTON CONTROL 5 $205.00VAN-BB BATTERY BOX 5 $19.00VAN-BATT BATTERY 55 108.00BC BENCH TOP STYLE BATTERY CHARGER 8 133.50*VAN-J-DC INCLUDES BATTERY-POWERED WINCH WITH 50 FEET OF CABLEDC-20/FC-70Power Lift Jib CranesLIST PRICEEACHITEMOPERATIONA WTJ-20-3-DC 12V DC 2,000 40" to 63" 54½" to 88½" 280 $2,429.00A WTJ-20-4-DC 12V DC 2,000 52" to 87" 54½" to 99" 298 2,529.00A WTJ-20-3-AC 115V AC 2,000 40" to 63" 54½" to 88½" 385 3,013.00A WTJ-20-4-AC 115V AC 2,000 52" to 87" 54½" to 99" 398 3,118.00B WTJ-E-15-3-DC 12V DC 1,500 42" to 66" 41½" to 65½" 245 $1,944.00B WTJ-E-15-3-AC 115V AC 1,500 42" to 66" 41½" to 65½" 355 2,472.00WINCH-AC-HHPB HANDHELD PUSHBUTTON CONTROL FOR AC 5 $205.00DC-20/FC-70Shop Crane Engine Hoists12V DC & 115V 1-PHASE AC STANDARDDesigned for material handling applications on docks, in warehouses or in truck beds. Chooseeither intermittent or continuous duty winches with reaches from 3 to 9 feet. Choose either 12VDC, 1/3HP with 12 foot removable plug-in pendant control or 115V AC 1/2 HP with fingertipswitch to raise and lower hook. Meets ANSI and OSHA specifications. 12" x 12" mounting plate.A) Intermittent use cranes feature rotation hand brakes that offer unlimited 360° positioning.Mast mounts permanently. Boom adjusts in 12" increments and can be positioned at 4 elevations.DC models include 50 feet of 3/16" aircraft-grade wire rope with swivel hook and safety latchwhile AC units feature 25 feet of 7/32" cable. Folds for storage.B) The economical answer to your material handling problems. Offers light-duty, intermittent use. Upto 1,500 pounds uniform capacity at 36" boom extension. 360° locking manual rotation, 25 feet of7/32" cable with swivel snatch block and safety latch on AC units, 50 feet of 3/16" cable on DC units.These portable units are great for hundreds of lifting applications. Telescopic boom for multiplelifting heights and capacities. Boom is raised and lowered with a manual hydraulic hand pump.The high-capacity hydraulic cylinder provides for faster lifting action and features a large diameterram to withstand angled loads when lifting. Includes two rigid and two swivel casters forportability. Heavy-duty steel construction and painted finish.LIST PRICEEACH175 $261.00215 $357.00245 $333.00330 $631.00DC-20/FC-85model VAN-JBmodel EHN-20-CFOLDABLE LEGSAmodel EHN-40-TTELESCOPIC LEGSGANTRY AND JIB CRANESwww.vestil.com Phone (800) 348-0868
114Air/Hand Pump Hydraulic Shop CraneOur Air/Hand Pump Hydraulic Shop Crane allows one person to not only maneuver productfrom one location to another, but lift the product effortlessly with assistance of everyday factoryair. In remote areas where your airline does not reach you can lift your product with the handpump hydraulic option. Air raises unit 7" to 8" per second while hand pump raises units ½" perstroke. Units roll smoothly on 3½" x 1¼" cast steel casters, (4) swivel in back (2) rigid in front.The innovative hoist offers heavy-duty lifting power, while optimizing space when in the foldedposition. Standard features: foldable legs, adjustable boom, swivel hook, and steel construction.MODELNUMBERUNIFORMCAPACITY REACHMAXIMUMHEIGHTMINIMUMHEIGHTFOLDED SIZE: 33½"W x 44"L x 60½"H4,000 40" 75½" 21"EHN-40-C-AH3,000 47" 81" 15"2,000 54" 86-3/16" 9"1,000 61¼" 91-3/16" 3"NET WT.(LBS.)LIST PRICEEACH205 $438.00DC-20/FC-85/125Portable Cantilever HoistsGANTRY AND JIB CRANESDOUBLE-ACTINGHAND PUMPOUTRIGGERLEVELING JACKDVD or VIDEOAVAILABLE• Swivel Crane for Side Loading• Outriggers to Increase Stability• Double Acting Manual Hydraulic Hand Pump• Controlled Lowering• Adjustable Swing Outriggers with LevelingJacks to Stabilize Unit to Front or Side• Expedited & Increased Cable Down Reach• Customer Supplied Ballast or Optional FactorySupplied Ballast AvailableUNIFORM CAPACITYAT ARM LENGTHMODEL P-JIB-2(POUNDS)MODEL P-JIB-4(POUNDS)27" 2,000 4,00034" 1,600 3,20041" 1,300 2,60048" 1,100 2,200Lift Arm Projections:Beyond Frame: 48"Outriggers: 40"<strong>Casters</strong>: 8" PhenolicMODELNUMBEROVERALL SIZE(W x L x H)ARM LENGTHBEYOND FRAMEUNIFORMCAPACITYPHENOLICCASTERSNET WT.(LBS.)LIST PRICEEACHP-JIB-2 34" x 84" x 63" 48" 2,000 lbs. 8" x 2" 850 $2,706.00P-JIB-4 34" x 84" x 63" 48" 4,000 lbs. 8" x 2" 1050 2,985.00OPTIONAL BALLAST, MODEL P-JIB-BALL-2, $668.00 LIST, NET WEIGHT 1,850 LBS.DC-20/FC-100OPTIONAL BALLAST, MODEL P-JIB-BALL-4, $1,036.00 LIST, NET WEIGHT 3,650 LBS.Hoist TrailerUnique hoist may be towed behind a car or truck to job site and then used for hundreds ofapplications. Includes a class 2 ball coupler and safety chains for use with most commonhitches. Features (2) large 18" diameter pneumatic wheels, (2) swivel casters 4" x 2" inrear, (2) rigid 5" x 2" in front and one swivel clevis hook with safety latch at the end of theboom. Telescoping lift arm and legs and a removable jack handle standard. Welded steelconstruction with painted finish. Optional brake light kit with wiring harness available.MODELNUMBERUP/DOWNSTROKEARMLENGTHOVERALL SIZE(W x L)UNIFORMCAPACITYNET WT.(LBS.)LIST PRICEEACHH-TRAIL 30" to 91" 53½" to 77½" 47½" x 72" 4,000 465 $1,380.00DC-20/FC-100Counter Balanced Floor CranesThis Counter Balanced Floor Crane has an adjustable boom to allow for maximumadjustment and versatility to lift a variety of loads. Boom is raised with a manualhydraulic hand pump. Boom also telescopes out for greater reach. The counterbalance designeliminates the need for front legs. This makes the unit easier to maneuver and allows the craneto reach tight, hard to reach areas. Counterbalance included. Welded steel construction.DVD or VIDEOAVAILABLEMODELNUMBERMAX UNIFORM CAPACITYAT BOOM HEIGHTRIGID LOADWHEELSWIVEL REARCASTERNET WT.(LBS.)LIST PRICEEACHCBFC-500 500 lbs. @ 24"-86" 8" 6" 1089 $2,527.00CBFC-1000 1,000 lbs. @ 24"-90" 8" 6" 1508 3,464.00CBFC-2000 2,000 lbs. @ 34"-96" 8" 6" 2610 4,690.00DC-20/FC-100Phone (800) 348-0868www.vestil.com
Pallet LiftersThese solid steel constructed lifters contain tapered forks to allow easy access under pallets. Main supportcontains handles to allow personnel to position the unit. Large square head serves as a counterweight tokeep the unit level without a load. Meets ASME B30.20 Standard 1993. Painted finish.115MODELNUMBERFORKLENGTHOVERALLFORK WIDTHFORK SIZE(W x H)BAIL(W x H)UNIFORMCAPACITY (LBS)NET WT.(LBS.)LIST PRICEEACHHDP-2-36 36" 25" 2" x 2" 3" x 5" 2,000 421 $1,289.00HDP-2-42 42" 25" 2" x 2" 3" x 5" 2,000 470 1,354.00HDP-2-48 48" 25" 2" x 2" 3" x 5" 2,000 481 1,400.00HDP-4-36 36" 25" 4" x 2" 3" x 5" 4,000 647 $1,563.00HDP-4-42 42" 25" 4" x 2" 3" x 5" 4,000 676 1,665.00HDP-4-48 48" 25" 4" x 2" 3" x 5" 4,000 704 1,857.00HDP-6-42 42" 25" 6" x 2" 4" x 7" 6,000 881 $2,052.00HDP-6-48 48" 25" 6" x 2" 4" x 7" 6,000 956 2,377.00HDP-6-54 54" 25" 6" x 2" 4" x 7" 6,000 985 2,571.00ADJUSTABLE BAIL, MODEL HDP-AB, $92.00 LISTDC-20/FC-125DVD or VIDEOAVAILABLEDeluxe Overhead Load LiftersThe Deluxe Overhead Load Lifter is designed for lifting and moving pallets, skids andcrates with an overhead lifting crane. Includes an adjustable bail for keeping the load levelwhen moving. Includes three height positions for use with different sized loads. Series OLAfeatures adjustable-width forks. Series OLF features fixed-width forks. Usable fork length is43" on all units. Welded steel construction. Painted finish.MODELNUMBERUSABLELOAD HEIGHTFORK SIZE(W x L x H)UNIFORMCAPACITYNET WT.(LBS)LIST PRICEEACHOPENING HEIGHTADJUSTABLE FORK WIDTH 16½" TO 34¼"OLA-2-42 40½", 52¼", 64" 52¾", 64½", 76¼" 4" x 47½" x 2" 2,000 517 $1,703.00OLA-4-42 40½", 52¼", 64" 52¾", 64½", 76¼" 4" x 47½" x 2" 4,000 517 2,003.00FIXED FORK WIDTH AT 27"OLF-2-42 38¾", 50½", 62½" 51", 62¾", 74½" 4" x 47½" x 2" 2,000 488 $1,473.00OLF-4-42 38¾", 50½", 62½" 51", 62¾", 74½" 4" x 47½" x 2" 4,000 488 1,755.00DC-20/FC-70Coil LifterEASY TO GRIP HANDLESThe hoist mounted Coil Lifter has adjustable balance points to accommodate different sized coils. Coilscan be up to 90" in diameter and weigh as much as 1,500 pounds. The top adjusting bail allows theoperator to insure level transportation of load. Coil lifer is compact for easy storage. Steel construction.Painted finish. Lifting ring and hoist sold separately.GANTRY AND JIB CRANESMODELNUMBERRODLENGTHRODDIAMETEROVERALLWIDTHUNIFORMCAPACITY (LBS)NET WT.(LBS.)LIST PRICEEACHHDP-CL 36" 2¾" 21" 1,500 375 $1,062.00DC-20/FC-70Tripod Hoist StandsPortable and adjustable height tripod provides a convenient and economical lifting support stand.Available in steel or aluminum construction. Independently adjustable legs enable use on uneven surfaces.Adjust leg height in six inch increments. Unit folds for convenient portability and storage. Great for accessto confined spaces Features padded pivots for smooth or spiked feet. The spiked feet are designed to beused in rough terrain. A swivel eyebolt and safety chain are standard. Chain hoist not included. MeetsANSI safety requirements for confined space Z117.1.MODELNUMBEREYELET HEIGHTMIN. / MAX.UNIFORMCAPACITYNET WT.(LBS)LIST PRICEEACHDESCRIPTIONSTEEL CONSTRUCTIONTRI-SA ADJUSTABLE HEIGHT LEGS 8'11" to 14'" 2,000 285 $989.00TRI-SF FIXED HEIGHT LEGS 8'11" (fixed) 2,000 285 813.00ALUMINUM CONSTRUCTIONTRI-AA ADJUSTABLE HEIGHT LEGS 8'11" to 14'" 1,000* 215 $2,028.00TRI-AF FIXED HEIGHT LEGS 8'11" (fixed) 1,000* 215 1,650.00CAPACITY FOR MATERIAL 1,000 LBS.DC-20/FC-70SPIKE PADSMOOTH PADwww.vestil.com Phone (800) 348-0868
116Economy Spreader BeamsThese versatile lifters are ideal for lifting a variety of loads where headroom is limited. Complieswith OSHA and ANSI B30.20 standards. Two safety swivel hooks and durable powder coat finish.Heavy-duty welded steel construction.GANTRY AND JIB CRANESNewUPPER BAILmodel SM-UBLOWER BAILmodel SM-LBMODELNUMBERMODELNUMBERMINIMUMSPREADOVERALLLENGTHMAXIMUMSPREADUPPER BAIL(W x L)UNIFORM CAPACITY(POUNDS)LOWER BAIL(W x L)HEADROOMNET WT.(POUNDS)UNIFORMCAPACITYNET WT.(LBS.)LIST PRICEEACHHEADROOMSBM-10-3 36" 11¼" 1,000 37 $389.00SBM-10-4 48" 11¼" 1,000 47 406.00SBM-10-6 72" 11¼" 1,000 91 414.00SBM-10-8 96" 11¼" 1,000 97 510.00SBM-10-10 120" 12¼" 1,000 200 592.00SBM-10-12 144" 12¼" 1,000 240 686.00SBM-20-3 36" 11¼" 2,000 50 $402.00SBM-20-4 48" 11¼" 2,000 75 433.00SBM-20-6 72" 12¼" 2,000 131 439.00SBM-20-8 96" 12¼" 2,000 148 559.00SBM-20-10 120" 13¼" 2,000 179 645.00SBM-20-12 144" 13¼" 2,000 242 750.00SBM-40-3 36" 14" 4,000 78 $439.00SBM-40-4 48" 15" 4,000 96 450.00SBM-40-6 72" 15" 4,000 156 540.00SBM-40-8 96" 16" 4,000 194 568.00SBM-40-10 120" 17" 4,000 270 655.00SBM-40-12 144" 17" 4,000 336 975.00SBM-60-3 36" 14" 6,000 78 $521.00SBM-60-4 48" 15" 6,000 78 541.00SBM-60-6 72" 17" 6,000 170 643.00SBM-60-8 96" 17" 6,000 225 735.00SBM-60-10 120" 18" 6,000 312 746.00SBM-60-12 144" 18" 6,000 395 1,173.00DC-20/FC-50Adjustable Spreader BeamsLift uneven loads and keep them level with increased safety. The Spreader Beam width rangesfrom 16" to 72" in 4" increments. Center clevis can be adjusted in 4" increments. Clevis slidesbetween two 5" channels. Meets ASME B30.20-1993 standard.LIST PRICEEACHSBM-25 8" 6' 2½" x 5" 1½" x 4½" 15¾" 2,500 153 $469.00SBM-40 16" 6' 3" x 5½" 2" x 4" 16¼" 4,000 165 591.00SBM-80 16" 8' 4" x 7¼" 3" x 5¼" 23¼" 8,000 330 897.00SM-LB-25 ADDITIONAL LOWER BAIL FOR SBM-25 20 $100.00SM-UB-25 ADDITIONAL UPPER BAIL FOR SBM-25 20 103.00SM-LB-40 ADDITIONAL LOWER BAIL FOR SBM-40 20 101.00SM-UB-40 ADDITIONAL UPPER BAIL FOR SBM-40 20 104.00SM-LB-80 ADDITIONAL LOWER BAIL FOR SBM-80 20 102.00SM-UB-80 ADDITIONAL UPPER BAIL FOR SBM-80 20 105.00DC-20/FC-50Heavy Duty Load LifterDesigned for lifting uneven awkward sized loads. Adjust bail position left or right by turning handcrank. Includes chains for connecting to load (connector links and hooks are not included). Foruse with overhead lifting device (sold separately). Steel construction with painted finish. Spread is20" wide from center to center of bars.NewMODELNUMBEROVERALL SIZE(W x H x D)CHAINLENGTHUNIFORMCAPACITY (LBS)NET WT.(LBS.)LIST PRICEEACHHDLL-15 26" x 9" x 2" 42" 1,500 14 $49.00DC-20/UPS/FC-70Spreader Beam Roll LifterAdjustable roll lifter utilizes your overhead hoist to position roll material. Core rod is 2½"diameter. Ideal when headroom is limited. Designed to meet ASME B30.20. Width is adjustableon 4" increments.MODELNUMBERMAXIMUMROLL LENGTHUNIFORMCAPACITY (LBS)NET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONSBRL-25 ROLL LIFTER 6 FT. 2,500 140 $725.00SBRL-40 ROLL LIFTER 6 FT. 4,000 280 882.00SBRL-80 ROLL LIFTER 8 FT. 8,000 450 1,225.00DC-20/FC-70Phone (800) 348-0868www.vestil.com
117Bar Stock <strong>Material</strong> PositionersOverhead bar-stock material lifter. Includes two adjustable-width lifting arms. Lifting arm widthis adjustable in 6" increments along entire span. Lifting arm usable height is 18" while the lengthis 12". Arms are sloped back for material retention. Features adjustable lifting bale for levelingload.MODELNUMBERMODELNUMBERMODELNUMBERMAXIMUMARM WIDTHOVERALL SIZE(W x D x H)SHEET SIZECAPACITYMINIMUMARM WIDTHLOADHEIGHTGRIPRANGEOVERALLLENGTHMAXIMUMHEIGHTUNIFORMCAPACITYUNIFORMCAPACITY (LBS)UNIFORMCAPACITYNET WT.(LBS.)NET WT.(LBS.)NET WT.(LBS.)LIST PRICEEACHMATL-72 72" 24" 78" 2,000 150 $795.00MATL-120 120" 24" 126" 2,000 280 1,395.00MATL-144 144" 24" 150" 2,000 320 1,595.00MATL-ARM EXTRA LIFTING ARM 35 $175.00DC-20/UPS/FC-70Slab LiftersConvert your fork truck (with swivel hook) or overhead lifting system into a rugged slab lifter in amatter of seconds. Designed to meet or exceed the needs of the building and stone industries. Ourinnovative slab lifter is becoming a leader in the next generation of lifters.LIST PRICEEACHSLV-30 7½" x 7½" x 21" 3/8" TO 1 3 /16" 2,646 49 $540.00SLV-40 8" x 7½" x 21" 3/8" TO 1 5 /8" 2,646 51 555.00SLV-50 8" x 8½" x 21" 3/8" TO 2" 2,646 51 568.00SLV-60 9" x 10" x 22" 5/8" TO 2 3 /8" 2,646 77 703.00DC-20/UPS/FC-70Glass LiftersDesigned for transporting glass sheets safely and securely with its fully automated jaws clampingon both sides, therefore the labor required is minimal. The four lower wheels of the lifter are usedto keep the lifter above the surface, away from any abrasive particles that may scratch the glass.The four upper wheels are used to create pressure between the surfaces and to guide the sheet upinto the clamp. The dual sided clamp distributes its pressure evenly across the material beinghandled. The additional layer of vulcanized rubber on the clamp allows for added grip as well aspreventing scratches on the material being handled.MODELNUMBEROVERALL SIZE(W x L x H)GRIPRANGEUNIFORMCAPACITYNET WT.(LBS.)LIST PRICEEACHGLL-28 9½" x 23 5 /8" x 24 5 /8" 1/8" to 1 /8" 1,320 57 $695.00GLL-38 10" x 29 1 /8" x 28" 1/8" to 1½" 1,650 73 825.00DC-20/FC-70Deluxe Drywall/Panel HoistHoist lifts panels for installation on ceilings or walls up to 11 feet high. Synchronized telescopingmast action for fast, and smooth raising/lowering action. Easy winch operated, with built-in brakemechanism and double cables to reduce fall hazards. This hoist is affordable but very dependablewith all welded steel and heavy duty construction. Dismantles to fit in the trunk of most cars, andhas a tail roller for easy maneuvering. 360 degree swivel cradle to load sheets or panels vertically orhorizontally.LIST PRICEEACHDPH-X-11 4' x 16' 34" 140" 150 120 $420.00DC-25/FC-70NewNewmodel GLL-28NewGANTRY AND JIB CRANESDrywall/Panel HoistHoist lifts panels for installation on ceilings or walls up to 11 feet high. Easy winch operated,with built-in brake mechanism. This hoist is affordable but very dependable with all weldedsteel and heavy duty construction. 360 degree swivel cradle to load sheets or panels vertically orhorizontally. Easy rolling casters make it a snap to roll into position.MODELNUMBERSHEET SIZECAPACITYLOADHEIGHTMAXIMUMHEIGHTUNIFORMCAPACITYNET WT.(LBS.)NewLIST PRICEEACHDPH-11 4' x 16' 12" 132" 140 120 $380.00DC-25/FC-70www.vestil.com Phone (800) 348-0868
118NewCrane Scales6V DC STANDARDAccuracy, quality, durability and affordable are key attributes of the Crane Scales. Our digital hangingscales offer fast and reliable weighing in a compact and durable housing. Designed to withstand themost aggressive and heavy duty industrial lifting applications. Features: hook and shackle, rechargeable6V battery, AC/DC power adapter, automatic shutoff and convertible gross/net weight display.Accuracy is +/- 1%. Other capacities, remote, double side display, low temp and high temp available.GANTRY AND JIB CRANESNewMODELNUMBERMODELNUMBER WIDTH LENGTH HEIGHT PULL FORCEMODELNUMBEROVERALL SIZE(W x D x H)BASE PLATE(W x L)UNIFORM FLATCAPACITY (LBS)UNIFORM ROUNDCAPACITY (LBS)NET WT.(LBS.)LIST PRICEEACHML-2 2½" x 5" x 6½" 2½" x 3¾" 200 100 6 $178.00ML-6 3½" x 8" x 7" 3½" x 6½" 600 300 22 412.00ML-12 4¾" x 11" x 10¾" 4¾" x 8¾" 1,200 600 53 592.00DC-25/UPS/FC-70MODELNUMBERSTRAIGHT LIFTUNIFORM CAPACITYOVERALL SIZE(W x D x H)WIDTH(INCHES)COLORCODEUNIFORMCAPACITYNET WT.(LBS.)NET WT.(LBS.)LENGTH OF SLINGSLIST PRICE EACHLIST PRICEEACHDESCRIPTIONSC-06 CRANE SCALES 7 5 /8" x 8" x 14" 600 24 $732.00SC-2 CRANE SCALES 7 5 /8" x 8" x 17" 2,000 33 826.00SC-4 CRANE SCALES 7 5 /8" x 8" x 17" 4,000 33 851.00SC-6 CRANE SCALES 7 5 /8" x 8" x 17" 6,000 33 922.00DC-25/UPS/FC-70Magnetic CatcherIdeal for picking up small metallic objects. To use simply move over objects. To deactivate squeezelever and the items will be released. Made of a hard plastic body with black steel handle.LIST PRICEEACHMLM-20 3 13 /16" 6" 8¼" 20 LBS. 4 $81.00DC-25/UPS/FC-77.5Magnetic LiftersPick up sheets of material by use of overhead crane or chain with the permanent MagneticLifter. Magnet is activated or deactivated by simply rotating the lever. Units are lightweight, sotransporting from work area to work area is convenient.Polyester Lifting Slings - Double PlyFor medium to heavy-duty lifting, these double-ply lifting slings are the practical, economicalanswer to many lifting problems. TYPE III style, with fabric ends, has flat tapered eyes at bothends and can be used for all hitch types. Double capacity when used basket-style. Reduce capacity20% when used chocker-style. These slings meet DIN-EN 1492-1, ANSI standard B30.9 andOSHA requirements.REINFORCED FABRIC LOOP ENDS - TYPE III 4 FT. 6 FT. 8 FT. 10 FT.SL-2-F-(length) 2,000 1 PURPLE 12.00 15.00 18.00 21.00SL-4-F-(length) 4,000 2 GREEN 19.00 28.00 36.00 45.00SL-6-F-(length) 6,000 3 YELLOW 28.00 36.00 50.00 54.00DC-25/UPS/FC-70Digital Load IndicatorsTake the guess work out of load measurement. This load indicator can accurately measure theweight. Simply incorporate this high tech gauge into your setup and read off the results. This isa strong, heavy duty tool which can withstand great weights and is exceedingly robust. Easy-toreaddisplay and easy to use. The load indicator is provided with LCD display which can tare aswell as show either the gross or the net load. Light weight, compact and ergonomic design. Idealfor difficult conditions: access or sloping ground. It can be used in conjunction with shackles andhooks. Automatic stand-by for a prolonged battery life time. Suitable for operation in ambienttemperatures of 14° through 104°F.MODELNUMBERUNIFORMCAPACITY(POUNDS)PRECISION(POUNDS)INDEXINGACCURACY(POUNDS)ACCURACYIN % OFNOMINAL LOADUNIFORM TESTCAPACITY(POUNDS)NET WT.(LBS.)LIST PRICEEACHDLI-05 500 4.4 1.1 0.20 1,100 2 $387.00DLI-1 1,000 9 1.1 0.10 2,200 2 393.00DLI-2 2,000 18 4.4 0.20 4,400 2 399.00DLI-4 4,000 33 11 0.25 8,800 5 432.00DLI-7 7,000 55 11 0.16 14,000 5 474.00DLI-14 14,000 110 22 0.16 28,000 6 516.00DC-20/UPSPhone (800) 348-0868www.vestil.com
119Lift Master BoomsUnique performance, convenience, and safety features are built intoevery Lift Master Boom. Fabricated from structural steel with weldingto meet AWS creates a rugged and durable boom that will providelong term service. Telescopic units come with an infinitely adjustablelocking screw (except orbit booms which feature a locking detent). Forkpockets for 4,000 pound uniform capacity models measure 7½"W x2½"H usable on 24" centers. Usable fork pockets are 7¼"W x 2¼"Hfor 6,000 and 8,000 pound uniform capacity models. Optional forkpocket centers available, contact factory; 11", 30" and 36". A 36"safety restraint secures the boom to the fork truck for safe operation.Each unit includes two lifting hooks. Overall width is 32" on 4,000 lb.units.MODELNUMBERTELESCOPING STYLEDESCRIPTIONOVERALLHEIGHTOVERALLEXTENDED LENGTHUNIFORMCAPACITYNET WT.(LBS.)DVD or VIDEOAVAILABLEORBITING BOOMmodel LM-OBT-4-24LIST PRICEEACHLM-1T-4-24 LIFT MASTER ONE 26" 153" 4,000 418 $928.00LM-OBT-4-24 ORBIT BOOM 28" 147" 4,000 416 1,312.00LM-HRT-4-24 HIGH-RISE BOOM 80" 94" 4,000 875 1,758.00LM-EBT-4-24 ECONOMY BOOM 13" 153" 4,000 370 730.00LM-F15-4-24 FIXED 15 DEGREES 24" 146" 4,000 410 840.00LM-1T-6-24 LIFT MASTER ONE 26" 153" 6,000 456 $1,259.00LM-OBT-6-24 ORBIT BOOM 28" 147" 6,000 458 1,644.00LM-HRT-6-24 HIGH-RISE BOOM 80" 94" 6,000 949 1,910.00LM-EBT-6-24 ECONOMY BOOM 13" 153" 6,000 443 1,062.00LM-1T-8-24 LIFT MASTER ONE 27" 153" 8,000 656 $1,563.00LM-OBT-8-24 ORBIT BOOM 29" 146" 8,000 734 2,354.00LM-EBT-8-24 ECONOMY BOOM 12" 152" 8,000 568 1,364.00NON-TELESCOPING STYLELM-1NT-4-24 LIFT MASTER BOOM 25" 82" 4,000 403 $801.00LM-OBNT-4-24 ORBIT BOOM 27" 81" 4,000 558 1,140.00LM-HRNT-4-24 HIGH-RISE BOOM 79" 51" 4,000 627 1,145.00LM-EBNT-4-24 ECONOMY BOOM 13" 82" 4,000 258 565.00LM-1NT-6-24 LIFT MASTER ONE 25" 82" 6,000 478 $1,131.00LM-OBNT-6-24 ORBIT BOOM 27" 81" 6,000 628 1,413.00LM-HRNT-6-24 HIGH-RISE BOOM 79" 51" 6,000 697 1,421.00LM-EBNT-6-24 ECONOMY BOOM 13" 82" 6,000 291 896.00LM-1NT-8-24 LIFT MASTER ONE 24" 80" 8,000 595 $1,433.00LM-OBNT-8-24 ORBIT BOOM 26" 80" 8,000 792 2,107.00LM-EBNT-8-24 ECONOMY BOOM 12" 81" 8,000 620 1,196.00LARGER FORK POCKETS 8¼"W x 4¼"H (inside dimensions), model LM-FP, $184.00 LISTDC-25/FC-70FIXED 15° BOOMmodel LM-F15-4-24HIGH-RISE BOOMmodel LM-HRT-4-24LIFT MASTER BOOMmodel LM-1T-4-24ECONOMY BOOMmodel LM-EBT-4-24NewShorty Lift Master BoomsShort boom length is ideal for tight areas. Choose either telescoping or non-telescoping design. Includesbuilt-in fork pockets and safety restraint. Overall width is 32". Steel construction with powder coat finish.MODELNUMBERMODELNUMBERHOOKTYPEDESCRIPTIONHEIGHTW/O HOOKOVERALLHEIGHTOVERALLWIDTHOVERALLLENGTHUNIFORMCAPACITYUNIFORMCAPACITYNET WT.(LBS.)NET WT.(LBS.)LIST PRICEEACHLMS-EBT-46-4 TELESCOPING 13" 53 7 /8" to 94 3 /8" 4,000 248 $658.00LMS-EBT-46-6 TELESCOPING 13" 53 7 /8" to 94 3 /8" 6,000 280 956.00LMS-EBT-46-8 TELESCOPING 12" 52½" to 93" 8,000 430 1,228.00LMS-EBNT-40-4 NON-TELESCOPING 13" 50 7 /8" 4,000 190 $509.00LMS-EBNT-40-6 NON-TELESCOPING 13" 50 7 /8" 6,000 230 806.00LMS-EBNT-40-8 NON-TELESCOPING 12" 49½" 8,000 380 1,077.00Hook PlatesHook Plates enable any fork truck to safely lift a load using chains, cables, or slings. Features slantedfork openings measuring 6¼" wide by 1¾" high to prevent the hook plate from being used upsidedown. A hook with anchor shackle is included.DC-25/FC-70LIST PRICEEACHLM-HP4-S SWIVEL 6" 24" 4,000 26 $117.00LM-HP4-R RIGID 6" 24" 4,000 26 110.00LM-HP6-S SWIVEL 6" 24" 6,000 27 $139.00LM-HP6-R RIGID 6" 24" 6,000 27 133.00DC-25/UPS/FC-70LIFT MASTER BOOMmodel LM-1T-8NON-TELESCOPINGECONOMY BOOMmodel LM-EBNT-4-24NON-TELESCOPINGSHORTY BOOMmodel LMS-EBNT-40-4FORK TRUCK ATTACHMENTSwww.vestil.com Phone (800) 348-0868
FORK TRUCK ATTACHMENTS120SINGLE FORKseries S-FORKFORK TRUCK BASEseries HOOK-BASE(shown with optionalRigid Hook)PINTLE HOOKmodel PINTLEPhone (800) 348-0868DOUBLE FORKseries D-FORKNewSINGLE FORKAUTO-TENSIONseries S-FORK-4-ATFORK TRUCK BASEseries HOOK-BASE(shown with optionalPintle Hook & Tow Ball)TOW BALLSseries BALLSWIVEL HOOKWITH SHACKLEseries HOOKHoisting HooksConvert your fork truck into a hook with anchor in a matter of seconds. The easy to attach HoistingHook does not require the assistance of special tools. Secured to the fork truck by means of a 36"long safety restraint and screw clamps. Available in single or double fork design. Units are zinc plated.Hook with shackle included. Model S-FORK-4-AT, Auto-Tension Hoisting Hook, offers a uniquedesign and adds tension as weight is added.MODELNUMBERMODELNUMBERDESCRIPTIONHOOK TYPEUSABLE FORKPOCKET SIZE (W x H)UNIFORMCAPACITYUNIFORMCAPACITY (LBS)NET WT.(LBS.)NET WT.(LBS.)LIST PRICEEACHS-FORK-4/6-R SINGLE FORK/RIGID 6" x 2¼" 4,000 15 $82.00S-FORK-4/6-S SINGLE/SWIVEL 6" x 2¼" 4,000 15 89.00D-FORK-4-R DOUBLE/RIGID 6 13 /16" x 2½" 4,000 41 $184.00D-FORK-4-S DOUBLE/SWIVEL 6 13 /16" x 2½" 4,000 41 193.00D-FORK-10-S DOUBLE/SWIVEL 6 13 /16" x 3½" 10,000 46 $341.00S-FORK-4-AT SWIVEL, SINGLE AUTO-TENSION 5½" x 1 7 /8" 4,000 16 $153.00DC-25/UPS/FC-70Fork Truck Bases with Optional Tow Balls & Pintle HookConvert your fork truck into a tow truck for moving trailers and other portable equipment. Simpledesign slides onto forks and secures into place with safety pins. Welded steel construction withpowder coat blue finish. Optional pintle hook, tow balls, and lifting hooks (see below) available.Bolt on design.MODEL NUMBERDESCRIPTIONFORKLENGTHLENGTH TOCENTER OF BALLUNIFORMCAPACITYNET WT.(LBS.)LIST PRICEEACHHOOK-BASE-32 FORK BASE 36" 32" 4,000 84 $331.00HOOK-BASE-38 FORK BASE 42" 38" 4,000 100 354.00HOOK-BASE-44 FORK BASE 48" 44" 4,000 118 375.00MODEL NUMBERDESCRIPTIONBALLDIAMETERSHANKDIAMETERUNIFORMCAPACITYNET WT.(LBS.)LIST PRICEEACHBALL-178 TOW BALL 1 7 /8" 1" 2,000 3 $6.60BALL-200 TOW BALL 2" 1" 5,000 3 7.00BALL-2516 TOW BALL 2 5 /16" 1" 5,000 4 7.90MODEL NUMBERDESCRIPTIONJAW UNIFORMOPENING VERTICAL CAPACITYUNIFORM TRAILERCAPACITY (LBS.)NET WT.(LBS.)LIST PRICEEACHPINTLE PINTLE HOOK 1¾" 2,000 10,000 12 $75.00DC-25/UPS/FC-70Hooks with ShackleEasily connects to Hoisting Hooks, Hook Plates or Booms. Available in swivel or rigid styles. Varietyof capacities available. Forged steel construction.LIST PRICEEACHDESCRIPTIONHOOK-S-4 SWIVEL HOOK WITH CLEVIS 4,000 4 $27.10HOOK-S-6 SWIVEL HOOK WITH CLEVIS 6,000 7 32.80HOOK-S-10 SWIVEL HOOK WITH CLEVIS 10,000 9 110.70HOOK-R-4 RIGID GRAB HOOK WITH CLEVIS 4,000 4 $11.20DC-25/UPS/FC-70Fork Truck Floor ScraperDesigned to turn your fork truck into a floor scraper. Works well in paint and finish rooms forremoving over sprayed paint from floors. Simply slide fork into opening and attach safety restraintto carriage for safety. Features hardened scraping blade for long life and durability. Blade is mountedin pivot assembly to allow it to raise up with contact against a crack or rise in the floor. Heavy-dutywelded steel construction. Painted finish.MODELNUMBERMODELNUMBERBLADEWIDTHOVERALL SIZE(W x L x H)GROUNDCLEARANCEUSABLE FORKOPENING (W x H)SWEEPWIDTHOVERALLWIDTHNET WT.(LBS.)NET WT.(LBS.)LIST PRICEEACHSCRAPE-1 12" 13" x 36" x 8" 9¼" x 3¼" 145 $376.00DC-20/FC-70Hanging Magnetic SweepersSimply hang it from your vehicle and sweep your entire road or parking lot clean of tire damagingmaterial. Constructed with heavy gauge steel and aluminum. Each unit contains powerful ceramicmagnets that are protected by an aluminum shell. Comes completely assembled. Includes eyeboltsfor hanging from a vehicle and pockets for fork truck use.LIST PRICEEACHDESCRIPTIONHMS-36 LOAD RELEASE 1½" to 3¾" 36" 36" 38 $264.00HMS-48 LOAD RELEASE 1½" to 3¾" 48" 48" 48 339.00HMS-60 LOAD RELEASE 1½" to 3¾" 60" 60" 62 412.00DC-20/UPS/FC-85www.vestil.com
Fork Truck Mounted Brush SweepersFork Truck Brush Sweepers are ideal for interior and exterior commercial sweeping. Great forcleanup applications; docks, warehouses, and parking lots. Lightweight aluminum body withpolypropylene bristles. Red powder coat finish. Attach unit by sliding forks into pockets andsecuring with locking screws. Optional Dust Mop attaches to sweep fine material on polished floors.Fits both 48" and 60" sweeping width.MODELNUMBEROVERALL SIZE(W x D x H)FORK POCKET(W x D x H)SWEEPINGWIDTHBRISTLELENGTHNET WT.(LBS.)LIST PRICEEACHVSWP-48 48" x 9" x 12" 5" x 7¼" x 2" 48" 8" 44 $511.00VSWP-60 60" x 9" x 12" 5" x 7¼" x 2" 60" 8" 51 629.00VSWP-48-RB 48" REPLACEMENT BRUSH KIT (5 ROWS TO A KIT) 18 $174.00VSWP-60-RB 60" REPLACEMENT BRUSH KIT (5 ROWS TO A KIT) 20 209.00VSWP-60-DM OPTIONAL DUST MOP ATTACHMENT 10 116.00DC-20/UPS/FC-70Coil Rams/LiftersThe Coil Lifter is used to easily maneuver many types of coiled material. The Coil Lifters are availablein both class II carriage mount and fork mount. To accommodate multiple core sizes and capacities,units can be ordered with either a 4½" or 5-9/16" diameter ram pole. Sturdy steel constructionand painted blue. Fork mounted units feature 7½" wide x 2½" tall (usable) fork pockets. Carriagemounted units are class II with a spring loaded lock pin to secure the unit to fork truck carriage.MODELNUMBERMODEL POLENUMBER LENGTHFORK MOUNTED - INVERTEDPOLEDIAMETERPOLEDIAMETERCARRIAGECLASSCARRIAGECLASSUNIFORMCAPACITYUNIFORMCAPACITYNET WT.(LBS.)NET WT.(LBS.)LIST PRICEEACHLENGTHFORK MOUNTED - INVERTEDCCF-24-4 24" 4½" N/A 3,000 265 $462.00CCF-36-4 36" 4½" N/A 3,000 275 479.00CCF-48-4 48" 4½" N/A 3,000 290 505.00CCF-60-4 60" 4½" N/A 3,000 305 534.00CCF-24-5 24" 5 9 /16" N/A 5,500 300 $523.00CCF-36-5 36" 5 9 /16" N/A 5,500 315 550.00CCF-48-5 48" 5 9 /16" N/A 5,500 325 567.00CCF-60-5 60" 5 9 /16" N/A 5,500 345 606.00CARRIAGE MOUNTED - CLASS IICCM-24-4 24" 4½" 2 3,000 150 $261.00CCM-36-4 36" 4½" 2 3,000 160 279.00CCM-48-4 48" 4½" 2 3,000 175 317.00CCM-60-4 60" 4½" 2 3,000 190 336.00CCM-24-5 24" 5 9 /16" 2 5,500 185 $323.00CCM-36-5 36" 5 9 /16" 2 5,500 200 360.00CCM-48-5 48" 5 9 /16" 2 5,500 217 381.00CCM-60-5 60" 5 9 /16" 2 5,500 230 403.00DC-25/FC-70Rug Rams/Carpet PolesTransport rolls of carpet with our sturdy Rug Rams/Carpet Poles. Available in either carriageor fork mounted styles. 2¾" diameter high strength, rotatable, replaceable pole has taperedtip. All units are made of steel construction and painted blue.Fork Mounted Rug Rams feature 7½" wide by 2½" high usable fork pockets on 24" centers.Safety restraint is included to secure unit to fork truck.Carriage Mounted Rug Rams are available in class II or III and feature a spring loaded lockingpin to secure them to the carriage.LIST PRICEEACHCRP-108 108" 2¾" N/A 2,500 526 $1,140.00CRP-120 120" 2¾" N/A 2,200 550 1,342.00CRP-144 144" 2¾" N/A 1,800 570 1,386.00FORK MOUNTEDCRF-108 108" 2¾" N/A 2,500 500 $1,127.00CRF-120 120" 2¾" N/A 2,200 525 1,314.00CRF-144 144" 2¾" N/A 1,800 545 1,366.00CARRIAGE MOUNTED - CLASS IICR-108-2 108" 2¾" 2 2,500 397 $617.00CR-120-2 120" 2¾" 2 2,200 421 638.00CR-144-2 144" 2¾" 2 1,800 478 734.00CARRIAGE MOUNTED - CLASS IIICR-108-3 108" 2¾" 3 2,500 402 $627.00CR-120-3 120" 2¾" 3 2,200 428 650.00CR-144-3 144" 2¾" 3 1,800 490 747.00DC-25/FC-70FORK MOUNTEDseries CRFwww.vestil.com Phone (800) 348-0868121FORK MOUNTED - INVERTEDseries CCFCARRIAGE MOUNTEDseries CCMFORK MOUNTED - INVERTEDseries CRPCARRIAGE MOUNTEDseries CRFORK TRUCK ATTACHMENTS
122FORK TRUCK ATTACHMENTSNewSTANDARD LOOP STYLEPIN STYLE • Suffix PADD $61.00 LISTREAR SPACER • Suffix RSADD $56.00 LISTHOT DIPPED GALVANIZED FINISH SHOWN.OTHER SPECIALTY FINISHES AVAILABLE,CONTACT FACTORY.TRIANGULAR STYLESuffix TPhone (800) 348-0868ROUND STYLESuffix RFork ExtensionsProvide the extra support needed to lift long or large objects with a fork truck. Welded steel constructionwith cast steel tips. Steel retaining strap (loop style*) prevents fork extensions from sliding off forksduring use. Powder coat yellow finish. OSHA regulations require that extensions are no morethan 150% of the existing fork length. (e.g. 48" existing forks, the fork extension should notexceed 72"). Maximum uniform capacity is 4,000 lbs. evenly distributed per pair.Loop Style: Insert loop at the tip of the fork and slide it up at a 45° angle. Then, lay it down over the existing fork.Pin Style (suffix P): Remove pin and lay extension over fork or drive fork truck into the extension.Re-insert the pin behind the heel of the fork to secure extension.Rear Spacer (suffix RS): Insert the loop at the tip of the fork and slide it up at a 45° angle. Then, lay it downover the existing forks. Load pallets into rear of trailer conveniently and easily. Practical for pushing palletstwo or three deep into a trailer.MODELNUMBERMODELNUMBERACCOMMODATESFORK WIDTHFORK EXTENSIONINSIDE WIDTHDESCRIPTIONLENGTHMAXIMUM FORKTHICKNESSBUMPER SIZE(W x H)NET WT.PAIR (LBS.)NET WT.(POUNDS)LIST PRICEPER PAIRFE-4-48 4" 4½" 48" 2" 101 $228.00FE-4-54 4" 4½" 54" 2" 109 236.00FE-4-63 4" 4½" 63" 2" 125 247.00FE-4-72 4" 4½" 72" 2" 135 267.00FE-4-84 4" 4½" 84" 2" 157 287.00FE-4-90 4" 4½" 90" 2" 163 295.00FE-4-96 4" 4½" 96" 2" 173 303.00FE-4-108 4" 4½" 108" 2" 200 326.00FE-4-120-P 4" 4½" 120" 2" 224 522.00FE-5-48 5" 5½" 48" 2" 112 $236.00FE-5-54 5" 5½" 54" 2" 126 247.00FE-5-63 5" 5½" 63" 2" 151 257.00FE-5-72 5" 5½" 72" 2" 155 277.00FE-5-84 5" 5½" 84" 2" 189 297.00FE-5-90 5" 5½" 90" 2" 195 308.00FE-5-96 5" 5½" 96" 2" 201 318.00FE-5-108 5" 5½" 108" 2" 225 339.00FE-5-120-P 5" 5½" 120" 2" 256 536.00FE-6-48 6" 6½" 48" 2½" 121 $263.00FE-6-54 6" 6½" 54" 2½" 146 280.00FE-6-63 6" 6½" 63" 2½" 165 291.00FE-6-72 6" 6½" 72" 2½" 166 318.00FE-6-84 6" 6½" 84" 2½" 199 347.00FE-6-90 6" 6½" 90" 2½" 202 360.00FE-6-96 6" 6½" 96" 2½" 210 373.00FE-6-108 6" 6½" 108" 2½" 225 408.00FE-6-120-P 6" 6½" 120" 2½" 275 551.00SUFFIX "P" FEATURES A PIN LOCKRound or Triangular Fork ExtensionsMODELNUMBERACCOMMODATESFORK WIDTHFORK EXTENSIONINSIDE WIDTHMAX. FORKTHICKNESSNET WT.PAIR (LBS.)DC-25/UPS/FC-65Ideal for moving around large rolls of material. Available in round or triangular style. Powder coat yellowfinish. To install, insert loop at the tip of the fork and slide it up at a 45° angle. Then, lay it down over thefork. OSHA regulations require that extensions do not exceed the length of the fork by more than 150%.LIST PRICEPER PAIRLENGTHROUND EXTENSIONSFE-4-54-R 4" 4½" 54" 2" 140 $445.00FE-4-63-R 4" 4½" 63" 2" 162 466.00FE-5-54-R 5" 5½" 54" 2" 166 458.00FE-5-63-R 5" 5½" 63" 2" 185 481.00TRIANGULAR EXTENSIONSFE-4-54-T 4" 4½" 54" 2" 146 $445.00FE-4-63-T 4" 4½" 63" 2" 162 466.00FE-5-54-T 5" 5½" 54" 2" 166 458.00FE-5-63-T 5" 5½" 63" 2" 185 481.00DC-25/UPS/FC-65Fork Truck Carriage BumperProtect loads from potential damage with our Fork Truck Carriage Bumper. Simply bolt to forklift class IIcarriage with included hardware.LIST PRICEEACHFCB-818 FORK TRUCK CARRIAGE BUMPER 8" x 18" 28 $110.00DC-25/UPS/FC-55www.vestil.com
123Polyethylene Fork Blade ProtectorsPrevent damage to packages and skids from sharp edges of fork truck forks with our blunt endFork Blade Protectors. Hide unsightly scratches and gouges on your forks as well. Constructedfrom lightweight 100% polyethylene material. Simply slide over forks. Held in place with steelcable.MODELNUMBERMODELNUMBERMODELNUMBERACCOMMODATESFORK WIDTH WIDTH LENGTHOVERALL SIZE(W x D x H)USABLE SIZE(W x H) CASTERSMAXIMUM FORKTHICKNESSMINIMUMFORK EXTENSION LENGTHUNIFORMCAPACITY (LBS)NET WT./PAIR(POUNDS)NET WT.(POUNDS)NET WT.(LBS.)LIST PRICEPER PAIRVFP-42 4" 4½" 42" 2" 6 $80.00VFP-48 4" 4½" 48" 2" 6 80.00VFP-42-GRN 4" 4½" 42" 2" 6 $80.00VFP-48-GRN 4" 4½" 48" 2" 6 80.00DC-25/UPS/FC-150Fork Extension Storage RackInstall or remove fork extensions without lifting, pushing, or getting off the fork truck. Easy touse: A) Drive in so tips of forks are over elevated bar. B) Lower forks until they nest in channel inbase of rack. C) Back fork truck out of fork retraining straps. Fork extensions not included.LIST PRICEEACHFORK-R-54 40" x 46" x 54" 60" 135 $303.00DC-25/FC-70Fork Truck Fork CaddyTransport fork truck forks easily and safely. This caddy allows the user to easily remove and installforks onto a fork truck. This is usually a dangerous and time consuming process, but our forkcaddy makes this a breeze.After transporting the fork to the fork truck, rotate the handle 90°. Slide the fork onto the mast.The Fork Caddy has easy-grip handles and rolls smoothly on two swivel casters. A locking screwsecures the fork into the caddy to keep it in place while transporting. The comfort-grip handlepivots up to 180° to allow for easier mobility. The Fork Caddy is lightweight and small enoughfor easy storage as well.LIST PRICEEACHFC-29 7½" x 2½" 3" x 1" SWIVEL 2,000 29 $282.00DC-25/UPS/FC-70Forged Steel ForksChange your current fork length or buy an extra pair of forks for an emergency with our ForgedSteel Forks. Forks are 4" wide each. Designed for class II carriage mounting and includes lockpin. Meets I.T.A. standards.vestilgreenNewAFTERBEFOREMODELNUMBERLENGTH(INCHES)THICKNESS(INCHES)UNIFORMCAPACITY (LBS.)NET WT./PAIR(POUNDS)LIST PRICEPAIRF4-1.25-36 36 1¼ 3,000 191 $302.00F4-1.25-48 48 1¼ 3,000 222 351.00F4-1.50-36 36 1½ 4,000 224 $355.00F4-1.50-42 42 1½ 4,000 249 395.00F4-1.50-48 48 1½ 4,000 268 426.00F4-1.50-60 60 1½ 4,000 308 489.00F4-1.75-36 36 1¾ 5,000 251 $399.00F4-1.75-42 42 1¾ 5,000 277 438.00F4-1.75-48 48 1¾ 5,000 299 473.00F4-1.75-60 60 1¾ 5,000 392 548.00DC-25/FC-50Pallet CanopyUnload pallets in the rain, snow, or sleet. The Pallet Canopy will keep your incoming or outgoingproducts in great condition. The all steel roof measures 50" wide by 60" long. The clearancebetween the forks and the canopy is 51". Individual fork width is 6". The canopy slides ontoforks of a fork truck and is secured with a safety restraint.MODELNUMBEROVERALL SIZE(W x L x H)FORK SIZE(W x L)UNIFORMCAPACITY (LBS)NET WT.(POUNDS)LIST PRICEEACHCANOPY-5060 50" x 60" x 63" 30" x 60" 4,000 275 $657.00DC-25/FC-70FORK TRUCK ATTACHMENTSwww.vestil.com Phone (800) 348-0868
124NewFork Truck Snow PlowUnique design attaches to fork truck forks. Pass through forktubes keep weight back towards fork truck mast. Locking pinssecure snow plow to forks for safety. Manual pivot mechanismfor angled plowing on both sides. Floating pads allow foradjustment of plowing height. Adjustable springs allow blade topivot back for safety. Steel construction with painted finish.MODELNUMBERNET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONSPB-N-72 FORK TRUCK SNOW PLOW WITH 72" WIDE BLADE 530 $2,150.00SPB-N-WT OPTIONAL WEIGHT FOR BETTER PLOWING PERFORMANCE 45 $389.00DC-20/FC-70NewFork Mounted Snow Plow BladesDesigned for use with your fork truck, these Snow Plow Blades are multifunctional to work withyour existing equipment. No more waiting for daytime snow removal. Simply place the snow bladeonto your fork truck and away you go! Installation is as easy as sliding the forks into the fork pocketsand securing them to the fork carriage. Prevent damage from obstacles and uneven surfaces withtrip springs. Easy angling and backgrade capabilities for optimal performance. Constructed of 5/16"rollplate with steel ribs on back. The blade edge is 5/8" x 6" hardened steel. Optional counterbalanceshipped empty.MODELNUMBEROVERALLPLOW WIDTHPLOW WIDTHAT 24° ANGLEPLOW WIDTHAT 47° ANGLEMAXIMUM FORKWIDTH x LENGTHNET WT.(POUNDS)LIST PRICEEACHSPB-548 6 FEET 66" 48" 5½" x 48" 561 $3,540.00SPB-748 6 FEET 66" 48" 7½" x 48" 572 3,578.00SPB-556 7 FEET 76" 56" 5½" x 48" 585 $3,652.00SPB-756 7 FEET 76" 56" 7½" x 48" 594 3,690.00SPB-CB COUNTERBALANCE (estimated weight filled 500 lbs.) 40 $555.00DC-20/FC-70Fork Mounted Front LoaderThe Front Loader is engineered for use with your existing fork truck. “Dust Pan” design isideal for transporting snow, gravel, sand, or refuse. Pull release cable to dump contents ofscoop. Attaches quickly and easily to most fork trucks. Beveled front edge for better scoopingability. The usable fork pockets measure 7½" wide by 2½" high on 24" centers. All welded steelconstruction with durable powder coat finish.MODELNUMBEROVERALL SIZE(W x D x H)UNIFORMCAPACITYDUMPANGLECUBIC YD.CAPACITYNET WT.(POUNDS)LIST PRICEEACHFL-4000-N 48" x 63½" x 22¼" 4,000 90° 1 470 $1,242.00FL-4000 69¾" x 63½" x 22¼" 4,000 90° 1 /3 552 1,449.00FL-LEKP WELDED LEAK PROOF OPTION 5 $304.00DC-20/FC-70FORK TRUCK ATTACHMENTSPhone (800) 348-0868model SPREAD-2model SPREAD-3Shown with optional Fork Mount Attachment<strong>Material</strong> SpreadersTough thermoplastic hopper spreads material up to 25 feet wide (fixed). Hitch mount standard.SPREAD-2 is a multi-purpose spreader with a welded steel material auger for free flowingmaterial; rock salt. Includes a 2" receiver tube. 12 volt DC motor.SPREAD-3 is an accurate flow spreader with precision material gate system for free flowing finematerial; ice melters, fertilizers, seed, insecticides, and pellets. Includes 2" receiver, completewiring, and on/off switch. 12 volt DC motor. 10" steel spinner with steel spring agitator.Adjustable metering gate with positive stop for quick return to original calibration setting.MODELNUMBERSPREADINGWIDTHOVERALL SIZE(W x D x H)UNIFORM CUBICFT. CAPACITYUNIFORMCAPACITYNET WT.(LBS.)LIST PRICEEACHSPREAD-2 25' 30½" x 21" x 29" 2.7 180 60 $1,065.00SPREAD-3 25' 30½" x 21" x 29" 2.7 180 60 1,065.00SPREAD-FT OPTIONAL FORK MOUNT ATTACHMENT(8"W x 2¼"H USABLE FORK POCKETS)10 $305.00DC-20/UPS/FC-70www.vestil.com
125Battery Powered Dump Trash CanDumper and ContainerOne person with a fork truck can safely and easily dump drums into ahopper. DC powered operation with on-board battery charger. Raisetime is 10 seconds and lowered time is 8 seconds. Dump height is 55".A 2 cubic yard Vestil “D” style hopper is available separately to collecttrash. Custom configurations can be made for most trash containers.24V DC POWER STANDARDNewMODELNUMBEROVERALL SIZE(W x L x H)UNIFORMCAPACITY (LBS)NET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONT-HOP DUMPER 37" x 103½" x 60" 400 500 $1,795.00D-200-LD HOPPER 56½" x 61" x 52" 2,000 725 $889.00DC-20/FC-70Fork Truck Mounted Trash Can DumperSave time and reduce work-related injuries caused by lifting and dumping heavy waste containers.This innovative product will allow a fork truck driver to lift and dump refuse containers weighingup to 1,000 lbs. without ever leaving the seat of the fork truck! Secure dumper to fork truck withsafety chain and run cable to driver's seat. Align trash can with dumper and lock into place. Oncelocked in place, transport trash can to refuse container, align, and pull chain to dump refusecontainer contents. Only for use with 64 gallon trash can, series TH-64 or approved equal. Forkpockets are 2¼" high by 7¼" wide usable. Steel construction for years of dependable use.DVD or VIDEOAVAILABLEMODELNUMBERMODELNUMBERDESCRIPTIONFORK POCKETS(W x H)FORKLENGTHOVERALL SIZE(W x L x H)OVERALLWIDTHUNIFORMCAPACITY (LBS)UNIFORMCAPACITY (LBS)NET WT.(POUNDS)NET WT.(LBS.)LIST PRICEEACHFM-T-DUMP DUMPER 41" x 42" x 43" 1,000 lbs. 234 $917.00TH-64-GY TRASH CAN 23" x 29" x 41" 64 gal. 26 $84.60DC-25/FC-70Trash Can DumperLift, carry, and dump trash cans without leaving the seat of your fork truck. Simple design does nothave any moving parts. Includes sloped guides to center container as it rotates. Adjustable pick-uphooks adjust from 12" to 16". Fork pockets measure 4¾" wide x 2" high on 31¾" centers. Weldedsteel construction is powder coated blue.MODELNUMBEROVERALL SIZE(W x L x H)UNIFORMCAPACITY (LBS)NET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONTCD-FM-E DUMPER 36½" x 58½" x 7½" 500 lbs. 120 $290.00TH-64-GY TRASH CAN 23" x 29" x 41" 64 gal. 26 $84.60DC-25/FC-70Pallet Dumper/RetainerDump loaded pallets easily without leaving the seat of your fork truck with the all welded steelPallet Dumper. Unit slides onto forks and is secured by a safety restraint. Two retainers hold thepallet in place while dumping the contents into a hopper or dumpster. Once the retainershave cleared the opposite end of the pallet, raise the forks and the retainers will holdthe pallet on the forks. Lift the pallet to the dumping height and rest the pallet onthe edge of the dumpster. Pull the chain, releasing the fork carriage,allowing the pallet to tilt and dump the load into the hopper ordumpster. When finished, simply lower to the ground until thecarriage latches.LIST PRICEEACHPAL-D/R 7½" x 2½" 52" 32" 2,000 300 $530.00DC-25/FC-70Loading Platform for Fork TruckAllows fork trucks to load/unload items into trucks and trailers. Usable platformsize 54" x 54". Maximum uniform weight capacity is 2,000 lbs. (dependenton fork truck capacity). Includes 12" lip to help with transition. Side guardtoeboards are 6" high. Fork truck fork pockets are 7½"W x 2½"H usable. Fourtie-down rings are included for securing equipment (tie downs not included).Checker plate floor for extra traction. Steel construction with blue painted finish.FTLP-5454MODELNUMBERDESCRIPTIONNET WT.(POUNDS)LIST PRICEEACHFTLP-5454 FORK TRUCK LOADING PLATFORM 300 $775.00FTLP-5454-HR* FORK TRUCK LOADING PLATFORM W/OPTIONS 410 $963.00*FEATURES HANDRAIL ON TWO SIDES, BACK MESH SCREEN & CHAINSDC-25/FC-70RETAINERADJUSTABLEHOOKSwww.vestil.com Phone (800) 348-0868NewNewFTLP-5454-HRDVD or VIDEOAVAILABLEFORK TRUCK ATTACHMENTS
FORK TRUCK ATTACHMENTS126SINGLE SIDE DOOR ENTRYseries WPPIN STYLE TINE LOCKIS STANDARDPhone (800) 348-0868DVD or VIDEOAVAILABLEDUAL SIDE DOOR ENTRY16" Wide Doorsseries WP-DDWork PlatformsConvenient fork truck work platforms quickly and safely raise maintenance personnel where theyare needed. Attaches to fork truck by inserting forks into fork pockets and securing platform tofork truck. Tine lock must be engaged to secure platform to forks. 42" high handrail with 21"high mid-rail on three sides. 60" high expanded metal backing on fourth side (84" high backingto meet California OSHA specifications on models with suffix -84B). Includes checker floorplate platform and 36" long strap with hook to attach platform to fork truck. The usable forkpockets are 7¾"W x 3⅞"H in rear and 7¾"W x 1⅞"H in front. A maximum of two people canbe in the work platform at one time. Uniform weight capacity is 1,000 lbs. evenly distributed.Welded steel construction. Powder coat finish. The Full Featured units include an EmergencyStop Button Kit and Web Lanyard with Safety Harness.PLATFORMSIZE (W x L)FORK POCKETCENTERSEXPANDEDMETAL BACKNET WT.(POUNDS)LIST PRICEEACHMODEL NUMBERSINGLE SIDE DOOR ENTRYWP-3636 36" x 36" 16" 60" 200 $550.00WP-3648 36" x 48" 16" 60" 230 606.00WP-4848 48" x 48" 24" 60" 260 739.00WP-4848-FF 48" x 48" 24" 60" 295 1,223.00(FULL FEATURED)WP-3636-84B 36" x 36" 16" 84" 246 $708.00WP-3648-84B 36" x 48" 16" 84" 259 766.00WP-4848-84B 48" x 48" 24" 84" 300 900.00WP-4848-84B-FF 48" x 48" 24" 84" 316 1,378.00(FULL FEATURED)DUAL SIDE DOOR ENTRYWP-3636-DD 36" x 36" 16" 60" 234 $565.00WP-3648-DD 36" x 48" 16" 60" 247 624.00WP-4848-DD 48" x 48" 24" 60" 288 761.00WP-4848-DD-FF 48" x 48" 24" 60" 304 1,260.00(FULL FEATURED)WP-3636-84B-DD 36" x 36" 16" 84" 246 $730.00WP-3648-84B-DD 36" x 48" 16" 84" 259 789.00WP-4848-84B-DD 48" x 48" 24" 84" 300 925.00WP-4848-84B-DD-FF 48" x 48" 24" 84" 316 1,419.00(FULL FEATURED)SEE THE FOLLOWING PAGE FOR OPTIONSStockpicker Work PlatformDC-25/FC-85/150Elevate personnel and pallets to overhead racks and shelving for safe and convenient access.Accommodates one person and a 42" long pallet. Attaches to fork truck by inserting forks intofork pockets and securing platform to fork truck. Pin style tine lock standard. 42" high handrailwith 21" high mid-rail on two sides. 60" high expanded metal backing on fourth side (84" highbacking to meet California OSHA specifications). Includes checker floor plate platform and 36"long chain with hook to attach platform to fork truck. Usable fork pocket size is 7½"W x 2½"H.Welded steel construction. Powder coat finish.MODELNUMBERPLATFORMSIZE (W x L)FORK POCKETCENTEREXPANDEDMETAL BACKUNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHSP-175 30" x 20" 22¼" 60" 4,000 185 $684.00SP-175-84B 30" x 20" 22¼" 84" 4,000 190 837.00SEE THE FOLLOWING PAGE FOR OPTIONSDC-25/FC-85/150Fold Down Work PlatformElevate personnel to overhead racks and shelving for safe and convenient access. When not in use,unit can be folded down and moved out of the way by just one person. Unit stores convenientlyin a 4" deep bottom base, with an overall height of 11⅝". Handrail is 38" high with 23½" highmid-rail on three sides. 60" high expanded metal backing on fourth side (84" high backing tomeet California OSHA specifications on models with suffix -84B). Includes checker floor plateplatform, tine lock, and a safety restraint to attach platform to fork truck. Usable fork pocketsmeasure 7⅞"W x 3⅜"H on 27¾" centers. The overall size of the unit is 38"W x 38"L x 81½"H.Folded size is 38"W x 38"L x 11⅝"H. Powder coat yellow finish. Steel construction.MODELNUMBERPLATFORMSIZE (W x L)FORK POCKETCENTEREXPANDEDMETAL BACKUNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHWP-3737-FD 37" x 37" 27¾" 81½" 1,000 175 $758.00WP-3737-FD-84B 37" x 37" 27¾" 89" 1,000 195 924.00OPTIONAL 4" x 2" CASTERS (2 RIGID & 2 SWIVEL), model WP-CAFD, $112.00 LISTDC-25/FC-85/150www.vestil.com
127Work Platform Options4" x 1¼" Poly <strong>Casters</strong>,model WP-CA, allowsyou to move unitwithout the use of afork truck.WORK PLATFORM OPTIONSNET WT.(POUNDS)LIST PRICEEACHMODEL NUMBERDESCRIPTIONWP-CA (4) 4" x 1¼" POLY CASTERS (INCLUDES FOUR) 24 $82.00WP-SB EMERGENCY STOP BUTTON KIT 9 326.00WP-SB-FTJB EMERGENCY STOP FORK TRUCK JUNCTION BOX ONLY 4 149.00WP-SB-WPJB EMERGENCY STOP WORK PLATFORM JUNCTION BOX ONLY 5 178.00WP-TC STEEL FLUORESCENT TUBE CADDY 12 $46.00WP-P-TC POLYETHYLENE FLUORESCENT TUBE CADDY 15 68.00WP-TT36 SLIDING TOOL TRAY (FOR 36"W WORK PLATFORM) 6 45.00WP-TT48 SLIDING TOOL TRAY (FOR 48"W WORK PLATFORM) 10 55.00WP-AFR AUTOMATIC FOLD DOWN RAMP (16" LONG WITH 16° INCLINE) 276 841.00WP-WS ADDITIONAL CAUTION SIGNS WITH MOUNTING HARDWARE 2 $23.60WP-DL DOUBLE CHAIN DOOR LOCK 2 35.00DC-25LANYARD WITH SAFETY HARNESSCAPACITY(POUNDS)LENGTH OFLANYARDNET WT.(POUNDS)LIST PRICEEACHMODEL NUMBER DESCRIPTION SIZE WAIST SIZEWP-LH-S HARNESS SMALL SEE BELOW 350 6 FEET 6 $233.00WP-LH-M HARNESS MEDIUM SEE BELOW 350 6 FEET 6 233.00WP-LH-L HARNESS LARGE SEE BELOW 350 6 FEET 6 233.00WP-LH-XL HARNESS X-LARGE SEE BELOW 350 6 FEET 6 233.00WP-LH-XXL HARNESS XX-LARGE SEE BELOW 350 6 FEET 6 295.00WP-LH-XXXL HARNESS XXX-LARGE SEE BELOW 350 6 FEET 6 295.00HARNESS SIZING CHARTCHEST SIZEHEIGHT34" - 36" 38" - 40" 42" - 44" 46" - 48" 50" - 54" 56" - 60"SMALL (5'4" to 5'7") SMALL SMALL MEDIUM LARGE X-LARGE XX-LARGEREGULAR (5'8" to 5'11") SMALL MEDIUM LARGE X-LARGE XX-LARGE XXX-LARGETALL (6'0" to 6'3") MEDIUM MEDIUM LARGE X-LARGE XX-LARGE XXX-LARGEEXTRA TALL (6'3" PLUS) LARGE LARGE X-LARGE X-LARGE XX-LARGE XXX-LARGEDC-25/UPSMODELNUMBERVOLUMECUBIC YARDSEmergency Stop ButtonKit, model WP-SB, allowsthe operator to shut off forktruck power from the workplatform. Works with bothgas and electric fork trucks.Poly Industrial Tilt TrucksUNIFORMCAPACITY (LBS)OVERALL SIZE(W x D x H)Fluorescent Tube Caddy,model WP-TC, holdsfluorescent light bulbsand other maintenanceequipment.Poly industrial tilt trucks save time, money, and worker effort. This large capacity and one pieceseamless rotationally molded unit features a slanted front for easy dumping. Rust resistantpowder coated frame for strength and durability. Standard color is grey. Lids are available,contact factory. Additional colors of blue, green, red, white, and yellow are available.NET WEIGHT(POUNDS)LIST PRICEEACHITT-50-LD 1/2 300 23" x 52" x 36" 70 $445.00ITT-50-MD 1/2 750 23" x 52" x 36" 75 590.00ITT-50-HD 1/2 1,200 23" x 52" x 36" 80 692.00ITT-100-LD 1 750 31" x 67" x 42" 100 $538.00ITT-100-MD 1 1,000 31" x 67" x 42" 125 734.00ITT-100-HD 1 2,000 31" x 67" x 42" 130 835.00ITT-150-LD 1½ 1,000 43" x 81" x 49" 145 $918.00ITT-150-MD 1½ 1,800 43" x 81" x 49" 155 1,115.00ITT-150-HD 1½ 2,300 43" x 81" x 49" 165 1,225.00ITT-200-LD 2 1,000 47" x 83" x 51" 215 $1,083.00ITT-200-MD 2 1,800 47" x 83" x 51" 225 1,272.00ITT-200-HD 2 2,300 47" x 83" x 51" 250 1,365.00DC-20/FC-200Sliding Tool Tray, seriesWP-TT, available in36" or 48" wide. Holdsmaintenance tools.Web Lanyard withSafety Harness, seriesWP-LH, protects workerin the event of a fall.Automatic Fold DownRamp, series WP-AFR,allows you to roll toolboxes on and off theWork Platform. Rampautomatically rises whenthe unit is lifted off theground and lowers whenwork platform is lowered.Option comes standardwith a front chain gate.www.vestil.com Phone (800) 348-0868NewPoly Tube Caddy, seriesWP-P-TC, will not rust,scratch, or dent.NewFORK TRUCK ATTACHMENTS
128FULL 90°DUMP ANGLEHeight from the Front Lip to theFloor on "H" series HoppersH-25.........................................14"H-50.........................................21"H-100 ......................................21"H-150 ...................................30¾"DVD or VIDEOAVAILABLELow Profile 90° Self-Dumping Steel HoppersUnits feature a full 90° dump angle with a cushioned rubber bumper stop. The low profile design isessential for convenient loading. Dumping with a fork truck is quick and simple. A cable is pulled fromthe seat of the fork truck to dump the hopper. The unit returns to an upright and locked position whenlowered to the ground. A safety restraint is provided to secure the hopper to the fork truck. 22"L usablefork pockets measure 7"W x 2"H. Formed base thickness is ¼". Optional Adjustable Dump SpeedDampener sold separately, see page 129. Powder coat blue finish.MODELNUMBERVOLUMECUBIC YARDSUNIFORMCAPACITYOVERALL SIZE(W x D x H)FORK POCKETCENTERSNET WT.(POUNDS)LIST PRICEEACHLIGHT DUTY • 12 GAUGE STEELH-25-LD 1/4 2,000 25" x 46" x 18" 11 5 /8" 219 $487.00H-50-LD 1/2 2,000 25" x 51¼" x 28" 11 5 /8" 256 555.00H-100-LD 1 2,000 49" x 51¼" x 28" 21 5 /8" 347 $662.00H-150-LD 1-1/2 2,000 49" x 52" x 40" 21 5 /8" 377 757.00MEDIUM DUTY • 10 GAUGE STEELH-25-MD 1/4 4,000 25" x 46" x 18" 11 5 /8" 229 $509.00H-50-MD 1/2 4,000 25" x 51¼" x 28" 11 5 /8" 276 581.00H-100-MD 1 4,000 49" x 51¼" x 28" 21 5 /8" 395 $679.00H-150-MD 1-1/2 4,000 49" x 52" x 40" 21 5 /8" 463 839.00HEAVY DUTY • 8 GAUGE STEELH-25-HD 1/4 6,000 25" x 46" x 18" 11 5 /8" 216 $535.00H-50-HD 1/2 6,000 25" x 51¼" x 28" 11 5 /8" 279 612.00H-100-HD 1 6,000 49" x 51¼" x 28" 21 5 /8" 462 $757.00H-150-HD 1-1/2 6,000 49" x 52" x 40" 21 5 /8" 540 955.00DC-25/FC-200Self-Dumping Steel Hoppers with Bumper ReleaseHopper automatically dumps when bumper release contacts the side of the dumpster. Hopper returnsto an upright and locked position automatically after it dumps. Also includes a cable that may beoperated from the seat of the fork truck to manually dump the hopper. A safety restraint is providedto secure the hopper to the fork truck. Usable fork pockets are 7½"W x 2½"H. Optional leak proofdesign sold separately, see page 130. D-33, D-50, D-75 and D-100 are stackable if you stack the tophopper turned 90° from the bottom. Powder coat blue finish. Options on page 129.FORK TRUCK ATTACHMENTSBUMPER RELEASEDVD or VIDEOAVAILABLEPhone (800) 348-0868MODELNUMBERVOLUMECUBIC YDS.USABLE CHUTE SIZE(W x D* x H)OVERALL SIZE(W x D x H)FORK POCKETCENTERSNET WT.(LBS.)LIST PRICEEACHLIGHT DUTY • 12 GAUGE STEEL • 2,000 LB. UNIFORM CAPACITYD-25-LD 1/4 20" x 41¼" x 27 7 /8" 26" x 52" x 38" 18" 360 $546.00D-33-LD 1/3 20" x 41¼" x 27 7 /8" 26" x 52" x 38" 18" 375 $568.00D-50-LD 1/2 30" x 41¼" x 27 7 /8" 33¼" x 52" x 38" 18" 410 611.00D-75-LD 3/4 28¼" x 54½" x 32½" 31½" x 60½" x 43" 18" 480 $648.00D-100-LD 1 38" x 54¼" x 32½" 41¼" x 61" x 42 5 /8" 18" 524 704.00D-150-LD 1½ 40" x 63¾ x 41½" 43¼" x 61" x 52" 28" 630 $838.00D-200-LD 2 53" x 63¾" x 41½" 56¼" x 61" x 52 3 /8" 28" 725 889.00D-250-LD 2½ 66¼" x 63¾" x 41½" 69½" x 69" x 52" 28" 760 $1,007.00D-300-LD 3 78 3 /16" x 63¾" x 41½" 81 7 /16" x 61" x 50¾" 28" 975 1,439.00MEDIUM DUTY • 10 GAUGE STEEL • 4,000 LB. UNIFORM CAPACITYD-25-MD 1/4 20" x 41¼" x 27 7 /8" 26" x 52" x 38" 18" 385 $571.00D-33-MD 1/3 20" x 41¼" x 27 7 /8" 26" x 52" x 38" 18" 390 $587.00D-50-MD 1/2 30" x 41¼" x 27 7 /8" 33¼" x 52" x 38" 18" 420 637.00D-75-MD 3/4 28¼" x 54½" x 32½" 31½" x 60½" x 43" 18" 525 $678.00D-100-MD 1 38" x 54¼" x 32½" 41¼" x 61" x 42 5 /8" 18" 625 781.00D-150-MD 1½ 40" x 63¾ x 41½" 43¼" x 61" x 52" 28" 670 $916.00D-200-MD 2 53" x 63¾" x 41½" 56¼" x 61" x 52 3 /8" 28" 730 946.00D-250-MD 2½ 66¼" x 63¾" x 41½" 69½" x 69" x 52" 28" 795 $1,225.00D-300-MD 3 78 3 /16" x 63¾" x 41½" 81 7 /16" x 61" x 50¾" 28" 991 1,529.00HEAVY DUTY • 8 GAUGE STEEL • 6,000 LB. UNIFORM CAPACITYD-25-HD 1/4 20" x 41¼" x 27 7 /8" 26" x 52" x 38" 18" 410 $595.00D-33-HD 1/3 20" x 41¼" x 27 7 /8" 26" x 52" x 38" 18" 420 605.00D-50-HD 1/2 30" x 41¼" x 27 7 /8" 33¼" x 52" x 38" 18" 455 $662.00D-75-HD 3/4 28¼" x 54½" x 32½ 31½" x 60½" x 43" 18" 560 707.00D-100-HD 1 38" x 54¼" x 32½" 41¼" x 61" x 42 5 /8" 18" 620 $858.00D-150-HD 1½ 40" x 63¾ x 41½" 43¼" x 61" x 52" 28" 745 994.00D-200-HD 2 53" x 63¾" x 41½" 56¼" x 61" x 52 3 /8" 28" 778 $1,142.00D-250-HD 2½ 66¼" x 63¾" x 41½" 69½" x 69" x 52" 28" 890 1,343.00D-300-HD 3 78 3 /16" x 63¾" x 41½" 81 7 /16" x 61" x 50¾" 28" 991 $1,595.00D-350-HD 3½ 88¼" x 63¾" x 41½" 92" x 69" x 52" 28" 1110 1,664.00* DEPTH DIMENSION IS MEASURED AT TOP OF CHUTE DC-25/FC-200www.vestil.com
Heavy-Duty Poly Lids for Self-Dumping HoppersKeep the contents of hoppers out of sight for a cleaner appearance with our newHopper Covers. Constructed from heavy-duty virgin polyethylene material, theselids are lightweight and easy to open. The top of the lid includes a crown forwater drainage and a ribbed design for strength and aesthetics. Ideal for schools,hospitals, and warehouses. Factory installed when ordered with hopper. May alsobe easily field installed. Standard color is black.MODELNUMBERUSE WITHSIZEUSE WITHSTYLENUMBEROF PIECESNET WT.(LBS.)LIST PRICEEACHPLID-H-25 1/4 H 1 7 $97.00PLID-H-50* 1/2 H 1 8 118.00PLID-H-100* 1 H 2 14 131.00PLID-H-150* 1-1/2 H 2 16 167.00PLID-D-33 1/3 D 1 7 $97.00PLID-D-50 1/2 D 1 8 118.00PLID-D-75 3/4 D 1 9 125.00PLID-D-100 1 D 1 10 131.00PLID-D-150 1-1/2 D 1 14 167.00PLID-D-200 2 D 2 16 176.00PLID-D-250 2-1/2 D 2 18 199.00PLID-D-300 3 D 2 20 222.00*WORKS WITH PORTABLE HOPPERSDC-20/UPS/FC-100/250SPECIFY COLOR BY ADDING THE SUFFIX TO THE ABOVE PART NUMBER;RED suffix RD; BLUE suffix BU; YELLOW suffix YL; STANDARD COLOR IS BLACKSpecialty Colors for Self-Dumping HoppersIdentify your hopper quickly and easily with our universal color codes.Contact factory for pricing.MODELNUMBER COLOR DESCRIPTIONSPO-PC-SR RED HAZARDSPO-PC-WHT WHITE PAPERSPO-PC-GY-SG GREY METALSPO-PC-GRN-T GREEN ORGANICSPO-PC-BL BLUE PLASTICSPO-PC-YEL YELLOW GLASSSPO-PC-ORG-C ORANGE HIGH VISIBILITYSPO-PC-HD-GALV GALVANIZED WET ENVIRONMENTMODELNUMBERCASTERSIZEUNIFORMCAPACITYCASTERDESCRIPTIONQTY. PERORDERNET WT.(LBS.)LIST PRICEPER SETHOP-SC6-2 6" x 2" 4,800 SEMI-STEEL 4 33 $164.00HOP-SC8-2 8" x 2" 4,800 SEMI-STEEL 4 42 181.00HOP-RC6-2 6" x 2" 2,400 MOLD-ON-RUBBER 4 28 $164.00HOP-RC8-2 8" x 2" 2,400 MOLD-ON-RUBBER 4 37 181.00HOP-PC6-2 6" x 2" 4,800 POLY-ON-STEEL 4 33 $210.00HOP-PC8-2 8" x 2" 4,800 POLY-ON-STEEL 4 42 234.00HOP-PHC6-2 6" x 2" 4,800 GLASS FILLED NYLON 4 37 $165.00HOP-PHC8-2 8" x 2" 4,800 GLASS FILLED NYLON 4 54 190.00HOP-SC6-2.5 6" x 2½" 6,000 STEEL 4 65 $335.00WEIGHT OF HOPPER MUST BE CONSIDERED WHEN CALCULATING USABLE CAPACITY DC-20/UPS/FC-65/100MODELNUMBERVARIETY OFCOLORS AVAILABLEPADLOCK NOT INCLUDED<strong>Casters</strong> for Self-Dumping HoppersTransport loads with portable hoppers. When casters are ordered with hopper, quick-install caster padsare factory-welded to the base of the hopper. The casters are then shipped uninstalled to prevent freightdamage. <strong>Casters</strong> not ordered with the hopper will need to have a caster pad welded in place by thecustomer. The ¼ and ½ cubic yard "H" series hoppers only include three casters - two rigid and oneswivel. The maximum weight capacity is the lowest weight capacity of either the hopper or the casters.NET WT.(LBS.)LIST PRICEEACHDESCRIPTIONH-DAMP-4 MORE CONTROLLED DUMPING PROCESS (4,000 LB. UNITS) 30 $584.00H-DAMP-6 MORE CONTROLLED DUMPING PROCESS (6,000 LB. UNITS) 40 774.00H-LEKP WELDED LEAK PROOF OPTION FOR "H" STYLE HOPPER 5 $145.00H-DPLG 2" THREADED DRAIN PLUG, LOCATED IN LEFT CORNER 2 204.00LUG (4) LIFTING LUGS (WELDED) ONE ON EACH CORNER 150 294.00DC-20series PLID-Hwww.vestil.com Phone (800) 348-0868NewOptions for "H" Style HoppersModel H-DAMP, features a pressure compensated flow control to reduce the speed the chuterotates when the release lever is pulled. Does not allow you to stop at any point along dump cycle.New129series PLID-DHOPPER LID OPTIONSContact factory for more detailsSIDE-LOADCONTAINERSEMI-STEELPOLY-ON-STEELREAR-LOADCONTAINERDRAIN PLUGFRONT-LOADCONTAINERMOLD-ON-RUBBERGLASS FILLED NYLONNewFORK TRUCK ATTACHMENTS
130Newmodel D-TILTOptions for "D" Style HoppersSideways Tilt Option, model D-TILT, can be used with D-75 and D-100 hoppers only. Usermust obtain written permission from fork truck manufacturer prior to use. Factory or fieldinstalled. May still use hopper like normal. Adds 3¼" to height.MODELNUMBERNET WT.(LBS.)LIST PRICEEACHDESCRIPTIOND-TILT SIDEWAYS TILT OPTION 130 $290.00D-LEKP WELDED LEAK PROOF OPTION FOR "D" STYLE HOPPER 5 $187.00D-DPLG 2" THREADED DRAIN PLUG, LOCATED IN LEFT CORNER 2 204.00LUG (4) LIFTING LUGS (WELDED) ONE ON EACH CORNER 150 $294.00DC-20SIDEWAYS TILT OPTIONDRAIN PLUGPortable Steel HoppersPortable Steel Hoppers make handling waste and bulk material safer and more convenient. Forktruck entry tubes are designed to move hopper over rough terrain. Usable fork pockets are7"W x 2"H on 21⅝" centers (11⅝" fork pocket centers for ½ cubic yard capacity model only).Foot operated caster lock is included. Units tilt with assistance from operator. Handle for dumpingcontents. Must be attached to fork truck when dumping. Welded construction makes themdurable. Powder coat blue finish.DVD or VIDEOAVAILABLEMODELNUMBERVOLUMECUBIC YARDSUNIFORMCAPACITYOVERALL SIZE(W x D x H)GAUGEOF STEELNET WT.(LBS.)LIST PRICEEACHP-HOP-0.5 1/2 2,000 34 13 /16" x 52¼" x 37 5 /8" 12 251 $630.00P-HOP-1 1 2,000 58 13 /16" x 52 7 /8" x 37 3 /8" 12 393 680.00P-HOP-1.5 1-1/2 2,000 58 13 /16" x 53 3 /8" x 49 3 /8" 12 461 712.008" x 2" PHENOLIC CASTERS, TWO RIGID AND TWO SWIVEL STANDARD DC-20/FC-200FORK TRUCK ATTACHMENTSNewPortable Steel Hopper with Power Traction DriveReduce worker fatigue and injury with this 1/3 cubic yard Power Traction Drive Hopper. Thisfactory installed option makes portable equipment easy to maneuver with its 240° turning radius,handle grip/throttle, and auto reverse. This state-of-the-art option allows a single operator toperform tasks safely and ergonomically. Includes built-in electric drive motor and DC batterywith on-board charger. Maximum speed is 3 mph. Hopper and fork pockets are included. Forkpockets are 7½"W x 2½"H usable on 18" centers.MODELNUMBERMODELNUMBERVOLUMECUBIC YDS.UNIFORMCAPACITYVOLUME UNIFORMCUBIC YARDS CAPACITYOVERALL SIZE(W x D x H)OVERALL SIZE(W x D x H)USABLE CHUTE SIZE(W x D* x H)USABLE SIZE(W x D x H)NET WT.(LBS.)NET WT.(LBS.)LIST PRICEEACHHOP-PTD 1/3 1,500 26" x 54" x 44¼" 20" x 41¼" x 27 7 /8" 691 $3,032.00* DEPTH DIMENSION IS MEASURED AT TOP OF CHUTE DC-20/FC-200Low Profile Parts Hopper24V DC POWER STANDARDThis unique product has been designed to function as a parts hopper that may be dumpedwith the assistance of a fork truck. The low profile design allows the hopper to be placedunderneath machinery as a catch basin for parts. The newly designed hopper reduces the hazards,inconveniences, and time associated with collecting parts off the floor.This ½ cubic yard, 10 gauge parts hopper has 7"W x 2"H usable fork pockets on 7¾" centersfor dumping the hopper 90° with a fork truck. Unit rolls smoothly on 4" x 2" phenolic casters,two rigid and two swivel, and includes a 34" high removable push handle. Once the material isdumped, the hopper will return to the locked position when lowered to the ground.LIST PRICEEACHHOP-LP-N 1/3 2,000 30" x 54¼" x 34" 29½" x 49½" x 13½" 244 $527.00HOP-LP 1/2 2,000 48½" x 54¼" x 33½" 48" x 37" x 13½" 384 634.00DC-20/FC-200Phone (800) 348-0868www.vestil.com
131Low Profile HoppersLow profile design (only 22" high) allows for use under machinery and conveyors. Tapered sideallows for easy loading and unloading. Designed for containment of scrap, chips, and waste.Constructed of welded 14-gauge steel for strength and lighter weight. Unit rolls smoothly on(2) rigid and (2) swivel 5" x 2" poly-on-steel casters. 37" high push handle is removable andmay be used at either end. Industrial grade blue powder coat finish.NewMODELNUMBERVOLUMECUBIC YARDSVOLUMECUBIC FEETUNIFORMCAPACITYOVERALL SIZE(W x D x H)NET WT.(LBS.)LIST PRICEEACHSLPT-24 1/4 6.9 1,000 26¼" x 42" x 37" 100 $519.00SLPT-33 1/3 9.6 1,000 30¼" x 54" x 37" 115 582.00DC-20/FC-200Portable Steel Dump TrucksEasily move and empty contents with a balanced design making dumping of scrap, chips, andwaste easier. Constructed of welded 14-gauge (12-gauge on model SPTT-15) steel for strengthand lighter weight. Unit rolls smoothly on (2) rigid and (2) swivel 5" x 2" poly-on-steel casters.Industrial grade blue powder coat finish.NewMODELNUMBERVOLUMECUBIC YARDSVOLUMECUBIC FEETUNIFORMCAPACITYOVERALL SIZE(W x D x H)NET WT.(LBS.)LIST PRICEEACHSPTT-05 2/3 18 1,000 26¼" x 56 9 /16" x 36" 184 $632.00SPTT-10 1 27 1,500 38¼" x 56 9 /16" x 36" 225 710.00SPTT-15 1-1/2 40 2,000 38¼" x 63 5 /8" x 46" 339 862.00DC-20/FC-200Open Ended Steel Dumping HopperReduce bending and lifting motions while loading items into a hopper. This hopper will allowfor convenient and orderly loading at ground level with its open front design. Flat items canbe loaded so more can be put into the hopper. Rolls smoothly on 4" x 2" phenolic casters, thehopper can easily be moved from one location to another. Once the hopper is full or the userhas finished loading, the hopper can be easily dumped with the use of a fork truck.MODELNUMBERUNIFORMCAPACITYOVERALL SIZE(W x D x H)USABLE SIZE(W x D x H)NET WT.(POUNDS)LIST PRICEEACHHOP-OE 2,000 54½" x 64 11 /16" x 53 11 /16" 51¾" x 60" x 48¼" 725 $1,203.00DC-20/FC-200Steel Chute HoppersUnit is designed for use in areas with limited space. Fixed-position hopper features a fullheightfront door that opens to dump the hopper contents. Door will automatically close andlock after contents have been dumped. Front door is opened with a release cable that may beoperated from a safe distance. Units may be moved with assistance from a fork truck. Usablefork pockets measure 7½"W x 2½"H on 30" centers. Safety restraint is attached for securingunit to the carriage of the fork truck. Not for use with fine grain or high density materials.Welded steel construction with blue painted finish.MODELNUMBERVOLUMECUBIC YARDSUNIFORMCAPACITYOVERALL SIZE(W x D x H)GAUGEOF STEELNET WT.(LBS.)LIST PRICEEACHC-HOP-200 2 2,000 57½" x 57" x 67½" 7 912 $1,166.00C-HOP-300 3 2,000 82½" x 57" x 67½" 7 1062 1,234.00DC-20/FC-200Fabric HoppersThese hoppers provide an economical and convenient means for storing and moving dry bulkcommodities. The coated polypropylene has a polyester webbing for extra strength. The 8 oz.white fabric is UV tested. Fold for easy storage when not in use. The four corner straps provideconvenient forklift handling.MODELNUMBERVOLUMECUBIC FEETUNIFORMCAPACITYBASE SIZE(W x L)OVERALLHEIGHTNET WT.(LBS.)LIST PRICEEACHFAB-H-45 40 3,300 36" x 36" 45" 5 $36.80FAB-H-55 50 3,300 36" x 36" 55" 6 39.70FAB-H-63 78 3,300 42" x 42" 63" 8 49.90DC-25/UPSwww.vestil.com Phone (800) 348-0868NewFORK TRUCK ATTACHMENTS
132FORK TRUCK ATTACHMENTSNewSteel Lid Style ASteel Lid Style CPhone (800) 348-0868NewSHOWN WITHOPTIONAL CASTERSSteel Self-Dumping HoppersAll welded self-dumping hoppers handle bulk materials and scrap easily. Must transport and dumpwith a forklift or make the unit mobile with the optional casters. Self dumping hoppers are engineeredto dump when the safety latch is tripped and to return to an upright locked position when empty.All units come with safety retaining chain and a trip rope assembly. The 1/4 to 2 cubic yard hoppershave a formed stackable base (8 gauge ¼ - 2½ LD to MD and ¾ - 2½ HD is .220 gauge), the 3 to5 cubic yard hoppers have structural bases (¼" base) nonstackable with re-enforced rockers for heavyuse. Options include: casters, lids (1 to 2½ cubic yard), 3-way entry, lifting lugs, and paint colors.Standard paint finish is vista green.STACKABLE STEEL SELF-DUMPING HOPPERSMODELNUMBERVOLUMECUBIC YARDSUNIFORMCAPACITYOVERALL SIZE(W x D x H)GAUGEOF STEELNET WT.(LBS.)LIST PRICEEACHHOP-100-LD 1 2,000 41½" x 62" x 37" 12 440 $671.00HOP-150-LD 1-1/2 2,000 59½" x 62" x 37" 12 560 790.00HOP-200-LD 2 2,000 59½" x 66" x 46" 12 600 878.00HOP-250-LD 2-1/2 2,000 59½" x 66" x 51" 12 630 911.00HOP-100-MD 1 4,000 41½" x 62" x 37" 10 500 $738.00HOP-150-MD 1-1/2 4,000 59½" x 62" x 37" 10 600 862.00HOP-200-MD 2 4,000 59½" x 66" x 46" 10 700 964.00HOP-250-MD 2-1/2 4,000 59½" x 66" x 51" 10 730 1,010.00HOP-25-HD 1/4 4,000 30¾" x 46" x 26½" 7 385 $598.00HOP-33-HD 1/3 4,000 30¾" x 48½" x 31½" 7 420 627.00HOP-50-HD 1/2 4,000 41½" x 48½" x 31½" 7 490 713.00HOP-75-HD 3/4 4,000 41½" x 56¾" x 35½" 7 595 806.00HOP-100-HD 1 6,000 41½" x 62" x 37" 7 620 845.00HOP-150-HD 1-1/2 6,000 59½" x 62" x 37" 7 805 1,005.00HOP-200-HD 2 6,000 59½" x 64" x 46" 7 900 1,129.00HOP-250-HD 2-1/2 6,000 59½" x 64" x 51" 7 1105 1,241.00HOP-300-HD* 3 6,000 65½" x 71½" x 59½" 7 1279 1,796.00HOP-400-HD* 4 6,000 85½" x 71½" x 59½" 7 1445 1,990.00HOP-500-HD* 5 6,000 105½" x 71½" x 59½" 7 1605 2,166.00*SPECIAL CASTER BASE FOR CASTER OPTION, MODEL HOP-CASTER-BASE, $641.00 (-20%)DC-20/FC-200SPECIALTY STEEL LIDS FOR HOPPERS (SERIES HOP only)MODELNUMBERHOPPERCUBIC YARDSSPECIFY LID STYLE(add suffix to model #)DESCRIPTIONOF STYLESLID-100 1 A or C STYLE "A" - Single hinge inthe center of the hopper withthe back half welded closedNET WT. LIST PRICE(LBS.) EACH65 $202.00LID-150 1-1/2 A or C 92 250.00LID-200 2 A or C STYLE "C" - Single hinge in 106 $280.00LID-250 2-1/2 A or C the center, but both front and 139 295.00back lids can be opened.Chip & Waste Trucks• Heavy-Duty Reinforced Steel Construction • Ideal for Clean Up & Other <strong>Material</strong> <strong>Handling</strong> JobsSturdy Chip and Waste Trucks are ideal for collecting and transporting bulk materials or trash.Tapered ends allow easy loading and dumping. Hopper is balanced to maneuver and dump withless effort. All welded 14 gauge steel construction with industrial welds. Optional leak proof seamsavailable. Painted finish.MODELNUMBERVOLUMECUBIC FEETUNIFORMCAPACITYOVERALL SIZE(W x L x H)CASTERSIZENET WT.(LBS.)LIST PRICEEACHCHIP-17.5 17.5 1,500 26" x 67" x 37½" 10" x 2½" 200 $606.00CHIP-22.2 22.2 2,000 32" x 67" x 37½" 10" x 2½" 245 741.00CHIP-26.7 26.7 2,000 38" x 67" x 37½" 10" x 2½" 265 788.00DC-20/FC-200Bulk ContainersThis rugged container maximizes shipping, handling, and storage efficiencies. These units stackthree high and safely accommodate up to 700-800 lbs. of uniform solid, pourable, granular, andnon-regulated material. Molded nesting "lugs" or "ribs" prevent units from jamming together. Allare available in a wide variety of colors and with optional permanent, molded-in or raised graphicsand logos. Caster and custom options available, contact factory.MODELNUMBERVOLUMECUBIC FEETUNIFORMCAPACITYOVERALL SIZE(W x L x H)CASTERSIZENET WT.(LBS.)LIST PRICEEACHMHBC-3244 27.5 700 45" x 45" x 33" NONE 95 $350.00MHBC-4444 35 800 45" x 45" x 45½" NONE 118 415.00MHBC-3244-5C 27.5 700 45" x 45" x 39" 5" 105 $495.00MHBC-4444-5C 35 800 45" x 45" x 51½" 5" 128 565.00DC-20/FC-250www.vestil.com
Rolling Warehouse LaddersFinally an easy and safe solution for reaching products on high shelves. Each ladder includesan exclusive lockable safety gate that keeps children and unauthorized personnel off theladder. Pushing the gate forward will raise the casters off the floor and allow for safe access tothe ladder. Pulling the gate backwards will lower the casters to the floor, prohibit access to theladder and allow the ladder to be moved.Each ladder is rated at 350 pounds uniform capacity. The standard climb angle is 58° (contactfactory for pricing on optional 50° Easy-Climb angle). The handrail height is 30" from thesteps and 34" around the top platform that includes a 4" toeboard. Each step is 24" wide by7" deep. Choose either grip strut style or perforated style steps. Front wheels are 10" diameter.Side frame is constructed from heavy-duty formed steel and offers maximum strength. Uniquedesign allows ladder to separate for shipping and storage. Welded steel construction withpowder coat finish. Manufactured in compliance with OSHA and ANSI A14.7 standards.Order optional Sideways Wheel Option for even more ladder maneuverability. This optionwill allow the ladder to turn within its own length and be pushed sideways against shelvingunits. Factory-installed.133INDUSTRIAL LADDERSGRIP STRUT STEPSMODEL NUMBERNUMBER OF STEPSTOP STEPHEIGHTOVERALLHEIGHTBASE SIZE(W x D)TOP STEPDEPTHNET WT.(POUNDS)LIST PRICEEACHLAD-6-10-G 6 60" 97" 33" x 47" 10" 130 $543.00LAD-7-10-G 7 70" 107" 33" x 53" 10" 144 565.00LAD-8-10-G 8 80" 117" 33" x 59" 10" 160 588.00LAD-9-10-G 9 90" 127" 33" x 65" 10" 174 610.00LAD-10-10-G 10 100" 137" 33" x 72" 10" 188 633.00LAD-11-10-G 11 110" 147" 33" x 78" 10" 237 981.00LAD-12-10-G 12 120" 157" 43" x 84" 10" 253 $1,006.00LAD-13-10-G 13 130" 167" 43" x 91" 10" 269 1,029.00LAD-14-10-G 14 140" 177" 44" x 97" 10" 285 1,052.00LAD-15-10-G 15 150" 187" 44" x 103" 10" 301 1,076.00LAD-16-10-G 16 160" 197" 44" x 109" 10" 317 1,100.00LAD-6-20-G 6 60" 97" 33" x 57" 20" 164 $607.00LAD-7-20-G 7 70" 107" 33" x 63" 20" 179 629.00LAD-8-20-G 8 80" 117" 33" x 69" 20" 194 653.00LAD-9-20-G 9 90" 127" 33" x 75" 20" 209 675.00LAD-10-20-G 10 100" 137" 33" x 82" 20" 223 697.00LAD-11-20-G 11 110" 147" 33" x 88" 20" 275 1,061.00LAD-12-20-G 12 120" 157" 43" x 94" 20" 290 $1,071.00LAD-13-20-G 13 130" 167" 43" x 101" 20" 307 1,095.00LAD-14-20-G 14 140" 177" 44" x 107" 20" 323 1,119.00LAD-15-20-G 15 150" 187" 44" x 113" 20" 339 1,141.00LAD-16-20-G 16 160" 197" 44" x 119" 20" 356 1,167.00PERFORATED STEPSLAD-6-10-P 6 60" 97" 33" x 47" 10" 135 $554.00LAD-7-10-P 7 70" 107" 33" x 53" 10" 150 579.00LAD-8-10-P 8 80" 117" 33" x 59" 10" 167 604.00LAD-9-10-P 9 90" 127" 33" x 65" 10" 182 629.00LAD-10-10-P 10 100" 137" 33" x 72" 10" 197 654.00LAD-11-10-P 11 110" 147" 33" x 78" 10" 247 1,006.00LAD-12-10-P 12 120" 157" 43" x 84" 10" 264 $1,030.00LAD-13-10-P 13 130" 167" 43" x 91" 10" 281 1,057.00LAD-14-10-P 14 140" 177" 44" x 97" 10" 298 1,082.00LAD-15-10-P 15 150" 187" 44" x 103" 10" 315 1,109.00LAD-16-10-P 16 160" 197" 44" x 109" 10" 332 1,134.00LAD-6-20-P 6 60" 97" 33" x 57" 20" 169 $619.00LAD-7-20-P 7 70" 107" 33" x 63" 20" 185 643.00LAD-8-20-P 8 80" 117" 33" x 69" 20" 201 669.00LAD-9-20-P 9 90" 127" 33" x 75" 20" 217 694.00LAD-10-20-P 10 100" 137" 33" x 82" 20" 232 719.00LAD-11-20-P 11 110" 147" 33" x 88" 20" 285 1,071.00LAD-12-20-P 12 120" 157" 43" x 94" 20" 301 $1,097.00LAD-13-20-P 13 130" 167" 43" x 101" 20" 319 1,123.00LAD-14-20-P 14 140" 177" 44" x 107" 20" 336 1,150.00LAD-15-20-P 15 150" 187" 44" x 113" 20" 353 1,174.00LAD-16-20-P 16 160" 197" 44" x 119" 20" 370 1,202.00SIDEWAYS WHEEL OPTION, model LAD-SW, $104.00 LISTDC-35/FC-125/175GRIP STRUT STEPPull handle backwards toprohibit access to ladder.<strong>Casters</strong> are lowered andunit becomes portable.Locking Grip Pads addstability and prevent theladder from rolling.PERFORATED STEPPush handle forward togain access to ladder.<strong>Casters</strong> are raised fromfloor and unit becomesstationary.Includes lockout featureto padlock ladder whennot in use. Padlock notincluded.Our exclusive two-piece design allows ladder to shipin half the space of other ladder brands. Unit is shrinkwrapped before leaving factory.www.vestil.com Phone (800) 348-0868
134INDUSTRIAL LADDERSNON-STRADDLENUMBEROF STEPSTOP STEP(W x D x H)NUMBEROF STEPSTOP STEPHEIGHTOVERALL(W x D x H)NUMBERSTEPTOP STEPOVERALLNET WT.MODEL NUMBERLIST PRICEOF STEPS TYPEHEIGHT(W x D x H)(POUNDS) YELLOW BLUE WHITE EACH1 RUBBER 9¾" 21 1 /8" x 16 1 /8" x 9¾" 16/UPS LAD-1-Y LAD-1-B LAD-1-W $146.002 RUBBER 18¾" 21 1 /8" x 20¼" x 18¾" 25/UPS LAD-2-Y LAD-2-B LAD-2-W 161.003 RUBBER 28½" 21 1 /8" x 26 7 /8" x 60 5 /8" 39 LAD-3-Y LAD-3-B LAD-3-W 230.004 RUBBER 38" 21 1 /8" x 33 1 /8" x 70¼" 47 LAD-4-Y LAD-4-B LAD-4-W 270.005 RUBBER 47½" 21 1 /8" x 39 3 /8" x 79¾" 56 LAD-5-Y LAD-5-B LAD-5-W 311.001 PERFORATED 10" 21 1 /8" x 16 1 /8" x 9¾" 20/UPS LAD-1-Y-P LAD-1-B-P LAD-1-W-P $143.002 PERFORATED 19¼" 21 1 /8" x 20¼" x 18¾" 30/UPS LAD-2-Y-P LAD-2-B-P LAD-2-W-P 158.003 PERFORATED 28½" 21 1 /8" x 26 7 /8" x 60 5 /8" 40 LAD-3-Y-P LAD-3-B-P LAD-3-W-P 225.004 PERFORATED 38" 21 1 /8" x 33 1 /8" x 70¼" 50 LAD-4-Y-P LAD-4-B-P LAD-4-W-P 264.005 PERFORATED 47½" 21 1 /8" x 39 3 /8" x 79¾" 60 LAD-5-Y-P LAD-5-B-P LAD-5-W-P 304.00DC-35/FC-175NET WT.(LBS.)MODEL NUMBERPERFORATEDLIST PRICEEACHMODEL NUMBERGRIP STRUTLIST PRICEEACH4 40" 29½" x 43½" x 70" 102 LAD-MM-4-P $409.00 LAD-MM-4-G $462.005 50" 29½" x 49¾" x 80" 122 LAD-MM-5-P 468.00 LAD-MM-5-G 537.006 60" 29½" x 56" x 90" 139 LAD-MM-6-P 502.00 LAD-MM-6-G 605.007 70" 29½" x 62" x 100" 155 LAD-MM-7-P 566.00 LAD-MM-7-G 667.008 80" 29½" x 68¼" x 110" 170 LAD-MM-8-P 629.00 LAD-MM-8-G 729.009 90" 29½" x 74½" x 120" 185 LAD-MM-9-P 691.00 LAD-MM-9-G 790.0010 100" 29½" x 80¾" x 130" 199 LAD-MM-10-P 752.00 LAD-MM-10-G 850.0011 110" 29½" x 87" x 140" 213 LAD-MM-11-P 812.00 LAD-MM-11-G 909.0012 120" 29½" x 93¼" x 150" 226 LAD-MM-12-P 871.00 LAD-MM-12-G 967.00DC-35/FC-175/250OVERALLSIZE (W x D x H)NET WT.(LBS.)MODEL NUMBERPERFORATED STEPSLIST PRICEEACHMODEL NUMBER GRIPSTRUT STEPSLIST PRICEEACHANGLENON-STRADDLE DESIGN2 50° 24" x 14" x 20" 27" x 34" x 54½" 65 LAD-TGN-50-2-P $195.00 LAD-TGN-50-2-G $229.003 50° 24" x 14" x 30" 27½" x 43" x 64½" 80 LAD-TGN-50-3-P 226.00 LAD-TGN-50-3-G 258.004 50° 24" x 14" x 40" 28" x 52" x 74½" 100 LAD-TGN-50-4-P 273.00 LAD-TGN-50-4-G 300.005 50° 24" x 14" x 50" 29" x 60½" x 84½" 120 LAD-TGN-50-5-P 310.00 LAD-TGN-50-5-G 358.006 50° 24" x 14" x 60" 29½" x 69½" x 94½" 135 LAD-TGN-50-6-P 373.00 LAD-TGN-50-6-G 428.002 60° 24" x 14" x 20" 27" x 33" x 54½" 65 LAD-TGN-60-2-P $196.00 LAD-TGN-60-2-G $208.003 60° 24" x 14" x 30" 27½" x 40" x 64½" 80 LAD-TGN-60-3-P 226.00 LAD-TGN-60-3-G 237.004 60° 24" x 14" x 40" 28" x 46" x 74½" 95 LAD-TGN-60-4-P 260.00 LAD-TGN-60-4-G 277.005 60° 24" x 14" x 50" 29" x 53" x 84½" 115 LAD-TGN-60-5-P 311.00 LAD-TGN-60-5-G 335.006 60° 24" x 14" x 60" 29½" x 60" x 94½" 135 LAD-TGN-60-6-P 373.00 LAD-TGN-60-6-G 404.00STRADDLE DESIGN2 50° 24" x 21" x 20" 27½" x 42" x 54½" 75 LAD-TGS-50-2-P $382.00 LAD-TGS-50-2-G $428.003 50° 24" x 21" x 30" 28" x 51" x 64½" 95 LAD-TGS-50-3-P 414.00 LAD-TGS-50-3-G 464.004 50° 24" x 21" x 40" 29" x 59½" x 74½" 120 LAD-TGS-50-4-P 463.00 LAD-TGS-50-4-G 519.005 50° 24" x 21" x 50" 29½" x 68" x 84½" 160 LAD-TGS-50-5-P 502.00 LAD-TGS-50-5-G 562.006 50° 24" x 21" x 60" 30" x 76½" x 94½" 190 LAD-TGS-50-6-P 549.00 LAD-TGS-50-6-G 615.002 60° 24" x 21" x 20" 27½" x 41" x 54½" 75 LAD-TGS-60-2-P $378.00 LAD-TGS-60-2-G $401.003 60° 24" x 21" x 30" 28" x 47" x 64½" 95 LAD-TGS-60-3-P 410.00 LAD-TGS-60-3-G 435.004 60° 24" x 21" x 40" 29" x 54½" x 74½" 120 LAD-TGS-60-4-P 458.00 LAD-TGS-60-4-G 485.005 60° 24" x 21" x 50" 29½" x 54½" x 84½" 160 LAD-TGS-60-5-P 497.00 LAD-TGS-60-5-G 527.006 60° 24" x 21" x 60" 30" x 66½" x 94½" 190 LAD-TGS-60-6-P 544.00 LAD-TGS-60-6-G 577.00DC-35/FC-175/250Phone (800) 348-0868NewNewSTRADDLE DESIGNMaintenance LaddersPortable ladders for use around warehouses, hardware stores or inventory rooms. Tilt the unit to allow forportability. Units roll on 4" poly-on-poly wheels. Constructed of square tubing framework which handlesuniform capacities up to 350 lbs. Features 30" high removable hand railing, access chain, 21" deep top platform,and an industrial blue powder coat finish. Each step measures 24" wide by 7" deep and is spaced 10" apart. Unitsare ship crated, some assembly required. Complies with ANSI 14.7 and OSHA 1910.29 specifications.Tip-N-Roll Mobile LaddersThese all welded ladders are available in either straddle or non-straddle design. Choose the straddle basefor areas with permanent obstructions or non-straddle base for standard applications. When tilted, ladderrolls smoothly on 4" wheels. Straddle base ladders include a removable tool tray that measures 24" x 10".Uniform capacity is 300 lbs. Available with perforated steps or grip strut steps. Powder coat blue finish.Spring-loaded swivelcasters are protected bya steel dome with rubberbottom pads for extra grip.Commercial Spring Loaded LaddersCommercial users of rolling ladders now have an attractive and economical alternativeto the traditional warehouse rolling ladders. This sleek design also provides maximumsafety and convenience. The all directional spring-loaded swivel casters feature steeldome protection and include rubber pad bottoms to minimize movement. Climbangle is 57°. The top step is 16" wide by 11" deep while the remaining steps measure16" wide by 8" deep. The powder coat finish provides a durable attractive appearance.Uniform capacity is 300 pounds.www.vestil.com
135Standard Slope LaddersPortable warehouse ladder for every-day use applications. Heavy-duty uniform weight capacity is 300 lbs. Features60° standard climb angle. Choose either Perforated or Grip-Strut steps. Step depth is 7" with a top step depth of 14".Welded square tubular steel construction with powder-coat blue finish. Rubber feet provided for floor protection.Units with 2-5 steps have all directional spring-loaded swivel casters. Ships fully assembled and ready to use.Units with 6 to 12 steps have bottom step lock casters for safe use when climbing. Ships knockdown.NO. OFSTEPSTOP STEP(W x H)OVERALL(W x D x H)NET WT.(LBS.)MODEL NUMBERPERFORATED STEPSLIST PRICEEACHMODEL NUMBERGRIP STRUT STEPSLIST PRICEEACHNO HANDRAIL2 18" x 20" 22" x 24" x 20" LAD-R-18-2-P-NHR $132.00 LAD-R-18-2-G-NHR $156.003 18" x 30" 22" x 28" x 30" LAD-R-18-3-P-NHR 158.00 LAD-R-18-3-G-NHR 188.004 18" x 40" 22" x 36" x 40" LAD-R-18-4-P-NHR 180.00 LAD-R-18-4-G-NHR 217.002 26" x 20" 28" x 24" x 20" LAD-R-26-2-P-NHR $142.00 LAD-R-26-2-G-NHR $171.003 26" x 30" 28" x 28" x 30" LAD-R-26-3-P-NHR 172.00 LAD-R-26-3-G-NHR 201.004 26" x 40" 30" x 36" x 40" LAD-R-26-4-P-NHR 198.00 LAD-R-26-4-G-NHR 235.002 32" x 20" 32" x 24" x 20" LAD-R-32-2-P-NHR $161.00 LAD-R-32-2-G-NHR $195.003 32" x 30" 32" x 28" x 30" LAD-R-32-3-P-NHR 202.00 LAD-R-32-3-G-NHR 244.004 32" x 40" 32" x 36" x 40" LAD-R-32-4-P-NHR 265.00 LAD-R-32-4-G-NHR 318.00HANDRAIL INCLUDED2 18" x 20" 22" x 24" x 44" LAD-R-18-2-P $154.00 LAD-R-18-2-G $185.003 18" x 30" 22" x 28" x 54" LAD-R-18-3-P 174.00 LAD-R-18-3-G 207.004 18" x 40" 22" x 36" x 70" LAD-R-18-4-P 259.00 LAD-R-18-4-G 303.005 18" x 50" 22" x 43" x 80" LAD-R-18-5-P 228.00 LAD-R-18-5-G 272.002 26" x 20" 28" x 24" x 44" LAD-R-26-2-P $166.00 LAD-R-26-2-G $198.003 26" x 30" 28" x 28" x 54" LAD-R-26-3-P 211.00 LAD-R-26-3-G 256.004 26" x 40" 30" x 36" x 70" LAD-R-26-4-P 257.00 LAD-R-26-4-G 312.005 26" x 50" 30" x 43" x 80" LAD-R-26-5-P 267.00 LAD-R-26-5-G 310.002 32" x 20" 32" x 24" x 44" LAD-R-32-2-P $190.00 LAD-R-32-2-G $228.003 32" x 30" 32" x 28" x 54" LAD-R-32-3-P 220.00 LAD-R-32-3-G 270.004 32" x 40" 32" x 36" x 70" LAD-R-32-4-P 310.00 LAD-R-32-4-G 385.005 32" x 50" 32" x 43" x 80" LAD-R-32-5-P 345.00 LAD-R-32-5-G 413.00HANDRAIL INCLUDED6 18" x 60" 28" x 50" x 93" LAD-R-18-6-P $437.00 LAD-R-18-6-G $525.007 18" x 70" 28" x 57" x 103" LAD-R-18-7-P 469.00 LAD-R-18-7-G 563.006 26" x 60" 30" x 50" x 90" LAD-R-26-6-P $451.00 LAD-R-26-6-G $541.007 26" x 70" 30" x 57" x 103" LAD-R-26-7-P 484.00 LAD-R-26-7-G 493.008 26" x 80" 32" x 62" x 113" LAD-R-26-8-P 525.00 LAD-R-26-8-G 630.009 26" x 90" 32" x 68" x 123" LAD-R-26-9-P 623.00 LAD-R-26-9-G 690.0010 26" x 100" 32" x 78" x 133" LAD-R-26-10-P 627.00 LAD-R-26-10-G 751.0011 26" x 110" 32" x 81" x 144" LAD-R-26-11-P 706.00 LAD-R-26-11-G 846.0012 26" x 120" 32" x 88" x 150" LAD-R-26-12-P 860.00 LAD-R-26-12-G 915.006 32" x 60" 32" x 50" x 93" LAD-R-32-6-P $469.00 LAD-R-32-6-G $564.007 32" x 70" 32" x 57" x 103" LAD-R-32-7-P 510.00 LAD-R-32-7-G 614.008 32" x 80" 36" x 62" x 113" LAD-R-32-8-P 597.00 LAD-R-32-8-G 718.009 32" x 90" 36" x 68" x 123" LAD-R-32-9-P 638.00 LAD-R-32-9-G 768.0010 32" x 100" 36" x 78" x 133" LAD-R-32-10-P 722.00 LAD-R-32-10-G 864.0011 32" x 110" 36" x 81" x 144" LAD-R-32-11-P 789.00 LAD-R-32-11-G 946.0012 32" x 120" 36" x 88" x 150" LAD-R-32-12-P 861.00 LAD-R-32-12-G 1,034.00Alternating-Tread StairsAlternating-Tread Step design offers a shorter span than traditional steps. Features handrail on each side of unit,MODELNUMBERNUMBEROF STEPSTOP STEPHEIGHTSTEPANGLEUNIFORMCAPACITYNET WT.(POUNDS)DC-35/FC-125/175dual safety chain at the top of the stair and formed steel steps with raised surfaces for better traction. Welded steelconstruction with bolt-on handrails. Powder coated safety yellow finish. Ships knockdown for lower freight costs.LIST PRICEEACHLENGTHATS-4-56 7 48" 36½" 56° 350 129 $1,013.00ATS-5-56 8 60" 44 5 /8" 56° 350 147 1,177.00ATS-6-56 10 72" 52¾" 56° 350 166 1,355.00ATS-7-56 12 84" 60¾" 56° 350 184 1,531.00ATS-8-56 13 96" 68 7 /8" 56° 350 202 1,694.00ATS-9-56 15 108" 77 1 /8" 56° 350 220 1,873.00ATS-10-56 16 120" 85 1 /8" 56° 350 272 2,044.00ATS-4-68 6 48" 26 1 /8" 68° 350 114 $1,013.00ATS-5-68 7 60" 31" 68° 350 131 1,177.00ATS-6-68 9 72" 35 7 /8" 68° 350 148 1,355.00ATS-7-68 10 84" 40¾" 68° 350 165 1,531.00ATS-8-68 11 96" 45½" 68° 350 182 1,694.00ATS-9-68 13 108" 50 3 /8" 68° 350 199 1,873.00ATS-10-68 14 120" 55¼" 68° 350 216 2,044.00DC-35/FC-85www.vestil.com Phone (800) 348-0868Newmodel LAD-R-26-4-P-NHRmodel LAD-R-18-4-G-NHRmodel LAD-R-26-6-GBOTTOM STEP LOCKSCASTERS FOR SAFECLIMBING ON UNITSWITH 6 TO 12 STEPSINDUSTRIAL LADDERS
136INDUSTRIAL LADDERSNewRoll-A-Fold LaddersPortable ladder conveniently folds for storage. Constructed of square tubing framework which handlesuniform capacities up to 350 lbs. Features 30" high removable hand railing, 14" deep top platform, and anindustrial blue powder coat finish. Each step measures 17" wide by 7" deep and is spaced 10" apart. Unitrolls around on two large 10" x 2½" hard rubber wheels. Units are shipped crated, some assembly required.Complies with ANSI 14.7 and OSHA 1910.29 specifications.NUMBEROF STEPSTOP STEPHEIGHTNET WT.(LBS.)MODEL NUMBERPERFORATED STEPSLIST PRICEEACHMODE NUMBERGRIP STRUT STEPSLIST PRICEEACHANGLE4 58° 40" 93 LAD-RF-4-P $334.00 LAD-RF-4-G $354.005 58° 50" 107 LAD-RF-5-P 355.00 LAD-RF-5-G 375.006 58° 60" 121 LAD-RF-6-P 383.00 LAD-RF-6-G 404.007 58° 70" 136 LAD-RF-7-P 467.00 LAD-RF-7-G 490.008 58° 80" 153 LAD-RF-8-P 548.00 LAD-RF-8-G 576.009 58° 90" 168 LAD-RF-9-P $598.00 LAD-RF-9-G $640.0010 58° 100" 182 LAD-RF-10-P 666.00 LAD-RF-10-G 708.0011 58° 110" 197 LAD-RF-11-P 714.00 LAD-RF-11-G 767.0012 58° 120" 213 LAD-RF-12-P 759.00 LAD-RF-12-G 818.004 50° 40" 97 LAD-RF-4-P-EZ $342.00 LAD-RF-4-G-EZ $374.005 50° 50" 112 LAD-RF-5-P-EZ 383.00 LAD-RF-5-G-EZ 410.006 50° 60" 127 LAD-RF-6-P-EZ 438.00 LAD-RF-6-G-EZ 459.007 50° 70" 142 LAD-RF-7-P-EZ 499.00 LAD-RF-7-G-EZ 527.008 50° 80" 160 LAD-RF-8-P-EZ 596.00 LAD-RF-8-G-EZ 623.009 50° 90" 186 LAD-RF-9-P-EZ $654.00 LAD-RF-9-G-EZ $691.0010 50° 100" 191 LAD-RF-10-P-EZ 707.00 LAD-RF-10-G-EZ 762.0011 50° 110" 210 LAD-RF-11-P-EZ 774.00 LAD-RF-11-G-EZ 828.0012 50° 120" 225 LAD-RF-12-P-EZ 828.00 LAD-RF-12-G-EZ 881.00DC-35/FC-175/250Cross-Over LaddersMount where you need permanent access at crossover points. The upper platform features removabletwo sided 42" high handrail with 21" mid-rail and fixed 4" toeboards to prevent objects from rolling off.Serrated steps for extra grip and safety are 24" wide and 7" deep with a step height of 10". The angle ofthe steps is 58°. The overall ladder width is 29". Ground legs include floor mounting pads. Units mustbe anchored to the floor. Units are all welded steel construction but can be knock-down for storage andshipping. Uniform capacity is 500 pounds. Meets OSHA 1910.25. Powder coat yellow finish.NewPhone (800) 348-0868SPRING LOADEDDETENT PINMODELNUMBERNUMBEROF STEPS A B C D E FNET WT.(LBS.)LIST PRICEEACHCOL-3-26-14 3 28" 14½" 54½" 72¾" 30" 24" 186 $848.00COL-3-26-23 3 28" 26½" 66½" 72¾" 30" 36" 210 898.00COL-3-26-33 3 28" 38½" 78½" 72¾" 30" 48" 241 955.00COL-3-26-44 3 28" 50½" 90½" 72¾" 30" 60" 265 1,006.00COL-4-36-14 4 38" 14½" 67" 82¾" 40" 24" 217 $960.00COL-4-36-23 4 38" 26½" 79" 82¾" 40" 36" 242 1,011.00COL-4-36-33 4 38" 38½" 91" 82¾" 40" 48" 272 1,068.00COL-4-36-44 4 38" 50½" 103" 82¾" 40" 60" 297 1,116.00COL-5-46-14 5 48" 14½" 79½" 92¾" 50" 24" 248 $1,084.00COL-5-46-23 5 48" 26½" 91½" 92¾" 50" 36" 273 1,135.00COL-5-46-33 5 48" 38½" 103½" 92¾" 50" 48" 303 1,191.00COL-5-46-44 5 48" 50½" 115½" 92¾" 50" 60" 328 1,240.00COL-6-56-14 6 58" 14½" 92" 102¾" 60" 24" 279 $1,198.00COL-6-56-23 6 58" 26½" 104" 102¾" 60" 36" 304 1,249.00COL-6-56-33 6 58" 38½" 116" 102¾" 60" 48" 334 1.305.00COL-6-56-44 6 58" 50½" 128" 102¾" 60" 60" 359 1,354.00DC-35/FC-85/175Folding Ladders with WheelsLocking foldable design saves on storage space when ladder is not in use. Ladder folds after unlockingspring-loaded detent pin. Once unit is folded, tilt back on wheels for easy portability. Available in eithercarbon steel or stainless steel. The steps are perforated to provide a non-slip surface. The ladders have 7"deep steps and a climb angle of 58°. Complies with ANSI 14.7 and OSHA 1910.29 specifications.NUMBEROF STEPSTOP STEPHEIGHTUNIFORMCAPACITYNET WT.(POUNDS)MODEL NUMBERCARBON STEELLIST PRICEEACHMODEL NUMBERSTAINLESS STEELLIST PRICEEACH2 20" 350 30 FLAD-2 $180.00 FLAD-2-SS $632.003 30" 350 35 FLAD-3 235.00 FLAD-3-SS 799.004 40" 350 42 FLAD-4 273.00 FLAD-4-SS 899.00DC-35/UPS/FC-85www.vestil.com
137Alternating Step Cross-Over LaddersMount where you need permanent access at crossover points. Alternating step design forshorter overall span than other units. The upper platform features removable two sided42" high handrail with 21" mid-rail and fixed 4" toeboards to prevent objects from rollingoff. Usable width is 19¾" between handrails. Heavy-duty uniform capacity rating of 350pounds per unit. Includes lag-down points for securing to floor. Steel construction withpowder-coat safety yellow finish. Meets OSHA and ANSI A14.7 standards.MODELNUMBERNUMBEROF STEPSCLEARHEIGHTCLEARSPANOVERALLSPANSTEPANGLENET WT.(LBS.)LIST PRICEEACHCOLA-2-56-20 4 26" 20" 76¾" 56° 324 $1,153.00COLA-2-56-32 4 26" 32" 88¾" 56° 357 1,188.00COLA-2-56-44 4 26" 44" 100¾" 56° 390 1,228.00COLA-2-56-56 4 26" 56" 112¾" 56° 423 1,264.00COLA-2-68-20 4 26" 15" 61" 68° 296 $1,153.00COLA-2-68-32 4 26" 27" 73" 68° 329 1,188.00COLA-2-68-44 4 26" 37" 85" 68° 362 1,228.00COLA-2-68-56 4 26" 51" 97" 68° 396 1,264.00COLA-3-56-20 5 34" 20" 87½" 56° 324 $1,153.00COLA-3-56-32 5 34" 32" 99½" 56° 357 1,188.00COLA-3-56-44 5 34" 44" 111½" 56° 390 1,228.00COLA-3-56-56 5 34" 56" 123½" 56° 423 1,264.00COLA-3-68-20 5 34" 15" 61" 68° 296 $1,153.00COLA-3-68-32 5 34" 27" 73" 68° 329 1,188.00COLA-3-68-44 5 34" 39" 85" 68° 362 1,228.00COLA-3-68-56 5 34" 51" 97" 68° 396 1,264.00COLA-4-56-20 7 45" 20" 87½" 56° 324 $1,153.00COLA-4-56-32 7 45" 32" 99½" 56° 357 1,188.00COLA-4-56-44 7 45" 44" 111½" 56° 390 1,228.00COLA-4-56-56 7 45" 56" 123½" 56° 423 1,264.00COLA-4-68-20 7 45" 15" 64" 68° 296 $1,153.00COLA-4-68-32 7 45" 27" 76" 68° 329 1,188.00COLA-4-68-44 7 45" 39" 88" 68° 362 1,228.00COLA-4-68-56 7 45" 51" 100" 68° 396 1,264.00COLA-5-56-20 8 57" 20" 104" 56° 358 $1,268.00COLA-5-56-32 8 57" 32" 116" 56° 390 1,303.00COLA-5-56-44 8 57" 44" 128" 56° 424 1,343.00COLA-5-56-56 8 57" 56" 140" 56° 456 1,378.00COLA-5-68-20 8 57" 15" 73" 68° 330 $1,268.00COLA-5-68-32 8 57" 27" 85" 68° 363 1,303.00COLA-5-68-44 8 57" 39" 97" 68° 396 1,343.00COLA-5-68-56 8 57" 51" 109" 68° 430 1,378.00COLA-6-56-20 10 69" 20" 118½" 56° 396 $1,392.00COLA-6-56-32 10 69" 32" 132" 56° 429 1,427.00COLA-6-56-44 10 69" 44" 144" 56° 462 1,467.00COLA-6-56-56 10 69" 56" 156" 56° 495 1,503.00COLA-6-68-20 10 69" 15" 83" 68° 366 $1,392.00COLA-6-68-32 10 69" 27" 95" 68° 398 1,427.00COLA-6-68-44 10 69" 39" 107" 68° 431 1,467.00COLA-6-68-56 10 69" 51" 119" 68° 464 1,503.00COLA-7-56-20 12 81" 20" 136" 56° 433 $1,516.00COLA-7-56-32 12 81" 32" 148" 56° 466 1,551.00COLA-7-56-44 12 81" 44" 160" 56° 499 1,590.00COLA-7-56-56 12 81" 56" 172" 56° 532 1,626.00COLA-7-68-20 12 81" 15" 93" 68° 400 $1,516.00COLA-7-68-32 12 81" 27" 105" 68° 433 1,551.00COLA-7-68-44 12 81" 39" 117" 68° 466 1,590.00COLA-7-68-56 12 81" 51" 129" 68° 499 1,626.00DC-35/FC-125/175NewUSE LESS FLOOR SPACEINDUSTRIAL LADDERSConcrete Anchoring HardwareInstall Modular Style Stairway (page 138) to concrete surfaces quickly and easily. To install,mark hole placement of guard, drill into concrete with Masonry Bit, realign guard and securewith anchor bolt.NewMODELNUMBER DESCRIPTION SIZENET WT.(POUNDS)LIST PRICEEACHHKIT-1 (1) MASONRY BIT ¾" 4 $13.00HKIT-4 (4) ANCHOR BOLTS ¾"D x 4"L 3 12.00DC-20/UPSwww.vestil.com Phone (800) 348-0868
138INDUSTRIAL LADDERSNewNewRetracts forconvenient storageModular Style StairwayAttractive Modular Style Stairway is economical and easily assembled. Steps are 36" wide withnon-skid grip strut which bolt in place and are powder coated blue. Handrails and siderail bolttogether. The handrail tubing has a powder coat yellow finish. Units meet OSHA requirementsand unit ships disassembled. Concrete Anchoring Hardware available, see page 137.MODELNUMBERNUMBEROF STEPSMAXIMUMLANDING HEIGHT*UNIFORMCAPACITY (LBS)NET WT.(LBS.)LIST PRICEEACHSTAIR-5 5 35" 1,000 227 $865.00STAIR-6 6 42" 1,000 302 915.00STAIR-7 7 49" 1,000 312 985.00STAIR-8 8 56" 1,000 377 1,090.00STAIR-9 9 63" 1,000 387 1,185.00STAIR-10 10 70" 1,000 453 1,230.00STAIR-11 11 77" 1,000 463 $1,293.00STAIR-12 12 84" 1,000 529 1,437.00STAIR-13 13 91" 1,000 539 1,470.00STAIR-14 14 98" 1,000 604 1,523.00STAIR-15 15 105" 1,000 614 1,578.00STAIR-16 16 112" 1,000 680 1,607.00STAIR-17 17 119" 1,000 690 $1,637.00STAIR-18 18 126" 1,000 755 1,685.00STAIR-19 19 133" 1,000 765 1,730.00STAIR-20 20 140" 1,000 831 1,762.00STAIR-21 21 144" 1,000 841 1,795.00*Drop down step mounting. Stairways to be mounted flush with floor requiresDC-25/FC-125/175an additional step.Walk-Thru Style Dock LaddersPrevent needless dock injuries with Walk-Thru Style Dock Ladders. Constructed of steel angleiron. Mount ladder directly to the dock face by either welding or bolting on. The extra highhandrail provides maximum assistance and safety. All ladders project 8½" out from face of dock.MODELNUMBEROVERALLSIZE (W x H)NUMBEROF RUNGSTOP STEPHEIGHTWIDTHOF STEPDISTANCEBETWEEN STEPNET WT.(LBS.)LIST PRICEEACHDKL-2 21" x 67½" 2 12" 18" 12" 46 $155.00DKL-3 21" x 79½" 3 24" 18" 12" 50 167.00DKL-4 21" x 91½" 4 36" 18" 12" 55 178.00DKL-5 21" x 103½" 5 48" 18" 12" 59 189.00DKL-6 21" x 115½" 6 60" 18" 12" 65 $202.00DKL-7 21" x 127½" 7 72" 18" 12" 85 231.00DKL-8 21" x 139½" 8 84" 18" 12" 91 242.00DKL-9 21" x 151½" 9 96" 18" 12" 97 256.00DKL-10 21" x 163½" 10 108" 18" 12" 103 273.00DC-25/FC-85Aluminum Telescopic LaddersIdeal when storage space is limited. The lightweight and low profile design allows for storagein closets or tight spaces. Each step is serrated and has a spring loaded locking pin thatautomatically engages to secure step height. The release mechanism provides a smooth automaticclosing design. These ladders extend in 12" increments. Top bumper guards and molded rubberfeet protect walls and floors against scratches. Meets OSHA and ANSI specifications.MODELNUMBEREXTENDEDSTEPSCLOSED SIZE(W x D x H)STEPDEPTHUNIFORMCAPACITYNET WT.(LBS.)LIST PRICEEACHTLAD-10 6 in. - 10 ft. 18½" x 2¾" x 29" 1½" 225 22 $237.00TLAD-12 6 in. - 12 ft. 19¼" x 3½" x 32" 1½" 225 28 248.00TLAD-12-1A 6 in. - 12 ft. 18" x 4" x 32" 1½" 300 31 $353.00TLAD-15-1 6 in. - 15 ft. 19" x 4" x 36" 1½" 250 38 388.00DC-25/UPS/FC-70Aluminum Industrial Step StandsAluminum industrial step stands fold easily for easy transport and storage. Multi-purposeindustrial step stand is lightweight and has a 300 lb. uniform capacity. Units include a largemolded top and double rivet construction.Phone (800) 348-0868Newmodel AISS-2Type 1A300 lbs.MODELNUMBEROVERALLHEIGHT (FT.)TOP STEPHEIGHTTOP SIZE(W x D)NET WT.(POUNDS)LIST PRICEEACHAISS-1 1 11½" 14" x 9¼" 8 $154.00AISS-2 2 22¾" 14" x 9¼" 14 204.00AISS-3 3 34" 14" x 9¼" 19 252.00AISS-4 4 45¼" 14" x 9¼" 24 295.00DC-20/FC-150www.vestil.com
Aluminum Platform LaddersThese lightweight aluminum industrial platform ladders have a 375 lb. uniform duty rating, andare designed with extra heavy duty side rails. They also have a slip resistant platform and rubberfeet. Top platform has a guard rail for added protection. These ladders meet the most demandingindustrial and contracting applications.MODELNUMBERMODELNUMBEROVERALLHEIGHT (FT.)OVERALLHEIGHT (FT.)BOTTOMWIDTHLENGTH EACHSECTION (FT.)STEPSIZEAPPROXIMATESPREADMAXIMUM EXTENDEDLENGTH (FT.)NET WT.(POUNDS)NET WT.(POUNDS)LIST PRICEEACHPFSL-4 4 24¼" 3" 43¾" 23 $246.00PFSL-6 6 27¼" 3" 54¾" 30 320.00PFSL-8 8 30¼" 3" 65¾" 40 428.00DC-20/FC-150Fiberglass Twin Front LaddersFiberglass Twin Front Ladders are made of non-conductive fiberglass industrial material.They are extra-heavy duty, capable of supporting 300 uniform lbs. These ladders areequipped with slip resistant footing, heavy steel hinges, and inside spreader braces. Steps areon both sides of the ladder to make it easy for two people to work on the same project.MODELNUMBERLIST PRICEEACHEXL-24 24 12 21 52 $338.00EXL-28 24 14 25 58 398.00EXL-32 24 16 29 70 492.00DC-20/FC-150MODELNUMBEROVERALLHEIGHT (FT.)OVERALLHEIGHT (FT.)BOTTOMWIDTHBOTTOMWIDTHSTEPSIZESTEPSIZEAPPROXIMATESPREADAPPROXIMATESPREADNET WT.(POUNDS)NET WT.(POUNDS)LIST PRICEEACHFBTFL-4 4 19-9/16" 3" 37-1/2" 19 $193.00FBTFL-5 5 21-1/16" 3" 44-7/8" 22 223.00FBTFL-6 6 22-9/16" 3" 52-5/16" 27 251.00FBTFL-7 7 24-1/16" 3" 59-11/16" 30 292.00FBTFL-8 8 25-9/16" 3" 67-1/8" 34 345.00FBTFL-10 10 28-9/16" 3" 81-15/16" 44 432.00FBTFL-12 12 31-9/16" 3" 96-3/4" 62 518.00DC-20/FC-150Fiberglass Extension Ladders with Aluminum RungsThese Extension Ladders feature the Pro Top and have a Type IA 300 lb uniform duty rating.They are equipped with the exclusive Rung Lock Quicklatch, a quick and easy locking method forsecuring sections when the ladder is extended. The ladder also has the premium feature of a fullmetal plate that is wrapped around the rail for protection and durability. Pro Top features V-shapedesign for stability on corners, and soft non-marking/non-marring rubber tread protects worksurface.Fiberglass StepladderFiberglass Stepladders are made of a non-conductive fiberglass industrial material. They are extraheavy duty, capable of supporting 300 uniform lbs. These ladders are equipped with slip resistantfooting and a non-conductive structural molded top with tool slots to help keep tools close athand.LIST PRICEEACHFBSL-4 4 19 9 /16" 3" 28 15 /16" 15 $124.00FBSL-5 5 21 1 /16" 3" 34 7 /8" 17 138.00FBSL-6 6 22 9 /16" 3" 40 7 /8" 21 158.00FBSL-7 7 24 1 /16" 3" 43 13 /16" 25 186.00FBSL-8 8 25 9 /16" 3" 52¾" 28 210.00FBSL-10 10 28 9 /16" 3" 64 11 /16" 34 314.00FBSL-12 12 31 9 /16" 3" 76 1 /8" 51 384.00DC-20/FC-150Fiberglass Industrial Step StandsFiberglass industrial step stands fold easily for easy transport and storage. These step stands arenon-conductive fiberglass heavy duty, multi-purpose industrial material, with a 300 lb. uniformduty rating. Units included a large molded top and double rivet construction.NewType 1A300 lbs.NewType 1AA375 lbs.modelPFSL-4modelFBTFL-6V-shape design forstability on cornersNewType 1A300 lbs.New139model FBSL-6Type 1A300 lbs.INDUSTRIAL LADDERSMODELNUMBEROVERALLHEIGHT (FT.)TOP STEPHEIGHTTOP SIZE(W x D)NET WT.(POUNDS)LIST PRICEEACHFBSS-1 1 13" 14" x 9¼" 8 $208.00FBSS-2 2 22¾" 14" x 9¼" 15 254.00FBSS-3 3 34" 14" x 9¼" 20 309.00FBSS-4 4 45¼" 14" x 9¼" 25 358.00DC-20/FC-150www.vestil.com Phone (800) 348-0868Newmodel FBSS-2Type 1A300 lbs.
140INDUSTRIAL LADDERSNewNewAluminum Step StandsIdeal for industrial or commercial applications. Strong design yields a uniform capacity of 500pounds, but is lighter than comparable steel models. Open step design includes extra heavy dutyserrated surface for traction. With rubber tipped legs, this step ladder is ideal for use on manytypes floors. Available in welded or bolt-together design.MODELNUMBEROVERALL SIZE(W x D x H)UNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHSTEPSASSEMBLYSSA-2 2 22¼" x 24" x 20 500 WELDED 20 $174.00SSA-3 3 22¼" x 34" x 30 500 WELDED 32 318.00SSA-3-KD 3 22¼" x 34" x 30 500 BOLT TOGETHER 32 $274.00Portable Two-Step LaddersDC-35/UPS/FC-85Mobile two-step design for access to hard-to-reach places. Tubular steel construction. Two stylesto choose from - rubber matting or perforated steel. Top step height is 20" and measures 16" wide(15¾" usable) by 8" deep. Two rigid wheels allow for easy tilt and roll portability. Ships knockdown for lower shipping costs. Powder coat finish.model RLAD-2-YTILT AND ROLL UNITFROM LOCATION TOLOCATIONMODELNUMBEROVERALL SIZE(W x D x H) COLORNET WT.(POUNDS)LIST PRICEEACHSTEP STYLERLAD-2-Y RUBBER 23" x 22 11 /16" x 42" YELLOW 39 $239.00RLAD-2-B RUBBER 23" x 22 11 /16" x 42" BLUE 39 239.00RLAD-P-2-Y PERFORATED 23" x 22 11 /16" x 42" YELLOW 39 $261.00RLAD-P-2-B PERFORATED 23" x 22 11 /16" x 42" BLUE 39 261.00DC-35/UPS/FC-85model AFSP-2NewAluminum Folding Step PlatformsPerfect for getting that extra reach when pulling parts, painting, washing vehicles, ormaintenance needs. Non-skid feet on each leg provide a secure grip, even on wet concrete, yetwill not mar expensive epoxy garage floors. Lightweight construction for easy transport. Whennot needed, the legs fold under the platform for easy storage.model AFSP-2-TTTOOL TRAYMODELNUMBERPLATFORMSIZE (W x L)OVERALL SIZE(W x L x H)**OVERALL SIZE(W x L x H)*UNIFORMCAPACITYNET WT.(LBS.)LIST PRICEEACHAFSP-2 15" x 35" 18¼" x 36½" x 5¼" 18¼" x 47½" x 19½" 250 13 $130.00AFSP-2-TT 15" x 35" 18¼" x 36½" x 5¼" 18¼" x 47½" x 51" 250 17 145.80*WHEN IN USE / **FOLDEDDC-25/UPS/FC-85NewAluminum Ladder/CartThis well built aluminum ladder/cart is great for home, office, or store. Rugged aluminumconstruction is strong and lightweight. Converts in seconds from ladder to cart. Handy handgrips for carrying. Ladder uniform capacity is 300 lbs., while the hand truck uniform capacity is130 lbs. Nose plate measures 15" wide. Unit rolls smoothly on 4" diameter wheels.MODELNUMBEROVERALL SIZE ASLADDER (W x D x H)OVERALL SIZE ASTRUCK (W x D x H)OVERALL SIZEFOLDED (W x D x H)NET WT.(POUNDS)LIST PRICEEACHSTEPSC-130-2 2 18½" x 20" x 37" 18½" x 14" x 39" 18½" x 3½" x 39" 17 $104.00C-130-3 3 18½" x 29" x 47" 18½" x 18" x 50" 18½" x 3½" x 50" 22 119.00DC-25/UPS/FC-85Fold-Up Step LaddersThese durable, lightweight, multipurpose ladders are perfect for homes, offices, schools andindustrial warehouses. Folds up to a 3" profile for convenient storage in closets and other tightspaces. Extra wide anti-slip step heights are 9", 18" and 27". A locking safety latch ensures auser's safety when climbing. Uniform capacity is 250 pounds. Steel construction. Powder coatfinish.MODELNUMBERNUMBEROF STEPSOVERALL SIZE(D x W x H)*OVERALL SIZE(D x W x H)**NET WT.(POUNDS)LIST PRICEEACHFSL-2 2 20" x 19" x 36" 3" x 19" x 39" 12 $41.00FSL-3 3 28" x 20" x 42" 3" x 20" x 45" 18 66.00*WHEN IN USE - **FOLDEDDC-25/UPS/FC-85Phone (800) 348-0868www.vestil.com
141Rolling Step Stools (over 17 inches high)Convenient and easy to use. Spring loaded casters along with a rubber ring around the baseprovide the extra grip needed when being used. Each step includes a rubber surface. Steelconstruction with powder coat finish. Uniform capacity is 500 pounds. Easily assembleswithout need for tools. Meets or exceeds GSA standards.MODELNUMBERTOP STEPHEIGHTBOTTOMSTEP HEIGHTTOP STEPDIAMETERBASEDIAMETERNET WT.(LBS.)LIST PRICEEACHITEMCOLORA STEP-17-Y YELLOW 17 1 /8" 8 7 /8" 11 3 /8" 17 7 /8" 11 $50.00B STEP-17-R RED 17 1 /8" 8 7 /8" 11 3 /8" 17 7 /8" 11 50.00C STEP-17-GY GRAY 17 1 /8" 8 7 /8" 11 3 /8" 17 7 /8" 11 50.00D STEP-17-BK BLACK 17 1 /8" 8 7 /8" 11 3 /8" 17 7 /8" 11 50.00Polyethylene Step StoolsWhen items are out of reach, do not strain, simplystep up with one of our Polyethylene Step Stools.The two, three and four step units have rearopening access storage compartments. Individualstep depth is 9" with a top step depth of 12".All models have rubber feet and a non-skid tapesurface. Hand holes are standard for easy oneperson transportation.VST-3-YDC-25/UPS/FC-85VST-2-YvestilgreenNewVST-1-YCAWheels are locatedin back of steps onmodel VST-4-Y fortilt-n-roll portability.DBNewINDUSTRIAL LADDERSMODELNUMBERBASE SIZE(W x D)OVERALLHEIGHTTOP STEP(W x D)UNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHCOLORVST-1-Y YELLOW 18" x 12" 12" 18" x 12" 500 10/UPS $61.00VST-2-Y YELLOW 22" x 21" 20" 17¾" x 11¾" 500 22/UPS 95.00VST-3-Y YELLOW 22" x 32" 29" 17" x 11½" 500 33 146.00VST-4-Y YELLOW 45" x 25" 69½" 17" x 12" 500 53 477.00VST-1-G GRAY 18" x 12" 12" 18" x 12" 500 10/UPS $61.00VST-2-G GRAY 22" x 21" 20" 17¾" x 11¾" 500 22/UPS 95.00VST-3-G GRAY 22" x 32" 29" 17" x 11½" 500 33 146.00VST-4-G GRAY 45" x 25" 69½" 17" x 12" 500 53 477.00VST-1-GRN GREEN 18" x 12" 12" 18" x 12" 500 10/UPS $61.00VST-2-GRN GREEN 22" x 21" 20" 17¾" x 11¾" 500 22/UPS 95.00VST-3-GRN GREEN 22" x 32" 29" 17" x 11½" 500 33 146.00VST-4-GRN GREEN 45" x 25" 69½" 17" x 12" 500 53 477.00DC-20/FC-250Folding Aluminum ScaffoldingNewScaffolding can be used for many applications, including painting, building and outdoormaintenance. This aluminum folding scaffolding is made with rugged 2" sturdy aluminum tubeconstruction. Scaffold folds up, with platform in the middle for easy storage. Scaffold moves easilyand locks into position using four 5" swivel casters with brakes. Scaffold platform features antiskidsheet, which is 24" wide. Platform not to be used on top rung.MODELOVERALL SIZE UNIFORM NET WT. LIST PRICENUMBER DESCRIPTION(W x L x H) CAPACITY / PR. (POUNDS) EACHFAS-6 SCAFFOLDING 29" x 77½" x 78" 500 lbs. 86 $399.00DC-25/FC-85Stainless Steel Flag Poles and American FlagFlagpole features a bright-polished stainless steel finish to elegantly display your flag of choice.The one-piece stainless steel tapered construction will maintain its attractive finish for many yearsto come. Includes nylon rope, stainless steel rope cleat and top pulley. Base plate is pre-drilledwith four mounting holes. United States flags are available in a durable nylon fabric.MODELNUMBERTOPDIAMETERMIDDLEDIAMETERBOTTOMDIAMETERRECOMMENDEDFLAG SIZE (W x H)NET WT.(LBS.)LIST PRICEEACHHEIGHTFLP-20-SS 3" -- 3½" 20' 5' x 3' 122 $836.00FLP-25-SS 3" 3½" 4" 25' 6' x 4' 132 1,124.00MODELNUMBERWIDTH(FEET)HEIGHT(FEET)USE WITH POLEMODELNET WT.(POUNDS)LIST PRICEEACHAFL-20 5 3 FLP-20-SS 2 $46.00AFL-25 6 4 FLP-25-SS 3 62.00DC-20/UPS/FC-70/150FLAG SOLD SEPARATELYWidth of flag should not exceed 25%of the flag pole heightwww.vestil.com Phone (800) 348-0868
142Pipe Safety RailingsProtect people from uneven walkways and mezzanine drop off's. These durablerailings are made of schedule 40 pipe (1⅝" O.D.). Handrails are 42" highwith a 21" mid-rail. Mounting options include socket sleeves, cast steel base,barricade base, or cast steel sockets for convenient handrail removal. The caststeel sockets accept wood 2" x 4" or 2" x 6" when toe boards are required. Thecast steel base has two lag down holes for permanently mounting the railing.There are two open cavities to allow for 2" x 4" or 2" x 5" toe boards. Steelrailing features powder coat safety yellow finish.PROTECTIVE BARRIERSMETAL SLEEVEis used for concretemount. Measures4"H x 2" O.D.model VDKR-P1073 or 4 FOOT GATEmodel VDKR-G3model VDKR-G4Hardware IncludedSTEEL PIPE SAFETY RAILING • series VDKRshown with optional socketsALUMINUM PIPE SAFETY RAILINGseries ADKRshown with optional socketsDOUBLE SOCKETfor surface mounting.Sockets are 4" high andhold two posts.model VDKR-P102BARRICADE BASEWITH FEETmodel VDKR-BB-FSteel OnlyCONNECTOR KITIncludes (2) male &(2) female connectorsmodel VDKR-CONSINGLE SOCKETfor surface mounting,accepts wood fortoeboards.model VDKR-P101PERMANENT/PORTABLE BASEdesigned to meetOSHA temporary flooredge and roof railingrequirements (OSHA1926.500)model VDKR-BASEMODELNUMBERTOP RAILHEIGHTMIDRAILHEIGHTOUTSIDEDIAMETERNET WT.(POUNDS)LIST PRICEEACHLENGTHSTEEL CONSTRUCTIONVDKR-2 42" 21" 24" 1 5 /8" 18/UPS $59.00VDKR-3 42" 21" 36" 1 5 /8" 23/UPS 69.00VDKR-4 42" 21" 48" 1 5 /8" 28 72.00VDKR-5 42" 21" 60" 1 5 /8" 33 82.00VDKR-6 42" 21" 72" 1 5 /8" 38 88.00VDKR-7 42" 21" 84" 1 5 /8" 43 92.00VDKR-8 42" 21" 96" 1 5 /8" 48 101.00ALUMINUM CONSTRUCTIONADKR-2 42" 21" 24" 1 5 /8" 9/UPS $114.00ADKR-3 42" 21" 36" 1 5 /8" 10/UPS 134.00ADKR-4 42" 21" 48" 1 5 /8" 11 157.00ADKR-5 42" 21" 60" 1 5 /8" 13 180.00ADKR-6 42" 21" 72" 1 5 /8" 15 201.00ADKR-7 42" 21" 84" 1 5 /8" 16 223.00ADKR-8 42" 21" 96" 1 5 /8" 18 244.00PIPE SAFETY RAILING OPTIONSMODELNUMBERNET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONVDKR-P101 SINGLE SOCKET (FOUR BOLT HOLES) 7 $23.80VDKR-P102 DOUBLE SOCKET (FOUR BOLT HOLES) 12 28.00VDKR-BASE CAST STEEL BASE 115 253.00VDKR-P107 4" METAL SLEEVE 2 11.00VDKR-BB-F BARRICADE BASE WITH FEET 7 $23.80VDKR-BB-W BARRICADE BASE WITH WHEELS 7 28.90VDKR-G3 THREE FOOT STEEL GATE 23 $63.00VDKR-G4 FOUR FOOT STEEL GATE 35 67.00VDKR-KIT ANCHOR BOLTS FOR CONCRETE (4) 3/8" x 3" 4 $8.00VDKR-CON CONNECTOR KIT 7 22.50RAILING OPTIONS WORK WITH BOTH STEEL & ALUMINUM RAILINGDC-20/UPS/FC-50Self-Closing Steel GatesCustomize your safety railings with Self-Closing Steel Gates. Gates can bemounted from the left or right with the included mounting hardware. Mount tohorizontal rails that measure up to 2" diameter and are spaced 10" to 21" apartcenter to center. Choose from galvanized or yellow powder coat finish. MeetsOSHA 1910.23a requirements. (Railing and base not included.)model PBAR-72-Ymodel PBAR-72-WPhone (800) 348-0868Newmodel PBAR-72-OMODELNUMBEROPENINGWIDTHNET WT.(POUNDS)LIST PRICEEACHMATERIALHEIGHTSPG-26-Y YELLOW 16" to 26" 12" 30 $269.00SPG-26-G GALVANIZED 16" to 26" 12" 30 235.00SPG-40-Y YELLOW 24" to 40" 12" 35 $282.00SPG-40-G GALVANIZED 24" to 40" 12" 35 253.00DC-25/UPS/FC-50Plastic BarriersPortable barriers with removable base feet. Manufactured from virgin HDPEmaterial and includes UV stabilizers for longer life. Top section of each barrierside includes reflective tape. Base feet are 23" long each and are manufacturedfrom black recycled rubber. Hollow barrier design allows for filling with waterfor added weight.MODELNUMBERSIZE(L x H) COLORNET WT.(POUNDS)LIST PRICEEACHPBAR-72-Y 79" x 40" YELLOW 29 $132.00PBAR-72-O 79" x 40" ORANGE 29 132.00PBAR-72-W 79" x 40" WHITE 29 132.00DC-25/UPSwww.vestil.com
143Steel Square Safety HandrailsAn economical way to protect people and machinery. Applications include loadingdocks, floor openings, walkways, and mezzanines. Highly visible safety yellowpowder coat finish. Available with or without toeboards as application requires.MODELNUMBERSQUARETUBE (O.D.)OVERALLHEIGHTMID-RAILHEIGHTNET WT.(POUNDS)LIST PRICEEACHLENGTHRIGID SECTION WITH TOEBOARDSQ-48-TB 1 5 /8" 42" 21" 48" 59 $152.00SQ-60-TB 1 5 /8" 42" 21" 60" 64 191.00SQ-72-TB 1 5 /8" 42" 21" 72" 67 211.00SQ-84-TB 1 5 /8" 42" 21" 84" 72 251.00SQ-96-TB 1 5 /8" 42" 21" 96" 76 283.00SQ-108-TB 1 5 /8" 42" 21" 108" 80 322.00SQ-120-TB 1 5 /8" 42" 21" 120" 84 352.00RIGID SECTION WITHOUT TOEBOARDSQ-48 1 5 /8" 42" 21" 48" 42 $126.00SQ-60 1 5 /8" 42" 21" 60" 48 153.00SQ-72 1 5 /8" 42" 21" 72" 50 173.00SQ-84 1 5 /8" 42" 21" 84" 55 207.00SQ-96 1 5 /8" 42" 21" 96" 60 229.00SQ-108 1 5 /8" 42" 21" 108" 66 268.00SQ-120 1 5 /8" 42" 21" 120" 70 291.00OPTIONAL WIRE MESH (welded on)WM-48 -- 22" -- 48" 18 $46.00WM-60 -- 22" -- 60" 25 49.00WM-72 -- 22" -- 72" 28 52.00WM-84 -- 22" -- 84" 32 59.00WM-96 -- 22" -- 96" 36 66.00WM-108 -- 22" -- 108" 41 73.00WM-120 -- 22" -- 120" 43 79.00OPTIONAL CONNECTION TUBING (†)CSEC-48 1¼" -- -- 48" 14/PR. $76.00CSEC-60 1¼" -- -- 60" 16/PR. 83.00CSEC-72 1¼" -- -- 72" 18/PR. 87.00CSEC-84 1¼" -- -- 84" 20/PR. 95.00CSEC-96 1¼" -- -- 96" 22/PR. 97.00CSEC-108 1¼" -- -- 108" 24/PR. 122.00CSEC-120 1¼" -- -- 120" 25/PR. 144.00OPTIONAL 4" HIGH TOEBOARDTOE-B-48-N -- 4" -- 43½" 17 $29.00TOE-B-60-N -- 4" -- 55½" 21 35.00TOE-B-72-N -- 4" -- 67½" 25 37.00TOE-B-84-N -- 4" -- 79½" 30 46.00TOE-B-96-N -- 4" -- 91½" 34 48.00TOE-B-108-N -- 4" -- 99" 36 66.00TOE-B-120-N* -- 4" -- 111" 42 66.00OPTIONSC-CON CORNER CONNECTORS (†) 10 $41.00S-GATE-60 60" SLIDING GATE 22 138.00M-BUMP 72"L x 10"H BUMPER (HARDWARE INCLUDED) 43 117.00SQ-CAP BLACK END CAP 1 2.50VDKR-KIT CONCRETE ANCHOR BOLTS (4) 3/8" x 3" 4 8.00(†) CONNECTION TUBING IS PRICED & SOLD IN PAIRS DC-20/UPS/FC-50*RECEIVE (2) PIECES 55½" LONG EACH OPTIONAL WIRE MESHseries WMWIRE MESH (welded)FOR HANDRAILseries WMPLASTIC BUMPERmodel M-BUMPCORNER CONNECTORSWITH HARDWAREmodel C-CONOPTIONAL TOEBOARDseries TOE-BCONNECTION TUBINGWITH HARDWAREseries CSEC60" SLIDING GATEmodel S-GATE-60CONCRETE ANCHOR BOLTSmodel VDKR-KITBLACK END CAPmodel SQ-CAPNewPROTECTIVE BARRIERSStainless Steel RailingsCustom configurations are available upon request.Stainless Steel RailingKeep guests flowing in restaurants, schools, offices or other indoor, and outdoorapplications. The unique contemporary design offers a clean look wherever therailing is placed. The free standing units won't rust. Railing includes weightedround base feet, which may easily be removed for storage, and chain interlockingsystem for attaching multiple units together to form long runs.MODELNUMBER LENGTH HEIGHTBASEDIAMETERNET WT.(POUNDS)LIST PRICEEACHSSRAIL-96 96" 42" 12" 55 $262.00DC-20/FC-50/150model SSRAIL-96www.vestil.com Phone (800) 348-0868
144PRAIL-102-GCrowd Control Interlocking BarriersAttractive and functional design ideal for directing personnel. Interlocking portable railing hasmany commercial and industrial applications. Easy to move to meet changing needs. Upright barsare vertically spaced at 5¼" intervals. Each railing includes connectors to attach multiple unitstogether to form long runs. Overall size is 102"L x 40"H. Feet are removable so railing will lay flatfor shipping and storage. Variety of foot styles available. Rugged welded steel construction.PROTECTIVE BARRIERSNewPRAIL-102-YCURVED FEET FLAT FEET WHEELSShown:(2) WBS-42, (2) WBB-14,(1) WBS-CAUTIONNewNewMODELNUMBERGALVANIZED FINISHSTYLERAILDIAMETERFOOTSTYLENET WT.(LBS.)LIST PRICEEACHPRAIL-102-G LIGHT-WEIGHT 1¼" BOTH CURVED 36 $77.00PRAIL-102-G-WW LIGHT-WEIGHT 1¼" BOTH WHEELS 36 90.00PRAIL-102-G-FF LIGHT-WEIGHT 1¼" BOTH FLAT 36 87.00PRAIL-102-G-WF LIGHT-WEIGHT 1¼" (1) WHEEL, (1) FLAT 36 88.00PRAIL-102-G-W LIGHT-WEIGHT 1¼" (1) WHEEL, (1) CURVED 36 88.00PRAIL-102-HD-G HEAVY-DUTY 1 5 /8" BOTH CURVED 56 $114.00PRAIL-102-HD-G-WW HEAVY-DUTY 1 5 /8" BOTH WHEELS 56 127.00PRAIL-102-HD-G-FF HEAVY-DUTY 1 5 /8" BOTH FLAT 56 124.00PRAIL-102-HD-G-WF HEAVY-DUTY 1 5 /8" (1) WHEEL, (1) FLAT 56 125.00PRAIL-102-HD-G-W HEAVY-DUTY 1 5 /8" (1) WHEEL, (1) CURVED 56 125.00POWDER COAT SAFETY YELLOW FINISHPRAIL-102-Y LIGHT-WEIGHT 1¼" BOTH CURVED 36 $94.00PRAIL-102-Y-WW LIGHT-WEIGHT 1¼" BOTH WHEELS 36 107.00PRAIL-102-Y-FF LIGHT-WEIGHT 1¼" BOTH FLAT 36 104.00PRAIL-102-Y-WF LIGHT-WEIGHT 1¼" (1) WHEEL, (1) FLAT 36 105.00PRAIL-102-Y-W LIGHT-WEIGHT 1¼" (1) WHEEL, (1) CURVED 36 105.00PRAIL-102-HD-Y HEAVY-DUTY 1 5 /8" BOTH CURVED 56 $132.00PRAIL-102-HD-Y-WW HEAVY-DUTY 1 5 /8" BOTH WHEELS 56 145.00PRAIL-102-HD-Y-FF HEAVY-DUTY 1 5 /8" BOTH FLAT 56 142.00PRAIL-102-HD-Y-WF HEAVY-DUTY 1 5 /8" (1) WHEEL, (1) FLAT 56 143.00PRAIL-102-HD-Y-W HEAVY-DUTY 1 5 /8" (1) WHEEL, (1) CURVED 56 143.00STAINLESS STEEL TYPE 304 FINISHPRAIL-102-SS LIGHT-WEIGHT 1¼" BOTH CURVED 36 $215.00PRAIL-102-HD-SS HEAVY-DUTY 1 5 /8" BOTH CURVED 53 304.00DC-20/FC-50/150Semi-Permanent BarriersThis attractive, durable barriers have a powder-coat finish over a galvanized finish which provideslong life without rusting, fading, or cracking. Each rail section includes brackets and hardware forconnecting to post. Mount up to two rails per posts. Posts are held in place by pre-drilled heavydutyblack molded rubber base. Overall size of post base is 11¾"W x 15¾"D. Concrete mountinghardware is included with each post base. Railing height when mounted is 36".MODELNUMBER DESCRIPTION DIMENSIONS COLORNET WT.(POUNDS)LIST PRICEEACHSPR-120-W RAILING 120"L WHITE 39 99.00SPR-120-Y RAILING 120"L YELLOW 39 99.00SPR-POST-W POST WITH BASE 39"H WHITE 33 $57.00SPR-POST-Y POST WITH BASE 39"H YELLOW 33 $57.00DC-25/FC-150Web Barrier StakesThe unique barrier head design with spring loaded retractable tape allows for quick set up and easystorage. These stakes are very versatile, leaving you the option of direct ground insertion or usingthe weighted base for use on hard surfaces. Bases can be filled with liquid or sand in order to weightthem down. Different colors and verbiage options available, contact factory. Parts sold individually.WBS-42 & WBB-14WBS-42MODELNUMBER DESCRIPTION DIMENSIONSNET WT.(POUNDS)LIST PRICEEACHWBS-42 STAKE 2" DIAMETER x 42"H 3 $23.00WBB-14 BASE 14" DIAMETER x 5"H 3 35.00WBH-CAUTION REEL, CAUTION 12' LONG 1 $26.00DC-20/UPS/FC-150WBH-CAUTIONPhone (800) 348-0868WBS-42WBH-CAUTIONwww.vestil.com
Indoor Personnel Guidance BarriersKeep lines flowing smoothly with economical personnel guidance barriers.Perfect for restaurants, offices, hospitals, schools, and banks. Ideal for indoorapplications. Series WEB are not interchangeable with series TSB.Wall Mounted Barrier, model WEB-W includes yellow fabric web. The self-retractingweb extends up to 72". Web end will attach to wall-mounted receiver or anotherfloor-mounted barrier. Available in 15' length, model WEB-W-15.Classic Tensabarrier® Web Barrier is seen around the world in various businesses andairports. Standard is a red belt but many belt colors and designs available, contact factory.MODELNUMBERMODELNUMBER DESCRIPTION COLOR DIAMETER HEIGHTNET WT.(POUNDS)NET WT.(LBS.)LIST PRICEEACHDESCRIPTIONWEB-P 40"H POST W/WEB & SELF-REELING TOP (BLACK) 42 $85.00WEB-W WALL MOUNT UNIT WITH RECEPTACLE, 6' LONG 6 83.00WEB-W-15 WALL MOUNT UNIT WITH RECEPTACLE, 15' LONG 15 96.00TSB-7M 13½"D METAL BASE - 7'6"L x 40"H 26 $185.00TSB-13M 13½"D METAL BASE - 13'L x 40"H 26 258.00TSB-NBM 13½"D METAL BASE - NO BELT/ 40" POST ONLY 26 180.00TSB-7B 13½"D BASIC BASE - 7'6"L x 40"H 26 $175.00TSB-13B 13½"D BASIC BASE - 13'L x 40"H 26 240.00TSB-NBB 13½"D BASIC BASE - NO BELT/ 40" POST ONLY 26 162.00DC-20/UPS (4 UNITS OR LESS)/FC-150Plastic Chain BarricadesPortable and lightweight units are easy to position where needed most. Chain simply snaps onto posthooks (two hooks per post). Three standard colors to choose from. Units are easy to assemble withsnap-together parts. Posts are sold four (4) to a box. Chains sold in rolls (each).LIST PRICEPER BOXPCB-W-F FLOOR MT'D POST WHITE 2½" 38½" 32 $96.00PCB-Y-F FLOOR MT'D POST YELLOW 2½" 38½" 32 96.00PCB-B-F FLOOR MT'D POST BLACK 2½" 38½" 32 96.00PCB-W-G GROUND STAKE POST WHITE 2½" 35" 27 $101.00PCB-Y-G GROUND STAKE POST YELLOW 2½" 35" 27 101.00PCB-B-G GROUND STAKE POST BLACK 2½" 35" 27 101.00PCB-W-CN CHAIN WHITE 2" x 50 ft. -- 10 $44.00PCB-Y-CN CHAIN YELLOW 2" x 50 ft. -- 10 44.00PCB-B-CN CHAIN BLACK 2" x 50 ft. -- 10 44.00DC-20/UPS/FC-150Steel Pipe Bollard with Chain SlotsNewWALL MOUNTED BARRIERmodel WEB-W-15Create barriers around workstations, machinery, and outdoor space. Ideal for indoor and outdoorapplications. Easy to assemble. Series BOL-JK has a removable black rubber top cap which exposesfour chain slots while series BOL-JKS has a removable bolt-on steel top cap with socket set-screw.Place chain into chain slots, storing any excess chain inside the bollard, and place cap back ontobollard. The chain slots hold chain connected to other bollards. Base plate includes four pre-drilledmounting holes. Heavy duty welded steel construction. Powder coat safety yellow finish.METAL BASEseries TSB-7Mmodel WEB-PFLOOR MOUNTED POSTSPLASTIC CHAINGROUND STAKEmodel PCB-W-GNew145BASIC BASEseries TSB-7BPROTECTIVE BARRIERSMODELNUMBER TOP CAP STYLE DIAMETER HEIGHTNET WT.(LBS.)LIST PRICEEACHBOL-JK-24-4.5 REMOVABLE RUBBER CAP 4½" 24" 34 $61.00BOL-JK-36-4.5 REMOVABLE RUBBER CAP 4½" 36" 45 79.00BOL-JK-42-4.5 REMOVABLE RUBBER CAP 4½" 42" 50 91.00BOL-JK-48-4.5 REMOVABLE RUBBER CAP 4½" 48" 56 130.00BOL-JK-24-5.5 REMOVABLE RUBBER CAP 5½" 24" 42 $72.00BOL-JK-36-5.5 REMOVABLE RUBBER CAP 5½" 36" 57 92.00BOL-JK-42-5.5 REMOVABLE RUBBER CAP 5½" 42" 69 101.00BOL-JK-48-5.5 REMOVABLE RUBBER CAP 5½" 48" 78 141.00BOL-JKS-24-4.5 REMOVABLE BOLT-ON STEEL CAP 4½" 24" 35 $70.00BOL-JKS-36-4.5 REMOVABLE BOLT-ON STEEL CAP 4½" 36" 46 88.00BOL-JKS-42-4.5 REMOVABLE BOLT-ON STEEL CAP 4½" 42" 51 100.00BOL-JKS-48-4.5 REMOVABLE BOLT-ON STEEL CAP 4½" 48" 57 139.00BOL-JKS-24-5.5 REMOVABLE BOLT-ON STEEL CAP 5½" 24" 43 $82.00BOL-JKS-36-5.5 REMOVABLE BOLT-ON STEEL CAP 5½" 36" 58 102.00BOL-JKS-42-5.5 REMOVABLE BOLT-ON STEEL CAP 5½" 42" 70 111.00BOL-JKS-48-5.5 REMOVABLE BOLT-ON STEEL CAP 5½" 48" 79 151.00BOL-JK-CN6 GALVANIZED PROOF COIL CHAIN, 3 /16" x 6 FT. LONG 3 $6.00BOL-JK-CN15 GALVANIZED PROOF COIL CHAIN, 3 /16" x 15 FT. LONG 6 14.00BOL-ABK-4 CONCRETE ANCHOR BOLTS (4) ¾" x 4" 4 $12.00DC-20/UPS/FC-50REMOVABLE RUBBER CAPseries BOL-JKwww.vestil.com Phone (800) 348-0868
PROTECTIVE BARRIERS146series GRseries GR-PC-YELTUBULAR POSTseries GR-TPseries GR-CRVADJUSTABLE GUARD RAIL BRACKETseries GR-TP-ADJBKTSPRING POSTmodel GR-SPAdjustable from 0 to 90°. Attaches to any standard GR-TP.PLASTIC END CAPmodel GR-CAPFLARED END GUARDmodel GR-TGCONCRETE MOUNTING KITmodel GR-ABKBUFFER END GUARDmodel GR-BGThe above two End Guards can either be welded or boltedonto our Galvanized Guard Rail. Hardware not included.Phone (800) 348-0868Shown with GalvanizedGuard Rail and Plastic End CapsSTRUCTURAL GUARD RAILseries ST-GRNewTUBULAR MOUNTING POSTS WITHDROP-IN STYLE BRACKETSseries STGR-TP-DIGuard Rail SystemsProtect personnel and equipment both visually and physically with our Guard Rail Systems. Theseeconomical systems can be utilized indoors or outdoors. Ideal for protecting corners of buildingsand machinery from fork truck and vehicle damage. Choose between one, two, or three high railsystems. Tubular posts are machined for continuous or perpendicular rail mounting. US D.O.T.guard rail mounting and I-beam posts available, contact factory. Rail mounting hardware includedwith post. Floor mounting kit sold separately. Deduct 5" when overlapping on a shared post.MODELNUMBER HEIGHT LENGTHMOUNTINGPOSTS REQUIREDNET WT.(POUNDS)LIST PRICEEACHRADIUSGALVANIZED GUARD RAIL - STRAIGHT RAILSGR-4 12" 48" 2 -- 30 $56.00GR-6 12" 72" 2 -- 47 84.00GR-8 12" 96" 2 -- 56 118.00GR-10 12" 120" 3 -- 76 144.00GR-12 12" 144" 3 -- 83 153.00GALVANIZED GUARD RAIL includes two drop-in style brackets and hardwareGR-D-4 12" 48" 2 -- 44 $94.00GR-D-6 12" 72" 2 -- 66 123.00GR-D-8 12" 96" 2 -- 89 157.00GR-D-10 12" 120" 3 -- 112 183.00GR-D-12 12" 144" 3 -- 133 192.00POWDER COAT GUARD RAIL - STRAIGHT RAILSGR-4-PC-YEL 12" 48" 2 -- 32 $69.00GR-6-PC-YEL 12" 72" 2 -- 48 105.00GR-8-PC-YEL 12" 96" 2 -- 59 147.00GR-10-PC-YEL 12" 120" 3 -- 79 181.00GR-12-PC-YEL 12" 144" 3 -- 94 191.00POWDER COAT GUARD RAIL includes two drop-in style brackets and hardwareGR-D-4-PC-YEL 12" 48" 2 -- 44 $108.00GR-D-6-PC-YEL 12" 72" 2 -- 66 144.00GR-D-8-PC-YEL 12" 96" 2 -- 89 186.00GR-D-10-PC-YEL 12" 120" 3 -- 112 220.00GR-D-12-PC-YEL 12" 144" 3 -- 133 230.00GALVANIZED GUARD RAIL - CURVED RAILS 90°GR-6-CRV 12" 72" 2 46" 66 $229.00GR-8-CRV 12" 96" 2 61" 87 262.00GR-10-CRV 12" 120" 3 75½" 112 289.00GR-12-CRV 12" 144" 3 91½" 133 297.00GUARD RAIL OPTIONSMODELNUMBERGUARD RAILLEVELSNET WT.(LBS.)LIST PRICEEACHDESCRIPTIONGR-SP SPRING POST - 24" HIGH ONE 21 $92.00GR-TP18 TUBULAR POST - 18" HIGH (10" x 10" base plate) ONE 24 85.00GR-TP42 TUBULAR POST - 42" HIGH (10" x 10" base plate) TWO 43 100.00GR-TP60 TUBULAR POST - 60" HIGH (10" x 10" base plate) THREE 57 119.00GR-TP72 TUBULAR POST - 72" HIGH (10" x 10" base plate) THREE 65 138.00GR-CAP PLASTIC END CAP 7"W x 13½"H x 4"D (Adds 3" to Length) 6 $40.00GR-BG BUFFER END GUARD 48"L x 16"H x 12½"D (Adds 28" to Length) 21 72.00GR-TG FLARED END GUARD 27"L x 18"H x 10"D (Adds 18" to Length) 17 67.00GR-TP-ADJBKT ADJUSTABLE MOUNTING BRACKET (Adds 1-1/8" to Projection) 65 96.00GR-ABK CONCRETE ANCHOR BOLTS (4) ¾" x 4" 4 12.00CUSTOM SIZES AVAILABLE, CONTACT FACTORYDC-20/FC-50Structural Guard Rail SystemsConstructed of structural C-channel 11.5 lbs. per foot for maximum strength and protection. Railingcan be removed in a matter of seconds. Features 10" x 10" base plate with (4) pre-drilled mountingholes. Tubular mounting posts include drop-in style bracket. Available in custom lengths.MODELNUMBER DESCRIPTION HEIGHT LENGTHNET WT.(POUNDS)LIST PRICEEACHST-GR-4 STRUCTURAL GUARD RAIL 8" 48" 56 $54.00ST-GR-6 STRUCTURAL GUARD RAIL 8" 72" 69 86.00ST-GR-8 STRUCTURAL GUARD RAIL 8" 96" 92 123.00ST-GR-10 STRUCTURAL GUARD RAIL 8" 120" 115 154.00ST-GR-12 STRUCTURAL GUARD RAIL 8" 144" 142 163.00STGR-TP-18DI 18" HIGH TUBULAR POST (ACCOMMODATES 1 RAIL) 47 $112.00STGR-TP-42DI 42" HIGH TUBULAR POST (ACCOMMODATES 2 RAIL) 67 150.00STGR-TP-60DI 60" HIGH TUBULAR POST (ACCOMMODATES 3 RAIL) 95 190.00STGR-TP-72DI 72" HIGH TUBULAR POST (ACCOMMODATES 3 RAIL) 116 231.00STGR-BKT-DI EXTRA POST MOUNTING BRACKET 5 30.00DC-20/FC-50www.vestil.com
147Structural Guard Rail - drop-in and bolt-on styleCreate a modular system to protect equipment, inventory, and individuals from damage or injury. Tripleridge corrugated rails are constructed from ⅛" thick material, made for high impact resistance indoors orout. Posts are constructed of ¼" thick material. The steel base plate measures 10" square and is ⅝" thick.Bolts, anchors, washers, and nuts are provided with individual post sections. Provide easy accessibility withour Drop-In Style rails. Slide rail sections into post saddles for simple assembly. Each Drop-In Style railsection includes two brackets. Bolt-On Style rails are designed for permanent installation.MODELNUMBER COLOR HEIGHTGUARDLENGTHMOUNTINGPOSTS REQUIREDNET WT.(POUNDS)LIST PRICEEACHSTRUCTURAL GUARD RAIL SECTION - DROP-IN STYLE (2 BRACKETS INCLUDED PER RAIL)YGR-LO-4 YELLOW 15" 48" 2 54 $121.00YGR-LO-5 YELLOW 15" 60" 2 65 135.00YGR-LO-6 YELLOW 15" 72" 2 74 149.00YGR-LO-7 YELLOW 15" 84" 2 85 164.00YGR-LO-8 YELLOW 15" 96" 2 94 178.00YGR-LO-9 YELLOW 15" 108" 2 105 193.00YGR-LO-10 YELLOW 15" 120" 2 114 208.00GGR-LO-4 GALVANIZED 15" 41 7 /8" 2 54 $146.00GGR-LO-6 GALVANIZED 15" 65 7 /8" 2 74 179.00GGR-LO-8 GALVANIZED 15" 89 7 /8" 2 94 213.00GGR-LO-10 GALVANIZED 15" 113 7 /8" 2 114 249.00STRUCTURAL GUARD RAIL SECTION - BOLT-ON STYLEYGR-B-4 YELLOW 15" 48" 2 44 $104.00YGR-B-5 YELLOW 15" 60" 2 53 118.00YGR-B-6 YELLOW 15" 72" 2 64 132.00YGR-B-7 YELLOW 15" 84" 2 75 146.00YGR-B-8 YELLOW 15" 96" 2 84 160.00YGR-B-9 YELLOW 15" 108" 2 95 175.00YGR-B-10 YELLOW 15" 120" 2 104 189.00GGR-B-4 GALVANIZED 15" 48" 2 44 $124.00GGR-B-6 GALVANIZED 15" 72" 2 64 158.00GGR-B-8 GALVANIZED 15" 96" 2 84 192.00GGR-B-10 GALVANIZED 15" 120" 2 104 227.00RIGID POSTSYGR-TP18 YELLOW 18" RIGID POST 40 $87.00YGR-TP42 YELLOW 42" RIGID POST 65 123.00GGR-TP18 GALVANIZED 18" RIGID POST 40 $105.00GGR-TP42 GALVANIZED 42" RIGID POST 65 147.00YGR-ABK-4 CONCRETE ANCHOR BOLTS (4) ¾" X 4" 4 $12.00CUSTOM SIZES AVAILABLE, CONTACT FACTORYDC-20/FC-50Steel Pipe Safety BollardsBollards can be used both indoors and outdoors to protect work areas, racking and personnel.Molded rubber caps are removable on the 1¾", 4½" and 5½" diameter units. Steel caps arewelded on the 6½" and 8" diameter units. Base plate includes four (4) pre-drilled mounting holes.Mounting kits and replacement caps available. Yellow powder coat finish.POWDER COATBOLT-ON STYLENewseries GGR-TPPOWDER COATDROP-IN STYLEGALVANIZEDBOLT-ON STYLEGALVANIZEDDROP-IN STYLEPROTECTIVE BARRIERSMODELNUMBER FINISH HEIGHTOUTSIDEDIAMETERBASE PLATE(W x L)NET WT.(LBS.)LIST PRICEEACHBOL-24-2 YELLOW POWDER COAT 24" 1¾" 4" x 4" 12 $42.00BOL-36-2 YELLOW POWDER COAT 36" 1¾" 4" x 4" 15 58.00BOL-42-2 YELLOW POWDER COAT 42" 1¾" 4" x 4" 16 66.00BOL-48-2 YELLOW POWDER COAT 48" 1¾" 4" x 4" 22 79.00BOL-24-4.5 YELLOW POWDER COAT 24" 4½" 8" x 8" 34 $55.00BOL-36-4.5 YELLOW POWDER COAT 36" 4½" 8" x 8" 45 73.00BOL-42-4.5 YELLOW POWDER COAT 42" 4½" 8" x 8" 50 85.00BOL-48-4.5 YELLOW POWDER COAT 48" 4½" 8" x 8" 56 124.00BOL-24-5.5 YELLOW POWDER COAT 24" 5½" 8" x 8" 42 $64.00BOL-36-5.5 YELLOW POWDER COAT 36" 5½" 8" x 8" 57 84.00BOL-42-5.5 YELLOW POWDER COAT 42" 5½" 8" x 8" 69 93.00BOL-48-5.5 YELLOW POWDER COAT 48" 5½" 8" x 8" 78 133.00BOL-36-6.5 YELLOW POWDER COAT 36" 6½" 8" x 8" 69 $106.00BOL-42-6.5 YELLOW POWDER COAT 42" 6½" 8" x 8" 83 128.00BOL-48-6.5 YELLOW POWDER COAT 48" 6½" 8" x 8" 94 148.00BOL-36-8.5 YELLOW POWDER COAT 36" 8½" 10" x 10" 84 $122.00BOL-42-8.5 YELLOW POWDER COAT 42" 8½" 10" x 10" 101 136.00BOL-48-8.5 YELLOW POWDER COAT 48" 8½" 10" x 10" 115 149.00BOL-ABK-3 CONCRETE ANCHOR BOLTS (4) 3 /8" x 3" (1¾" DIA. BOLLARDS) 2 $8.00BOL-ABK-4 CONCRETE ANCHOR BOLTS (4) ¾" x 4" (LARGER DIA. BOL) 4 12.00DC-20/UPS/FC-50model BOL-42-2model BOL-42-4.5www.vestil.com Phone (800) 348-0868
148Replaceable Bollard CapsReplace lost or damaged bollard caps. Easy to attach. Rubber cap has serrated tapered teeth forpress-fit installation.PROTECTIVE BARRIERSMOLDED RUBBERseries BOL-CAP-RNewMODELNUMBERMATERIALINNER DIAMETERPIPE FITTINGFITSMODELNET WT.(LBS.)LIST PRICEEACHBOL-CAP-1.75-P PLASTIC 1.38" (1¼" SCH. 40 PIPE) BOL-2 1 $5.30BOL-CAP-4.5-R MOLDED RUBBER 4.26" (4" SCH. 10 PIPE) BOL-4.5 1 6.20BOL-CAP-5.5-R MOLDED RUBBER 5.30" (5" SCH. 10 PIPE) BOL-5.5 1 6.70Special Powder Coat Finishes for Guards & BarriersMODELNUMBER DESCRIPTION COLORRALNUMBERDC-20/UPS/FC-50Now you can select from a variety of colors to fit many different types of bollard installations.Color codes can quickly identify different areas in a factory. For example use red to signal fireextinguishers. To complete your buildings appearance choose from our architectural color palette.Simply add the "SPO" number to your product number and contact factory for current pricing.GLOSSLEVELARCHITECTURAL COLORSSPO-PC-BRN-EB EARTH BROWN DARK BROWN 8017 80%SPO-PC-BRN-KT KHAKI TAN MEDIUM BEIGE 1019 80%SPO-PC-BRN-SB SANDY BEIGE LIGHT BEIGE 1015 80%SPO-PC-BLK-HG BLACK, HIGH GLOSS BLACK, HIGH GLOSS 9005 85%SPO-PC-BLK-SG BLACK, SEMI-GLOSS BLACK, SEMI-GLOSS 9005 35%SPO-PC-GRN-H HUNTER GREEN DARK GREEN 6005 80%SPO-PC-GRN-T TRACTOR GREEN MEDIUM GREEN 6023 90%SPO-PC-GY-SG BATTLE SHIP GREY MEDIUM GREY 7012 90%SPO-PC-GY-MG MACHINE GREY LIGHT GREY 7001 85%DARKBROWNMEDIUMBEIGELIGHTBEIGEBLACKHIGH GLOSSDARKGREENMEDIUMGREENMEDIUMGREYLIGHTGREYNewMODELNUMBER DESCRIPTION COLORRALNUMBERGLOSSLEVELBRIGHT/ALERT COLORSSPO-PC-WT SNOWY WHITE WHITE -- 80%SPO-PC-SR SODA RED RED -- 80%SPO-PC-ORG-C CITRUS ORANGE ORANGE -- 80%SPO-PC-BL-E ERGO BLUE VESTIL BLUE 5005 80%SPO-PC-BG BUBBLE GUM PINK 4003 80%WHITEREDORANGEVESTILBLUEPINKPhone (800) 348-0868www.vestil.com
Surface Mounted Removable Steel Pipe Safety BollardsBollards can be used both indoors and outdoors to protect work areas, racking and personnel. Surfacemounted steel base plate allows for quick and easy bollard removal. Steel base plate is bolted inplace. Guard is easily inserted into base plate then locked in place. Base plate measures 10¼"W x10½"L x 2½" handle height and include four (4) pre-drilled mounting holes. Molded rubber caps areremovable. Powder coated safety yellow finish. Welded steel construction.New149MODELNUMBER DESCRIPTION HEIGHTOUTSIDEDIAMETERNET WT.(LBS.)LIST PRICEEACHBOL-RF-24-4.5 SURFACE MOUNTED BOLLARD 24" 4½" 36 $93.00BOL-RF-36-4.5 SURFACE MOUNTED BOLLARD 36" 4½" 47 112.00BOL-RF-42-4.5 SURFACE MOUNTED BOLLARD 42" 4½" 52 123.00BOL-RF-48-4.5 SURFACE MOUNTED BOLLARD 48" 4½" 58 162.00BOL-RF-24-5.5 SURFACE MOUNTED BOLLARD 24" 5½" 44 $102.00BOL-RF-36-5.5 SURFACE MOUNTED BOLLARD 36" 5½" 59 121.00BOL-RF-42-5.5 SURFACE MOUNTED BOLLARD 42" 5½" 71 130.00BOL-RF-48-5.5 SURFACE MOUNTED BOLLARD 48" 5½" 80 171.00Stainless Steel Pipe Safety BollardsDC-20/UPS/FC-50Bollards can be used both indoors and outdoors to protect work areas, racking and personnel. Steel capsare welded on. Base plate measures 8" x 8" and include four (4) pre-drilled mounting holes. Mountingkits available. 304 stainless steel polished finish.NewMODELNUMBER FINISH HEIGHTMODELNUMBER HEIGHT DIAMETEROUTSIDEDIAMETERBASE PLATEDIAMETERNET WT.(LBS.)NET WT.(POUNDS)LIST PRICEEACHBOL-SS-36-4.5 304 STAINLESS STEEL 36" 4½" 22 $149.00BOL-SS-42-4.5 304 STAINLESS STEEL 42" 4½" 26 169.00BOL-ABK-3 CONCRETE ANCHOR BOLTS (4) 3 /8" x 3" (1¾" DIA. BOLLARDS) 2 $8.00BOL-ABK-4 CONCRETE ANCHOR BOLTS (4) ¾" x 4" (4½" & 5½" DIA. BOL) 4 12.00Chrome-Plated Steel BollardDC-20/UPS/FC-50Improve the image of your facility while protecting people and equipment. Unit is made of steel andfinished with an attractive bright chrome plating for a clean fresh look. The mounting plate is pre-drilledwith (4) ½" diameter holes for quick and easy installation.LIST PRICEEACHCBOL-42-4 42" 4" 8" 23 $89.00CBOL-ABK-3 CONCRETE ANCHOR BOLTS (4) 3 /8" x 3" 2 $12.00DC-20/UPS/FC-50CHROME PLATEDmodel CBOL-42-4PROTECTIVE BARRIERSJumbo Steel Pipe BollardsOversized steel pipe for maximum protection and strength. Bollards can be used both indoors andoutdoors to protect work areas, racking and personnel. Base plate includes four pre-drilled mountingholes. Welded steel cap. Heavy-duty welded steel construction. Powder coated safety yellow finish.MODELNUMBEROUTSIDEDIAMETERBASE PLATEDIAMETERNET WT.(POUNDS)LIST PRICEEACHHEIGHTJBOL-36-12 36" 12" 16" 66 $229.00JBOL-42-12 42" 12" 16" 75 261.00JBOL-48-12 48" 12" 16" 83 287.00BOL-ABK-4 CONCRETE ANCHOR BOLTS (4) ¾" x 4" 4 $12.00DC-20/UPS/FC-50NewOffset Steel BollardsUnique design features offset base plate that won't interfere with traffic. The 8" x 8" base plate includes (4)pre-drilled mounting holes (mounting hardware is sold separately). Removable rubber top cap and black/yellowsafety tape included. Heavy-duty welded steel construction with a powder coat safety yellow finish is standard.MODELNUMBEROUTSIDEDIAMETERBASEPLATENET WT.(POUNDS)LIST PRICEEACHHEIGHTOBOL-35-4.5 35" 4½" 8" x 8" 32 $69.00OBOL-47-4.5 47" 4½" 8" x 8" 41 85.00OBOL-53-4.5 53" 4½" 8" x 8" 46 96.00BOL-ABK-4 CONCRETE ANCHOR BOLTS (4) ¾" x 4" 4 $12.00DC-20/UPS/FC-50www.vestil.com Phone (800) 348-0868
150Pour In Place BollardsMake your bollards permanent by setting them in concrete. The extra length of the Pour in PlaceBollard allows you to maintain the needed height while fixing the bollard in concrete. Bollard comeswith welded anchoring tabs and a removable cap so the bollard can be filled with concrete to increase itsstrength and durability. Powder coated yellow for high visibility.PROTECTIVE BARRIERSREMOVABLEseries BOL-RmodelBOL-R-KYSELF STORINGmodel BOL-SSTOR-42-5.5POUR IN PLACEseries BOLPPNewREMOVABLEORNAMENTAL BOLLARDmodel BOL-OR-40-BKMODELNUMBERMODELNUMBERUSABLEHEIGHTOVERALLHEIGHTBOLLARDDIAMETERNET WT.(POUNDS)LIST PRICEEACHBOL-R-36-5.5 36" 46" 5½" 88 $150.00BOL-R-42-5.5 42" 52" 5½" 96 163.00BOL-R-48-5.5 48" 58" 5½" 103 175.00BOL-R-KL KEY LOCKOUT OPTION 5 $102.00BOL-R-SLV SLEEVE COVER OPTION 8 54.00DC-20/UPS/FC-50MODELUSABLEBOLLARDNET WT. LIST PRICENUMBERHEIGHTDIAMETER(POUNDS) EACHBOL-SSTOR-42-4.5 42" 4½" 163 $277.00MODELNUMBERUSABLEHEIGHTOVERALLHEIGHTUSABLEHEIGHTOUTSIDEDIAMETERBOLLARDDIAMETERNET WT.(POUNDS)NET WT.(POUNDS)LIST PRICEEACHBOLPP-24-5.5 24" 34" 5½" 44 $70.00BOLPP-36-5.5 36" 46" 5½" 59 94.00BOLPP-42-5.5 42" 52" 5½" 73 118.00BOLPP-48-5.5 48" 58" 5½" 88 141.00Removable BollardsDC-20/UPS/FC-50The Removable Bollard comes with a sleeve that can be set in concrete to hold the bollard. When accessis needed into an area that is protected by the bollard, simply lift the bollard out of the sleeve. Replacethe bollard in its sleeve to reinstate the protective barrier. Powder coated yellow for high visibility. Sleeveis included.Self Storing Bollard with Door & LockThis unique bollard is designed to slide down into the ground or floor when not needed. Great forpreventing access to parking areas. Each unit includes a sleeve that can be set in the ground withconcrete. Bollard has a handle in the top to allow for easy lifting and lowering. Lift and twist to lockinto raised position. Twist and lower to return to stored position. Includes locking tab for use withpadlock (padlock not included) to prevent unauthorized operation. Steel construction with powdercoat safety yellow finish.Removable Ornamental Steel BollardDC-20/UPS/FC-50Provide an attractive yet functional barrier to vehicle access and parking. Bollards are 4½" in diameterwhile the rings make the overall diameter 6". Padlock not included. Powder coat black finish.Includes eyes for attaching chain or rope.Model BOL-OR-40-BK, locks into galvanized steel socket that is cemented into the ground. When thebollard is removed, a cover plate protects the hole leaving no protrusion above the surface.Model BOL-OR-40-BK-SM, fits into steel socket that is bolted to ground (mounting hdwr. not included).LIST PRICEEACHMOUNTINGBOL-OR-40-BK UNDERGROUND 40" 4½" 84 $184.00BOL-OR-40-BK-SM SURFACE 46¾" 4½" 84 184.00DC-25/UPS/FC-50MOVABLEmodel BOL-MB-42-5.5Movable Bollard (with Wheels)Movable Bollard provides a portable visual barrier when an area needs temporary protection. Ideal foruse when keeping traffic out of a temporarily hazardous area or area under repair. Can be used indoorsor outdoors. Mold-on-rubber wheels standard. Powder coated yellow for high visibility.MODELUSABLEOUTSIDEWHEEL NET WT. LIST PRICENUMBERHEIGHTDIAMETERSIZE(POUNDS) EACHBOL-MB-42-5.5 42" 5½" 10" 71 $128.00DC-20/UPS/FC-50Phone (800) 348-0868www.vestil.com
151Folding BollardFolding steel barrier post for parking control and security. Bollard is locked in the raised positionwith a padlock (padlock not included). When padlock is removed, bollard may be lowered toground to allow for access. Base plate must be lagged to ground for proper installation (installationhardware not included). Steel construction. Powder coat yellow or galvanized finish.MODELNUMBERDESCRIPTIONEXTENDEDHEIGHTCOLLAPSEDHEIGHTBOLLARDDIAMETERNET WT.(POUNDS)LIST PRICEEACHBOL-FD-36-Y YELLOW 42" 4" 1¾" 20 $83.00BOL-FD-36-G GALVANIZED 42" 4" 1¾" 20 83.00Spring Loaded Steel BollardsDC-25/UPS/FC-50Designed to serve as a visual and audible warning to personnel. Unique spring-loaded designwill bend and not break like rigid bollards. Prevents damage to bollard and equipment. Promoteslong life. Order bollard with or without light/siren option. Light/siren option includes sensitiveswitches that will activate a strobe light and warning siren when contacted. Operates with two 9Vbatteries (not included). Simply slides into open top of bollard. Each bollard is manufactured fromsteel and includes a powder coat safety yellow finish. Bollards measure 42" high with a 2⅛" O.D.BOL-FD-36-YMODELNUMBERNET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONSPBOL-42 SPRING BOLLARD 19 $73.00SPBOL-42-BL SPRING BOLLARD W/ BEEPER & STROBE 32 164.00SPBOL-ABK CONCRETE ANCHOR BOLTS (3) 3 /8" x 3" 2 $8.00Aluminum Smokers BollardDC-20/UPS/FC-50Manufactured from aluminum alloy for an attractive finish. Includes internal storage containerfor holding cigarettes. Easy to empty design. Floor-mounted unit includes pre-drilled mountingholes. Wall mounted unit includes hardware.MODELNUMBER DESCRIPTION HEIGHTOUTSIDEDIAMETERNET WT.(POUNDS)LIST PRICEEACHSMK-F-35A FLOOR MOUNTED 35" 3¼" 13 $135.00SMK-W-19A WALL MOUNTED 19" 3¼" 4 $59.00Smokers BollardsDC-20/UPS/FC-50Heavy-duty steel bollard also functions as a cigarette disposal unit. Cigarette disposable holemeasures 1¼" diameter. Removable top is connected to steel container for holding cigarette butts.Top is lockable with padlock (padlock not included). Includes a durable powder coat safety yellowfinish. Base plate includes four pre-drilled installation holes. Installation hardware sold separately.Optional dome base to hide installation bolts.NewSMK-W-19A HARDWARESPBOL-42-BLBOL-SMKSMK-F-35ASMK-W-19APROTECTIVE BARRIERSMODELNUMBEROUTSIDEDIAMETERBASEPLATENET WT.(POUNDS)LIST PRICEEACHHEIGHTBOL-SMK 35" 4½" 8" x 8" 32 $133.00DOME-4.5 3" 14" -- 8 25.20BOL-ABK-4 CONCRETE ANCHOR BOLTS (4) ¾" x 4" 4 $12.00Smoker StationsDC-20/UPS/FC-50Keep smokers waste under control with these all weather and fire-safe Smoker Stations. Oxygenrestricting design quickly extinguishes cigarettes.Steel - Nylon base buttons prevent damage to surface and base. Top and base are connected withnickel plated brass chain to deter theft. Stainless steel latches for quick alignment when fastening.ADA compliant.Polyethylene - Stainless steel snuffer screen reduces messy look and offers a fast, easy “snuff target” forcigarettes and cigars, resulting in fewer misses for a more attractive smoking area. Compact cartonsized to a small cube to reduce packaging material, inventory space requirements. FM compliant.Shown withoptional DOME-4.5NewMODELNUMBER FINISH/COLOR HEIGHTBASEDIAMETERNET WT.(POUNDS)LIST PRICEEACHSTEEL CONSTRUCTIONSMK-STA-B BRONZE 39" 16" 20 $181.00SMK-STA-C CHARCOAL 39" 16" 20 181.00POLYETHYLENE CONSTRUCTIONSMK-P-CG COOL GRAY 38" 12" 11 $96.00SMK-P-ST SIERRA TAN 38" 12" 11 96.00SMK-P-JB JET BLACK 38" 12" 11 96.00SMK-P-AG ASPEN GREEN 38" 12" 11 96.00DC-20/UPSseries SMK-STAseries SMK-Pwww.vestil.com Phone (800) 348-0868
152Protective Dome Covers for BollardsPrevent accidents and injuries from people tripping over raised bolts. Easy to use device slides overbollards covering mounting hardware and base plate for a nice clean finish. Durable yellow powdercoat finish. Steel construction. No hardware required.MODELNUMBEROUTSIDEDIAMETERNET WT.(POUNDS)LIST PRICEEACHUSE WITHHEIGHTDOME-4.5 4½" DIAMETER BOLLARDS 14" 3" 8 $25.20DOME-5.5 5½" DIAMETER BOLLARDS 14" 3" 9 25.20Plastic Hardware Caps for BollardsDC-20/UPS/FC-50Plastic hardware caps snap over the top of anchor bolts and washers to protect from weathering. Capsalso provide for a cleaner look.PROTECTIVE BARRIERSNewBPC-DM-FGBPC-DA-BBPC-DP-BNewBPC-DR-GYBPC-DC-BPhone (800) 348-0868MODELQUANTITY PER NET WT. LIST PRICENUMBERDESCRIPTIONPACKAGE (POUNDS) PER PKG.BC-B-1.5 SNAPS OVER ANCHOR HARDWARE 4 1 $9.90Plastic BollardMODELNUMBERMODELNUMBERDESCRIPTIONHEIGHTOVERALLHEIGHTOVERALLDIAMETERMODELNUMBER HEIGHT TYPE COLORBASE SIZE(W x L)FITS PIPEDIAMETERFITS PIPEDIAMETERNET WT.(POUNDS)NET WT.(POUNDS)NET WT.(LBS.)DC-20/UPS/FC-50Permanent/Portable design Plastic Bollard features square shaped base and three reflective collars. 3" indiameter. Ideal for crowd control, in plant maintenance, and construction.LIST PRICEEACHPBOL-22 HEAVY DUTY 23" 14" x 14" 24 $21.80DC-25/UPS/FC-125Decorative Aluminum BollardDecorate your office's exterior with this inexpensive, functional and attractive Aluminum Bollard. Rustand corrosion free. Ideal way to protect buildings, windows, loading docks, parking lots, etc.LIST PRICEEACHBOL-ALUM 47¼" 11¾" 6" O.D. 44 $279.00Decorative Bollard CoversDC-25/UPS/FC-125Improve the overall appearance of your facility. Eliminate painting your bollards again. This ¼" thickpolyethylene thermoplastic material slides over your existing steel bollard. Inserts available for the10"-11" diameter covers to fit 6" or 8" pipe, contact factory for details.LIST PRICEEACHBPC-DM-R 52" METRO RED 6" to 6 5 /8" 10 $124.00BPC-DM-FG 52" METRO GREEN 6" to 6 5 /8" 10 124.00BPC-DM-B 52" METRO BLACK 6" to 6 5 /8" 10 124.00BPC-DM-GY 52" METRO GREY 6" to 6 5 /8" 10 124.00BPC-DM-LAC-R 52" METRO W/LIGHT* RED 6" to 6 5 /8" 10 $475.00BPC-DM-LAC-FG 52" METRO W/LIGHT* GREEN 6" to 6 5 /8" 10 475.00BPC-DM-LAC-B 52" METRO W/LIGHT* BLACK 6" to 6 5 /8" 10 475.00BPC-DM-LAC-GY 52" METRO W/LIGHT* GREY 6" to 6 5 /8" 10 475.00BPC-DM-LUV-R 52" METRO W/LIGHT** RED 6" to 6 5 /8" 10 $413.00BPC-DM-LUV-FG 52" METRO W/LIGHT** GREEN 6" to 6 5 /8" 10 413.00BPC-DM-LUV-B 52" METRO W/LIGHT** BLACK 6" to 6 5 /8" 10 413.00BPC-DM-LUV-GY 52" METRO W/LIGHT** GREY 6" to 6 5 /8" 10 413.00BPC-DA-R 52" ARCH RED 6" to 6 5 /8" 9 $105.00BPC-DA-FG 52" ARCH GREEN 6" to 6 5 /8" 9 105.00BPC-DA-B 52" ARCH BLACK 6" to 6 5 /8" 9 105.00BPC-DA-GY 52" ARCH GREY 6" to 6 5 /8" 9 105.00BPC-DP-R 49" PAWN RED 10" to 11" 24 $193.00BPC-DP-FG 49" PAWN GREEN 10" to 11" 24 193.00BPC-DP-B 49" PAWN BLACK 10" to 11" 24 193.00BPC-DP-GY 49" PAWN GREY 10" to 11" 24 193.00BPC-DC-R 52" CINCO RED 10" to 11" 18 $193.00BPC-DC-FG 52" CINCO GREEN 10" to 11" 18 193.00BPC-DC-B 52" CINCO BLACK 10" to 11" 18 193.00BPC-DC-GY 52" CINCO GREY 10" to 11" 18 193.00BPC-DR-R 52" RIBBED RED 10" to 11" 24 $193.00BPC-DR-FG 52" RIBBED GREEN 10" to 11" 24 193.00BPC-DR-B 52" RIBBED BLACK 10" to 11" 24 193.00BPC-DR-GY 52" RIBBED GREY 10" to 11" 24 193.00*AC WIRED LIGHT ON TOP OF COVERDC-20/UPS/FC-125**SOLAR POWERED LIGHT ON TOP OF COVERwww.vestil.com
153Bollard/Post CoversThis durable poly sleeve will minimize maintenance and improve appearance.Covers are ⅛" thick. Units slide over existing bollards. No hardware needed.MODELNUMBERHEIGHTOUTSIDEDIAMETERINSIDEDIAMETERNET WT.(POUNDS)LIST PRICEEACHBPC-4 52" 5" 4 7 /8" 5 $35.00BPC-7 52" 7 1 /8" 7" 6 38.00DC-25/UPS/FC-70Plastic Bollard CoversEliminate the need for costly scraping and painting of unsightly bollards. The low density polyethylenethermoplastic molded sleeves slide over existing bollards. Covers are ¼" thick. No hardware needed.Additional sizes, thicknesses, and colors available. Contact factory.MODELNUMBERUSE WITHMODELINSIDEDIAMETERNET WT.(POUNDS)LIST PRICEEACHLIST PRICE4 OR MOREHEIGHTBPC-24-4.5 BOL-24-4.5 24" 4 13 /16" 4 $59.00 $56.00BPC-36-4.5 BOL-36-4.5 36" 4 13 /16" 6 59.00 56.00BPC-42-4.5 BOL-42-4.5 42" 4 13 /16" 8 59.00 56.00BPC-48-4.5 BOL-48-4.5 48" 4 13 /16" 11 59.00 56.00BPC-24-5.5 BOL-24-5.5 24" 5 7 /8" 6 $66.00 $63.00BPC-36-5.5 BOL-36-5.5 36" 5 7 /8" 9 66.00 63.00BPC-42-5.5 BOL-42-5.5 42" 5 7 /8" 11 66.00 63.00BPC-48-5.5 BOL-48-5.5 48" 5 7 /8" 15 66.00 63.00Low Profile Rack GuardsMODELNUMBER FINISH HEIGHT LENGTHOUTSIDEDIAMETERNET WT.(POUNDS)DC-20/UPS/FC-70May be used either indoors or outdoors to protect valuable pallet racking, machinery, and personnel.Available with a yellow powder coat or 304 stainless steel polished finish. Two base plates with fourpre-drilled mounting holes in each plate. Welded steel construction.LIST PRICEEACHLPRO-36-9-2 YELLOW POWDER COAT 9" 36" 1 5 /8" 22/UPS $59.00LPRO-48-9-2 YELLOW POWDER COAT 9" 48" 1 5 /8" 26/UPS 71.00LPRO-36-16-2 YELLOW POWDER COAT 16" 36" 1 5 /8" 28/UPS 75.00LPRO-48-16-2 YELLOW POWDER COAT 16" 48" 1 5 /8" 32/UPS 86.00LPRO-36-9-4 YELLOW POWDER COAT 9" 36" 4½" 48/UPS $122.00LPRO-48-9-4 YELLOW POWDER COAT 9" 48" 4½" 60/UPS 135.00LPRO-60-9-4 YELLOW POWDER COAT 9" 60" 4½" 73 148.00LPRO-72-9-4 YELLOW POWDER COAT 9" 72" 4½" 85 162.00LPRO-92-9-4 YELLOW POWDER COAT 9" 92" 4½" 133 264.00LPRO-144-9-4 YELLOW POWDER COAT 9" 144" 4½" 193 297.00LPRO-36-16-4 YELLOW POWDER COAT 16" 36" 4½" 64/UPS 132.00LPRO-48-16-4 YELLOW POWDER COAT 16" 48" 4½" 73/UPS 152.00LPRO-SS-36-9-4 304 STAINLESS STEEL 9" 36" 4½" 33/UPS $389.00LPRO-SS-48-9-4 304 STAINLESS STEEL 9" 48" 4½" 39/UPS 418.00LPRO-SS-36-16-4 304 STAINLESS STEEL 16" 36" 4½" 41/UPS 389.00LPRO-SS-48-16-4 304 STAINLESS STEEL 16" 48" 4½" 47/UPS 440.00LPRO-ABK-3 CONCRETE ANCHOR BOLTS (8) 3 /8" x 3" (1 5 / 8 " DIA.) 4/UPS $16.00LPRO-ABK-4 CONCRETE ANCHOR BOLTS (8) ¾" x 4" (4½" DIA.) 8/UPS 24.00DC-20/UPS/FC-50series LPRO-SSNewPROTECTIVE BARRIERSFloor Stop BollardUnique design offers horizontal crash protection. Unit is easily inserted into base plates then locked intoplace. Base plate includes four pre-drilled mounting holes. Removable black rubber end caps. Welded steelconstruction with yellow powder coat finish.MODELNUMBER DESCRIPTION HEIGHT LENGTHOUTSIDEDIAMETERNET WT.(POUNDS)LIST PRICEEACHFSBOL-24 FLOOR STOP BOLLARD 5" 24" 4½" 36/UPS $75.00FSBOL-36 FLOOR STOP BOLLARD 5" 36" 4½" 47/UPS 93.00FSBOL-42 FLOOR STOP BOLLARD 5" 42" 4½" 52/UPS 105.00FSBOL-48 FLOOR STOP BOLLARD 5" 48" 4½" 58/UPS 144.00DC-20/UPS/FC-50Newwww.vestil.com Phone (800) 348-0868
154High Profile Machinery GuardsHeavy-duty welded steel construction for protecting racks, building walls, expensive equipment, and hundredsof other applications. All 42" high units include a 21" mid-rail to comply with OSHA requirements. Availablewith a yellow powder coat or 304 stainless steel polished finish. Two base plates with four pre-drilled mountingholes in each plate.PROTECTIVE BARRIERSHPRO-48-36-4series HPRO-SSNewNewMODELNUMBER FINISH HEIGHT LENGTHOUTSIDEDIAMETERNET WT.(POUNDS)LIST PRICEEACHHPRO-36-24-2 YELLOW POWDER COAT 24" 36" 1 5 /8" 30/UPS $71.00HPRO-48-24-2 YELLOW POWDER COAT 24" 48" 1 5 /8" 40/UPS 80.00HPRO-36-36-2 YELLOW POWDER COAT 36" 36" 1 5 /8" 38 90.00HPRO-48-36-2 YELLOW POWDER COAT 36" 48" 1 5 /8" 48 100.00HPRO-36-42-2 YELLOW POWDER COAT 42" 36" 1 5 /8" 42 97.00HPRO-48-42-2 YELLOW POWDER COAT 42" 48" 1 5 /8" 52 108.00HPRO-36-24-4 YELLOW POWDER COAT 24" 36" 4½" 53/UPS $124.00HPRO-48-24-4 YELLOW POWDER COAT 24" 48" 4½" 69/UPS 147.00HPRO-36-36-4 YELLOW POWDER COAT 36" 36" 4½" 74 150.00HPRO-48-36-4 YELLOW POWDER COAT 36" 48" 4½" 82 162.00HPRO-36-42-4 YELLOW POWDER COAT 42" 36" 4½" 89 150.00HPRO-48-42-4 YELLOW POWDER COAT 42" 48" 4½" 93 171.00HPRO-60-42-4 YELLOW POWDER COAT 42" 60" 4½" 98 192.00HPRO-72-42-4 YELLOW POWDER COAT 42" 72" 4½" 102 213.00HPRO-SS-36-36-4 304 STAINLESS STEEL 36" 36" 4½" 74 $489.00HPRO-SS-48-36-4 304 STAINLESS STEEL 36" 48" 4½" 82 529.00HPRO-SS-36-42-4 304 STAINLESS STEEL 42" 36" 4½" 89 491.00HPRO-SS-48-42-4 304 STAINLESS STEEL 42" 48" 4½" 93 557.00HPRO-ABK-3 CONCRETE ANCHOR BOLTS (8) 3 /8" x 3" (1 5 / 8 " DIA.) 4 $16.00HPRO-ABK-4 CONCRETE ANCHOR BOLTS (8) ¾" x 4" (4½" DIA.) 8 24.00MODELNUMBER DESCRIPTION HEIGHT LENGTHOUTSIDEDIAMETERNET WT.(POUNDS)DC-20/UPS/FC-50Surface Mounted RemovableHigh Profile Machinery Guards & Low Profile Rack GuardsSurface-mounted steel base plates allow for quick and easy guard removal. May be used either indoors oroutdoors. Steel base plates are bolted in place. Guard is easily inserted into base plates then locked into place.Base plate includes four pre-drilled mounting holes. Welded steel construction with yellow powder coat finish.LIST PRICEEACHLPRO-RF-36-9-4 LOW PROFILE GUARD 9" 36" 4½" 52/UPS $230.00LPRO-RF-48-9-4 LOW PROFILE GUARD 9" 48" 4½" 64/UPS 242.00LPRO-RF-36-16-4 LOW PROFILE GUARD 16" 36" 4½" 68/UPS 240.00LPRO-RF-48-16-4 LOW PROFILE GUARD 16" 48" 4½" 77/UPS 259.00HPRO-RF-36-24-4 HIGH PROFILE GUARD 24" 36" 4½" 57/UPS $207.00HPRO-RF-48-24-4 HIGH PROFILE GUARD 24" 48" 4½" 73/UPS 232.00HPRO-RF-36-36-4 HIGH PROFILE GUARD 36" 36" 4½" 78 233.00HPRO-RF-48-36-4 HIGH PROFILE GUARD 36" 48" 4½" 86 245.00HPRO-RF-36-42-4 HIGH PROFILE GUARD 42" 36" 4½" 93 233.00HPRO-RF-48-42-4 HIGH PROFILE GUARD 42" 48" 4½" 97 254.00Adjustable Width Rack GuardsDC-20/UPS/FC-50Protect the row ends of tandem pallet racking with this heavy-duty, welded steel adjustable rack guard.Slide in design has a variable length range of 62" to 108". Includes steel mounting plates with 1" diameterholes to safely secure unit to floor. Powder coated with safety yellow finish.MODELNUMBERADJUSTABLELENGTHNET WT.(POUNDS)LIST PRICEEACHHEIGHTARMG-24 62" to 108" 24" 203 $345.00ARMG-ABK CONCRETE ANCHOR BOLTS (12) ¾" x 4" 12 36.00DC-20/FC-50NewPallet Rack End GuardProtects pallet rack frame ends with these heavy duty steel guards. For use with 42" deep frames only.Includes five pre-drilled mounting holes. Powder-coat yellow finish.MODELNUMBER WIDTH HEIGHTNET WT.(POUNDS)LIST PRICEEACHPREG-42 42" 12" 89 $213.00PREG-ABK CONCRETE ANCHOR BOLTS (5) ¾" x 4" 3 $15.00DC-20/FC-50Phone (800) 348-0868www.vestil.com
Heavy Duty Pallet Rack GuardHeavy duty steel construction for use when protecting rack. Offset base plates allow closerplacement to racking legs. Heavy structural mid-rail provides extra protection against impacts.Powder coat yellow finish, highly visible.MODELNUMBER WIDTH HEIGHTNET WT.(POUNDS)LIST PRICEEACHHDPRG-42 42" 42" 98 $198.00HDPRG-ABK CONCRETE ANCHOR BOLTS (6) ¾" x 4" 6 $18.00DC-20/FC-50New155Multi-Purpose BarricadesNewThese polyethylene plastic barricades can be linked together to enclose any shape or sizearea. They are lightweight, and fold away for easy storage. Made from durable polyethyleneplastic, and are suitable for both indoor and outdoor applications. The barricades are easy toclean, and bright yellow for high visability. Permanent mold in graphics with caution sign isstandard. Available in two and three panel units.MODELNUMBERWIDTH OFEACH PANEL HEIGHT LENGTH THICKNESSNUMBEROF PANELSNET WT.(POUNDS)LIST PRICEEACHHG-2F 37" 36" 74" 1" 2 15 $135.00HG-3F 37" 36" 111" 1" 3 23 204.00Poly BarricadesMODELNUMBER LENGTH DEPTH HEIGHT COLORUNIFORM FILLCAPACITYNET WT.(POUNDS)DC-20/UPS/FC-250The color of these barricades is ideal for applications where appearance is an issue. Displays wellat municipalities, parks, amusement parks, and parking areas. Ideal for traffic and crowd control.Lightweight and easy to fill with liquid or sand for added weight. Features a 4" fill cap and 2" drain.Approximate filled weight is 520 pounds. Additional colors available.LIST PRICEEACHVPC-5-ORANGE 60" 16" 24" ORANGE 60 GAL. 33 $121.00VPC-6-ORANGE 72" 16" 35" ORANGE 80 GAL. 70 259.00VPC-6G 72" 16" 35" GRAY 80 GAL. 70 $335.00DC-20/FC-250BarricadesBlock aisle ways, parking spaces, or other unauthorized access areas with Barricades.Designed for quick set up and convenient storage.NewThe A-Frame Barricade can be filled with water or sand for increased stability. Features threereflectors. Easy to assemble/disassemble and store.The Post Barrier has four visual reflectors on each side. Anchoring is easy with pre-drilled holes.Units can be interlockedwhen more than oneunit is needed.PROTECTIVE BARRIERSMODELNUMBER WIDTH HEIGHTBASEWIDTHNET WT.(POUNDS)LIST PRICEEACHAFB-44 44 5 /8" 31¾" 19½" 5 $29.90PBOL-24 -- 22 5 /8" 13¼" 8 $26.75DC-25/UPS/FC-70Traffic ConesThese durable all weather cones are constructed from 100% PVC for long life. Their constructionprohibits fading, cracking. Will retain its shape for years of reliable service. All models feature one piecemold except model TC-30, which features a removable weighted bottom. High-visibility orange in color.Suffix -2R features two reflectors around the traffic cone.AFB-44PBOL-24MODELNUMBER DESCRIPTION HEIGHTBASE(W x L)PIECES PERCARTONNET WT.(LBS.)LIST PRICEPER CARTONTC-30 ECONOMY 30¾" 17¾" x 17¾" 5 17 $46.00TC-28-HD-2R HEAVY DUTY 27½" 14" x 14" 1 10 33.00TC-28-SD-2R STANDARD DUTY 27½" 14" x 14" 1 6 22.00TC-28-SD STANDARD DUTY 27½" 14" x 14" 1 6 18.00TC-18-SD STANDARD DUTY 17¾" 10¾" x 10¾" 1 4 14.00DC-20/UPS/FC-70TC-30TC-28-HD-2Rwww.vestil.com Phone (800) 348-0868
156Surface Mount Flexible StakesIdeal for high traffic and high impact locations. Constructed of polycarbonate extrusion and flexible hingewhich makes it virtually indestructible. Easy four part assembly which is the post and hinge, 8" diameter base,grips and pin. Quick to install, they can be mounted to concrete, asphalt, wood and other hard surfaces usingappropriate hardware (not included). FAA approved. Other colors and styles are available.NewMODELNUMBEROVERALLHEIGHT WIDTH COLORNET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONVGLT-16-2F-W FLEXIBLE STAKE 24" 3¼" WHITE 3 $32.00VGLT-16-2F-Y FLEXIBLE STAKE 24" 3¼" YELLOW 3 32.00VGLT-16-2F-O FLEXIBLE STAKE 24" 3¼" ORANGE 3 32.00VGLT-16-3F-W FLEXIBLE STAKE 36" 3¼" WHITE 3.5 $41.00VGLT-16-3F-Y FLEXIBLE STAKE 36" 3¼" YELLOW 3.5 41.00VGLT-16-3F-O FLEXIBLE STAKE 36" 3¼" ORANGE 3.5 41.00VGLT-16-4F-W FLEXIBLE STAKE 48" 3¼" WHITE 4 $45.00VGLT-16-4F-Y FLEXIBLE STAKE 48" 3¼" YELLOW 4 45.00VGLT-16-4F-O FLEXIBLE STAKE 48" 3¼" ORANGE 4 45.00VGLT-RT-W* REFLECTIVE SHEETING 6" 3" WHITE 0.5 $2.00VGLT-RT-Y* REFLECTIVE SHEETING 6" 3" YELLOW 0.5 2.00VGLT-RT-O* REFLECTIVE SHEETING 6" 3" ORANGE 0.5 2.00*SOLD EACH / ONE PER SIDEDC-20/UPS/FC-250PROTECTIVE BARRIERSNew90° Triple Elbow GuardsProtect the corners of machinery, buildings, and offices. The 90° bend fits snug around corners toprovide the ultimate protection against potential damage from fork trucks or other mobile equipment.Base plate size is 8" x 8". Welded steel construction. Powder coated safety yellow.MODELNUMBER DESCRIPTION HEIGHT LENGTHOUTSIDEDIAMETERNET WT.(POUNDS)LIST PRICEEACHTEG-24-24-4 TRIPLE ELBOW GUARD 24" 24" 4½" 69 $241.00TEG-24-36-4 TRIPLE ELBOW GUARD 36" 24" 4½" 82 261.00TEG-24-42-4 TRIPLE ELBOW GUARD 42" 24" 4½" 90 270.00TEG-30-24-4 TRIPLE ELBOW GUARD 24" 30" 4½" 74 $255.00TEG-30-36-4 TRIPLE ELBOW GUARD 36" 30" 4½" 88 275.00TEG-30-42-4 TRIPLE ELBOW GUARD 42" 30" 4½" 95 287.00TEG-ABK CONCRETE ANCHOR BOLTS (8) ¾" x 4" 8 $24.00Triple Elbow Guards with Center SupportMODELNUMBER HEIGHT LENGTHMODELNUMBERINSIDEWIDTHOUTSIDEDIAMETERINSIDELENGTHNET WT.(POUNDS)NET WT.(POUNDS)DC-20/FC-50Heavy-duty welded steel construction includes three support legs for extra strength and protection. The90° bend fits snug around corners to provide the ultimate protection against potential damage from forktrucks or other mobile equipment. Base plate size is 4" x 4" with (4) 7 /16"" diameter holes. Manufacturedfrom 1⅝" diameter steel pipe. Powder coated safety yellow with black and yellow safety tape.LIST PRICEEACHTEGC-24-24-2 24" 24" 2" 58 $171.00TEGC-24-36-2 36" 24" 2" 69 188.00TEGC-24-42-2 42" 24" 2" 76 198.00TEGC-30-24-2 24" 30" 2" 63 $192.00TEGC-30-36-2 36" 30" 2" 74 195.00TEGC-30-42-2 42" 30" 2" 80 212.00TEGC-ABK CONCRETE ANCHOR BOLTS (12) 3 /8" x 3" 6 $24.00Heavy Duty Column ProtectorsDC-20/FC-50Two-piece design for protecting in-plant columns and other vertical support members. Hardwareis included to connect both pieces together. Heavy-duty welded steel construction. Each base plateincludes (4) pre-drilled mounting holes. Concrete installation hardware sold separately. Powder coatsafety yellow finish.LIST PRICEEACHHEIGHTCGP-24 24" 20" 20" 132 $246.00CGP-36 36" 20" 20" 150 311.00CGP-48 48" 20" 20" 168 374.00CGP-ABK CONCRETE ANCHOR BOLTS (8) ¾" x 4" 8 $24.00DC-20/FC-50Phone (800) 348-0868www.vestil.com
Modular Guard SystemsModular Guard System can be ordered to fit almost any application. Designed forquick and easy assembly. Railing sections are installed and secured to each post with asingle bolt. Select from different railing lengths to custom fit your application. Railingsystems are made from heavy-duty 3" square steel tubing. Wall mounting posts may beused to secure guard assembly to a wall. Durable safety yellow powder coat finish. Steelconstruction. All components sold separately.RAILING SECTIONMODELNUMBEREFFECTIVELENGTHOVERALLLENGTHSQUARETUBE (O.D.)NET WT.(POUNDS)LIST PRICEEACHMG-R-4 48" 56" 3" 26 $43.00MG-R-6 72" 80" 3" 38 60.00MG-R-8 96" 104" 3" 49 79.00MG-R-10 120" 128" 3" 60 96.00MG-R-12 144" 152" 3" 71 115.00MOUNTING POSTSMODELNUMBER DESCRIPTION STYLEOVERALLHEIGHTNET WT.(POUNDS)DC-20/FC-50LIST PRICEEACHMG-CP-36-1 CORNER POST SINGLE RAIL 36" 37 $88.00MG-CP-36-2 CORNER POST DOUBLE RAIL 36" 49 117.00MG-SP-36-1 STRAIGHT POST SINGLE RAIL 36" 37 $75.00MG-SP-36-2 STRAIGHT POST DOUBLE RAIL 36" 49 102.00MOUNTING OPTIONSMODELNUMBERNET WT.(POUNDS)DC-20/FC-50LIST PRICEEACHDESCRIPTIONMG-WP-A WALL MOUNTING POST - POST TUBING 7 $15.00MG-WP-B WALL MOUNTING POST - RAILING SECTION TUBING 8 20.00MG-KIT CONCRETE ANCHOR BOLTS (4 ANCHORS) 4 $12.00Gantry/Jib GuardMODELNUMBERINSIDEWIDTHINSIDEDEPTHOVERALLHEIGHTDC-20/FC-50Prevent costly damage to steel columns, pipe, and tubing from carts and fork trucks. Solid steeldesign is constructed of ⅜" thick material for maximum strength. Ideal for fixed jibs and gantrycranes. Mounting plate measures 17" wide by 13½" deep and features (6) pre-drilled mounting holes.NET WT.(POUNDS)LIST PRICEEACHCG-42 10-1/4" 10-1/8" 42" 150 $244.00CG-ABK CONCRETE ANCHOR BOLTS (6) ¾" x 4" 6 $18.00Individual Components areInstalled On-SiteDOUBLE RAIL CORNER POSTmodel MG-CP-36-2DC-20/FC-50WALL MOUNTseries MG-WP157Fits against walls to protectdrains or pipingSINGLE RAIL STRAIGHT POSTmodel MG-SP-36-1RAILING SECTIONseries MG-RPROTECTIVE BARRIERSHexagonal Column GuardTwo piece hexagonal column/post guard allows for easy installation. Heavy-duty ¼" thick steel plateconstruction with a powder coated safety yellow finish. Installation hardware included. Concrete lagbolts sold separately.NewMODELNUMBEROVERALLHEIGHTFITS COLUMNSMEASURINGNET WT.(POUNDS)LIST PRICEEACHHEX-48 48" 11" x 11" SQUARE / 15" ROUND 200 $385.00HEX-60 60" 11" x 11" SQUARE / 15" ROUND 245 475.00HEX-ABK CONCRETE ANCHOR BOLTS (6) ¾" x 4" 6 $18.00Concrete Anchoring HardwareMODELNUMBER DESCRIPTION SIZENET WT.(POUNDS)DC-20/FC-50Install Rack, Column, and Machinery Guards to concrete surfaces quickly and easily. To install,mark hole placement of guard, drill into concrete with Masonry Bit, realign guard and secure withanchor bolt.LIST PRICEEACHHKIT-1 (1) MASONRY BIT ¾" 4 $13.00HKIT-2 (2) ANCHOR BOLTS ¾"D x 4"L 2 6.00HKIT-4 (4) ANCHOR BOLTS ¾"D x 4"L 4 12.00DC-20/UPS/FC-70www.vestil.com Phone (800) 348-0868
PROTECTIVE BARRIERS158model VPP-5Rvestilgreenmodel DSG-48vestilgreenNewNewStructural Column ProtectorsProvide wrap around protection to columns, pipes, and tubing to prevent damage. Constructed of UVprotected polyethylene. Units can be stacked two high. Easy to assemble with nylon fasteners included.MODELNUMBERINSIDEOPENINGOUTSIDEWIDTHOVERALLHEIGHTUNIFORMCAPACITY (LBS)NET WT.(POUNDS)LIST PRICEEACHSTANDARDVB-6 6" SQUARE 26" 42" 7000 @ 6 MPH 46 $184.00VB-8 8" SQUARE 26" 42" 7000 @ 6 MPH 46 184.00VB-10 10" SQUARE 26" 42" 7000 @ 6 MPH 46 184.00VB-12 12" SQUARE 26" 42" 7000 @ 6 MPH 46 184.00VB-8-10 8" x 10" RECT. 26" 42" 7000 @ 6 MPH 46 $184.00VB-9R 9" ROUND 26" 42" 7000 @ 6 MPH 46 $184.00SLIM DESIGNVBS-3 3" SQUARE 12" 42" 7000 @ 6 MPH 18 $108.00VBS-4 4" SQUARE 12" 42" 7000 @ 6 MPH 18 108.00VBS-5 5" SQUARE 12" 42" 7000 @ 6 MPH 18 108.00VBS-6 6" SQUARE 12" 42" 7000 @ 6 MPH 18 108.00LOW PROFILEVPUP-6 6" SQUARE 24" 24" 7000 @ 6 MPH 28 $94.00VPUP-8 8" SQUARE 24" 24" 7000 @ 6 MPH 28 94.00VPUP-10 10" SQUARE 24" 24" 7000 @ 6 MPH 28 94.00VPUP-12 12" SQUARE 24" 24" 7000 @ 6 MPH 28 94.00"GREEN" 100% RECYCLED MATERIALVB-6-GRN 6" SQUARE 26" 42" 7000 @ 6 MPH 46 $184.00VB-8-GRN 8" SQUARE 26" 42" 7000 @ 6 MPH 46 $184.00VB-10-GRN 10" SQUARE 26" 42" 7000 @ 6 MPH 46 $184.00VB-12-GRN 12" SQUARE 26" 42" 7000 @ 6 MPH 46 $184.00VB-8-10-GRN 8" x 10" RECT. 26" 42" 7000 @ 6 MPH 46 $184.00VB-9R-GRN 9" ROUND 26" 42" 7000 @ 6 MPH 46 $184.00VBS-3-GRN 3" SQUARE 12" 42" 7000 @ 6 MPH 18 $108.00VBS-4-GRN 4" SQUARE 12" 42" 7000 @ 6 MPH 18 108.00VBS-5-GRN 5" SQUARE 12" 42" 7000 @ 6 MPH 18 108.00VBS-6-GRN 6" SQUARE 12" 42" 7000 @ 6 MPH 18 108.00VPUP-6-GRN 6" SQUARE 24" 24" 7000 @ 6 MPH 28 $94.00VPUP-8-GRN 8" SQUARE 24" 24" 7000 @ 6 MPH 28 94.00VPUP-10-GRN 10" SQUARE 24" 24" 7000 @ 6 MPH 28 94.00VPUP-12-GRN 12" SQUARE 24" 24" 7000 @ 6 MPH 28 94.00Pipe and Downspout ProtectorsDC-20/FC-250Protect down spouts and pipes attached to buildings from damage caused by fork trucks, vehicles, andmowers. Our Steel Down Spout Guards fit around standard down spouts. The Poly Pipe Protector fits pipesup to 5" diameter. Easy bolt on installation - installation hardware not included. Choose steel for optimumstrength or polyethylene for protection with deflection. Steel model is powder coated safety yellow.model VCW-RD-RNDNewEASY TOASSEMBLEMODELNUMBERINSIDE(W x D)OVERALL SIZE(W x D x H)NET WT.(POUNDS)LIST PRICEEACHMATERIALVPP-5R POLYETHYLENE 5" x 5" 12" x 6" x 42" 6 $56.00VPP-5R-GRN POLYETHYLENE 5" x 5" 12" x 6" x 42" 6 56.00DSG-48 STEEL 6" x 6" 10" x 6½" x 42" 63 $84.00Column WrapDC-20/UPS/FC-50The Column Wrap quickly and effortlessly slides around your square or round columns with itsunique locking device. Never paint again, made of polyethylene thermoplastic, which increasescolumn visibility and has low maintenance.model VCW-GY-11-SQPhone (800) 348-0868MODELNUMBEROVERALLHEIGHTFITS COLUMNSMEASURING DESCRIPTION COLORNET WT.(POUNDS)LIST PRICEEACHVCW-RD-RND 60" 8" ROUND RED 14 $90.00VCW-GY-RND 60" 8" ROUND GREY 14 90.00VCW-RD-11-SQ 60" 11" SQUARE RED 12 $84.00VCW-GY-11-SQ 60" 11" SQUARE GREY 12 84.00VCW-YL-11-SQ 60" 11" SQUARE YELLOW 12 84.00VCW-BL-11-SQ 60" 11" SQUARE BLACK 12 84.00VCW-RD-20-SQ 60" 20" SQUARE RED 12 $84.00VCW-GY-20-SQ 60" 20" SQUARE GREY 12 84.00VCW-YL-20-SQ 60" 20" SQUARE YELLOW 12 84.00VCW-BL-20-SQ 60" 20" SQUARE BLACK 12 84.00DC-20/UPS/FC-250www.vestil.com
Light Pole Base ProtectorsQuickly and inexpensively enhance the visual appearance of your parking lot, lower your long termmaintenance costs, while offering safety to your customers and their cars. Designed to fit around a 24"diameter light pole base. The ring assembly allows it to fit any height, and the top is easily customizedto fit round or square light poles. Each ring is 9½" high. Unit comes in half circles that are snappedtogether around the base and then stacked on top of each other. These are easily installed, without theuse of tools. When ordering specify; color, height, and light pole diameter for top piece.MODELNUMBERCEMENT BASEDIAMETEROVERALLHEIGHTNET WT.(POUNDS)LIST PRICEEACHMATERIALLPBP-24 POLYPROPYLENE 24" ANY 25 $217.00DC-20/UPS/FC-150SPECIFY COLOR WHEN ORDERINGCOLOR COLOR COLORCAUTION RED HUNTER GREEN BROWNSAFETY BLUE ORANGE STONE GRAYSAFETY YELLOW IMPERIAL BLUE BLACKNew159Bumper WrapBumper Wrap is a flexible UV coated protective wrap for use in warehouses, drive-thru’s, fuelingstations, and municipal barrier applications. Made of a non-marring, highly visible, flexible vinyl.Protect vehicles from impact and scraping damage while protecting posts from constant abuse.MODELNUMBEROVERALLHEIGHTNET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONTHICKNESSBW-480 40 FOOT BULK ROLL 12" 3/8" 53 $305.00BW-TIE-24 24" CABLE TIE (4) NEEDED PER BUMPER 1 $2.00BW-TIE-36 36" CABLE TIE (4) NEEDED PER BUMPER 1 3.00BW-TIE-48 48" CABLE TIE (4) NEEDED PER BUMPER 1 4.00Downspout Drain Water DisperserMODELNUMBEROVERALLHEIGHTFITS COLUMNSMEASURINGNET WT.(POUNDS)DC-20/UPS/FC-100Attaches to most standard down spouts. Easy installation, fits up and around the end of downspout.During a rainstorm water collects at the bottom of drains, ruining grass and landscaping. This deviceevenly disperses the water outward over a larger area. Constructed of aluminum. Installation hardwarenot included.MODELOVERALLOVERALLNET WT. LIST PRICENUMBERHEIGHTWIDTHDEPTH (POUNDS) EACHDRAIN-DD 6½" 6" 8" 6 $13.00Poly Rack GuardsLIST PRICEEACHCOLOR*PRG-5-1 5.24" 3" x 1 5 /8" YELLOW OR BLACK 3 $15.00PRG-5-2 5.24" 3¼" x 2" YELLOW OR BLACK 3 15.00PRG-5-3 5.24" 3" x 3" YELLOW OR BLACK 3 15.00*SPECIFY COLOR WHEN ORDERING - YELLOW OR BLACKDC-20/UPSPoly Rack Guards are a new innovation offering exceptional performance in racking protection. Racksystems are not designed to be struck by fork-lifts and even low speed collisions can lead to structuraldamage. This damage is a major occupational health and safety issue and is very costly to repair.Installation takes just seconds to install by hand. The design incorporates an ingenious spring clipdesign that enables it to securely grip the column and automatically adjust its width to suit a widerange of column sizes. All other products require an additional attachment system like Velcro, bolts,concrete penetration or additional parts that are prone to breakage.Polyethylene Rack ProtectorDC-20/UPSvestilgreenProtect pallet racking from damage with rugged polyethylene protectors. Easy installation with quickvelcro mount or concrete lag to the ground hardware included. Safety yellow color increases visibility.NewPROTECTIVE BARRIERSMODELNUMBERUSABLEOPENING SIZEOVERALL SIZE(W x L x H)NET WT.(POUNDS)LIST PRICEEACHMATERIALVRP-18 POLYETHYLENE 3½" 4½" x 8" x 18" 3 $41.00VRP-18-GRN POLYETHYLENE 3½" 4½" x 8" x 18" 3 41.00DC-20/UPS/FC-250VRP-18-GRNVRP-18www.vestil.com Phone (800) 348-0868
160NewRack ShieldEasy one-step installation, this Rack Shield eliminates painting and prevents damage to your verticalsupports. Made of extruded high-density polyethylene thermoplastic.VPRP-YLMODELNUMBEROVERALLHEIGHTUSABLE SIZE(W x D)HDWR. KITSREQUIREDNET WT.(LBS.)LIST PRICEEACHCOLORVPRP-YL-09 9" 3" x 2" 1 YELLOW 1½ $12.50VPRP-YL-12 12" 3" x 2" 2 YELLOW 2 14.50VPRP-YL-18 18" 3" x 2" 2 YELLOW 3½ 16.50VPRP-GY-09 9" 3" x 2" 1 GRAY 1½ $12.50VPRP-GY-12 12" 3" x 2" 2 GRAY 2 14.50VPRP-GY-18 18" 3" x 2" 2 GRAY 3½ 16.50VPRP-BK-09 9" 3" x 2" 1 BLACK 1½ $12.50VPRP-BK-12 12" 3" x 2" 2 BLACK 2 14.50VPRP-BK-18 18" 3" x 2" 2 BLACK 3½ 16.50VPRP-HDWR HARDWARE KIT (1) 3 /8" x 3" BOLTS 1 $3.00DC-20/UPSPROTECTIVE BARRIERSVPRP-BKSTRUCTURALRACK GUARDSVPRP-GYSTRUCTURAL RACK GUARDSWITH RUBBER BUMPERSStructural Rack GuardsEconomical way to protect against damage to pallet racking and wall corners. Constructed of 6" caststeel for durability. Available with or without a rubber bumper. Easy to install to concrete surface.Four mounting holes for maximum stability. Safety yellow powder coat finish. Installation hardwaresold separately.MODELNUMBEROVERALLHEIGHTUSABLE OPENING(W x D)OVERALL BASE(W x D)NET WT.(POUNDS)LIST PRICEEACHSTRUCTURAL RACK GUARDSG6-12 12" 4½" x 4" 10½" x 6¼" 11 $18.00G6-18 18" 4½" x 4" 10½" x 6¼" 20 22.00G6-24 24" 4½" x 4" 10½" x 6¼" 26 27.30G6-36 36" 4½" x 4" 10½" x 6¼" 34 42.30G8-12 12" 6½" x 4" 12½" x 6¼" 13 $27.20G8-18 18" 6½" x 4" 12½" x 6¼" 24 29.90G8-24 24" 6½" x 4" 12½" x 6¼" 36 32.60G8-36 36" 6½" x 4" 12½" x 6¼" 42 45.40STRUCTURAL RACK GUARDS WITH RUBBER BUMPERSG6-12-B 12" 4½" x 4" 10½" x 8¼" 18 $42.40G6-18-B 18" 4½" x 4" 10½" x 8¼" 30 55.40G6-24-B 24" 4½" x 4" 10½" x 8¼" 39 68.40G6-36-B 36" 4½" x 4" 10½" x 8¼" 48 100.90G8-12-B 12" 6½" x 4" 12½" x 8¼" 20 $47.00G8-18-B 18" 6½" x 4" 12½" x 8¼" 34 62.70G8-24-B 24" 6½" x 4" 12½" x 8¼" 47 76.10G8-36-B 36" 6½" x 4" 12½" x 8¼" 56 113.20G-ABK CONCRETE ANCHOR BOLTS (4) ¾" x 4" 4 $12.00DC-20/UPS/FC-50LOW PROFILERACK GUARDSseries NPGLow Profile Rack GuardsProtect pallet racking and wall corners against damage from fork trucks, pallet trucks, and carts withLow Profile Rack Guards. All components are laser cut. Quick and easy two-hole installation. Installsin half the time of other guards. Safety yellow powder coat finish. Steel construction. Mounting kitsold separately.MODELNUMBEROVERALLHEIGHTUSABLE OPENING(W x D)OVERALL BASE(W x D)NET WT.(POUNDS)LIST PRICEEACHNPG4-12 12" 4¼" x 1" 8" x 3" 8 $19.00NPG4-18 18" 4¼" x 1" 8" x 3" 12 21.50NPG4-24 24" 4¼" x 1" 8" x 3" 16 26.00NPG4-36 36" 4¼" x 1" 8" x 3" 18 32.70NPG6-12 12" 6¼" x 1" 10" x 3" 9 $24.10NPG6-18 18" 6¼" x 1" 10" x 3" 13 29.00NPG6-24 24" 6¼" x 1" 10" x 3" 15 31.00NPG6-36 36" 6¼" x 1" 10" x 3" 20 34.90NPG-ABK CONCRETE ANCHOR BOLTS (2) ¾" x 4" 2 $6.00DC-20/UPSPhone (800) 348-0868www.vestil.com
Rack Guard with Rubber Bumper InsertProtect pallet racking with durable wrap around protection. Increase pallet rack columnstrength on impact by over 100%. Includes rubber bumper insert, ½" thick, and hardware.Easy to install with wrench or socket. No concrete drilling required. Steel construction.Powder coat safety yellow finish.161MODELNUMBERMODELNUMBEROVERALL SIZE(W x D)OVERALLHEIGHTUSABLE OPENING(W x D) W/BUMPEROVERALLLENGTHSIDEHEIGHTOVERALLHEIGHTNET WT.(POUNDS)NET WT.(POUNDS)LIST PRICEEACHRUD-24 3 3 /8" x 4 7 /8" 3 1 /8" x 4¼" 24" 12 $19.00RUD-36 3 3 /8" x 4 7 /8" 3 1 /8" x 4¼" 36" 16 36.00RUD-48 3 3 /8" x 4 7 /8" 3 1 /8" x 4¼" 48" 21 48.00Corner GuardsDC-25/UPS/FC-50Protect busy corners, expensive machinery and personnel with 90° perpendicular protection."SAFETY FIRST" promotion reminds personnel of the number one priority. Steel unitsinclude powder coat safety yellow finish. Aluminum unit is unfinished.LIST PRICEEACHMATERIALPCG-16 16" 16" 8" STEEL 30 $104.40PCG-24 24" 24" 12" STEEL 35 131.60PCG-24-A 24" 24" 12" ALUMINUM 18 165.80PCG-ABK CONCRETE ANCHOR BOLTS (3) ¾" x 4" 3 $9.00Corner ProtectorsMODELNUMBEROVERALLHEIGHTFLANGEWIDTHDRYWALLANCHORSNET WT.(LBS.)DC-25/UPS/FC-50Heavy-duty corner protectors are designed to protect corners from damage. Extremelyversatile protection for in warehouses, offices, overhead door frames and tracks, or any 90°corner.Rubber Corner Protector, model RCP-B-BY, features black and yellow stripes for increasedvisibility. Includes (6) mounting holes and drywall anchors to secure unit to wall. Holediameter is 3 /16"".Corner Protector, model VCP-40 & VCP-40-GRN, is made of shock absorbing moldedpolyethylene construction. 2¼" thick with one flange edge measuring 6" and the other 8".No pre-drilled holes.Molded Rubber Corner Protectors, series MRCG, are made from black molded rubber. Acorner protector includes reflective safety yellow tape for higher visibility. No pre-drilled holes.PVC Corner Guards, model YCG-12, has a clean and attractive appearance with black andyellow safety stripes for greater visibility. Multiple guards may be installed end-to-end, 47"overall height, for greater coverage. Four screws/anchors included for installation. Fourpieces per package.LIST PRICEEACHMATERIALRCP-B-BY 35½" 3" INCLUDED RUBBER 6 $39.00VCP-40 40½" 6" & 8" NOT INCLUDED POLY 3 $53.00VCP-40-GRN 40½" 6" & 8" NOT INCLUDED POLY 3 53.00MRCG-20 20" 5½" NOT INCLUDED RUBBER 5 $42.00MRCG-39 39" 6" NOT INCLUDED RUBBER 8 33.00YCG-12 11¾" 4" INCLUDED PVC 1 $42.00Stainless Steel Corner GuardsMODELNUMBERSTYLEANGLEARMLENGTHOVERALLHEIGHTNET WT.(POUNDS)DC-25/UPSProvides for quick and easy corner protection. Excellent corrosion resistance. Made from1/16"" thick type 304 stainless steel. Mounting hardware/adhesive is NOT included.LIST PRICEEACHSS-48 SQUARE 3½" x 3½" 48" 5 $64.00SS-48R ROUNDED 3½" x 3½" 48" 7 76.00NewDC-25/UPSRUD-24PCG-24-APCG-24RCP-B-BY VCP-40 MRCG-20 MRCG-39YCG-12vestilgreenNewPROTECTIVE BARRIERSwww.vestil.com Phone (800) 348-0868SS-48SS-48-R
162PVC-48-WH PVC-48-GY PVC-48-BGPVC-48R-WH PVC-48R-GY PVC-48R-BGNewNewPVC Plastic Corner ProtectorsProvides for quick and easy corner protection. Made from 1 /16" thick PVC plastic material.Designed for indoor use only. Durable and attractive. Securely attach to corner with glue orconstruction adhesive (not included). Holes may also be drilled to allow for bolt-on installation(hardware not included).MODELNUMBER STYLE ANGLE COLORARMLENGTHOVERALLHEIGHTNET WT.(POUNDS)LIST PRICEEACHPVC-48-WH 90° WHITE 2" x 2" 48" 1 $18.56PVC-48-GY 90° GRAY 2" x 2" 48" 1 18.56PVC-48-BG 90° BEIGE 2" x 2" 48" 1 18.56PVC-48R-WH 90° ROUNDED WHITE 3" x 3" 48" 1 $20.90PVC-48R-GY 90° ROUNDED GRAY 3" x 3" 48" 1 20.90PVC-48R-BG 90° ROUNDED BEIGE 3" x 3" 48" 1 20.90PVC Plastic Corner Protectors (Aluminum Insert)DC-25/UPSProvides for quick and easy corner protection. Durable design with attractive appearance.External shell made from 1 /16" PVC white plastic. Inner structure made from 1 /16" aluminum.Insert is pre-drilled for use with 3 /16" screws. Four holes on one side, five holes on the other side,9 holes total. Installation hardware is not included. 90° angle design (not rounded).PROTECTIVE BARRIERSPVC-A-2-WH PVC-A-2-GY PVC-A-2-BGPhone (800) 348-0868FEG-AFEG-CFEG-DNewvestilgreenNewFEG-BMODELNUMBER STYLE ANGLE COLORMODELNUMBERMODELNUMBERMODELNUMBEROVERALLSIZE (W x H)HEIGHTBASE PLATESPECIFICATIONSARMLENGTHOVERALLHEIGHTADHESIVETAPEOVERALL(W x H) PROJECTIONMOUNTING HOLEDIAMETERNET WT.(POUNDS)NET WT.(OUNCES)NET WT.(POUNDS)NET WT.(POUNDS)LIST PRICEEACHPVC-A-2-WH 90° WHITE 2" x 2" 48" 3 $29.00PVC-A-2-GY 90° GRAY 2" x 2" 48" 3 29.00PVC-A-2-BG 90° BEIGE 2" x 2" 48" 3 29.00PVC-A-3-WH 90° WHITE 3" x 3" 48" 3 $39.00PVC-A-3-GY 90° GRAY 3" x 3" 48" 3 39.00PVC-A-3-BG 90° BEIGE 3" x 3" 48" 3 39.00Foam Edge GuardsDC-25/UPSVersatile foam edge guards provided added protection when necessary. Each guard is manufacturedfrom flexible foam. Black foam color with yellow alert striping. Sold in lengths of 36", easy to cutto custom lengths.LIST PRICEEACHSLOT SIZEFEG-A 1½" DIAMETER 5/16" x ¾" NO 12 $21.50FEG-B 2 3 /8" x 13 /16" NONE YES 12 23.00FEG-C 1½" x 7 /16" 5/16" x ¾" NO 14 23.00FEG-D 1½" x 1 7 /16" 1" x 1" YES 12 21.50Polyethylene Wall ProtectorDC-25/UPSProtect building walls from scratches and dents. This wall protector is weather resistant for useboth indoors and outdoors. Constructed of molded polyethylene material. Safety yellow for highvisibility. Features ⅜" counter sunk holes for anchor bolts. Hardware not included.LIST PRICEEACHDESCRIPTIONVBG-48 POLYETHYLENE 48" x 6¼" 2¼" 6 $51.00VBG-48-GRN POLYETHYLENE 48" x 6¼" 2¼" 6 51.00Overhead Door Track ProtectorsDC-20/UPSProtect the tracks of overhead doors from fork trucks, pallet trucks, and other traffic with thesesolid steel constructed, economical Overhead Door Track Protectors. The base plate is 6" squarewith a 3" notch out and 9/16" diameter mounting holes. Safety yellow powder coat finish forlong term wear. Steel construction.LIST PRICEEACHDSP-24 24¼" 6" Square 3" Notch Out 9/16" 13 $33.00DSP-36 36¼" 6" Square 3" Notch Out 9/16" 20 43.00DSP-48 48¼" 6" Square 3" Notch Out 9/16" 27 53.00DSP-ABK CONCRETE ANCHOR BOLTS (3) 3 /8" x 4" 3 $9.00DC-25/UPS/FC-50www.vestil.com
Economical Overhead Door Warning BarriersProtect overhead doors from fork trucks and other traffic coming and going throughout eachday. Intended for use as a warning system - not a fork truck stop. Constructed with tubularsteel uprights and a 4" x 4" wooden beam across the top of the guard. The wooden beam can beeasily and inexpensively replaced when damaged. Guard will not interfere with overhead door.Complete unit is painted high visibility OSHA safety yellow. Concrete installation kit available.MODELNUMBERUSABLE DOORWIDTH (FT.)USABLE DOORHEIGHT (FT.)NET WT.(POUNDS)LIST PRICEEACHCOLORDWB-88 8 8 YELLOW 395 $464.00DWB-810 8 10 YELLOW 475 501.00DWB-910 9 10 YELLOW 490 513.00DWB-1010 10 10 YELLOW 505 524.00DWB-ABK CONCRETE ANCHOR BOLTS (8) ½" x 6" 10 $28.00Clearance BarDC-20/FC-70Clearance Bars are low maintenance, highly visible, easily read so no more mistaking clearanceheight. These easy to install clearance bars are made of ¼" nominal wall lo-density polyethylenethat withstands -40 degree C to 210 degree C temperatures. Comes with eye hooks attached,chain not included. Standard lettering is "Clearance" and specified height. Other colors, sizesand specified lettering available, contact factory.NewWOODSTEEL163MODELNUMBERMODELNUMBEROUTSIDEDIAMETER LENGTH LETTERING COLOROVERALLLENGTHNET WT.(POUNDS)NET WT.(POUNDS)LIST PRICEEACHCLB-5-78P 5¼" 78" NO YELLOW 15 $110.00CLB-5-78L 5¼" 78" YES YELLOW 15 120.00CLB-7-110P 7½" 110" NO YELLOW 20 $125.00CLB-7-110L 7½" 110" YES YELLOW 20 135.00Overhead Door Warning BarriersDC-20/FC-250Protect overhead doors from fork truck damage. Heavy-duty PVC construction is light-weightand will not rust. Highly visible black and yellow safety tape and two American flags serve as avisual warning. Includes two 15' long chains with quick connects to hang barrier from ceiling orexisting overhead door track.Model ODG-133-BL features built-in warning sirens and flashing lights that activate when thebarrier is bumped or contacted. Provides for an audible and visual warning before damage tooverhead door is caused. Requires (2) 9V lithium batteries, not included.LIST PRICEEACHDESCRIPTIONODG-121-F ECONOMY WARNING BARRIER 120" 40 $222.00ODG-133-BL DELUXE WARNING BARRIER 133" 45 366.00Automatic Overhead Door LockDC-25/FC-70/77.5Unique product will allow overhead doors to be locked in virtually any up position. Automaticallylocks doors in full up position or in the closed position. Prevents the overhead door fromunexpectedly "slamming down". Protects personnel, product, and equipment. Spring-loadedlocking latch is released by pulling rope (included). Simply bolts to any overhead door (installationhardware is not included). Includes two reversible "locking plates" that may be mounted anywherealong door track. Heavy-duty welded steel construction with yellow painted finish.MODELNET WT. LIST PRICENUMBER DESCRIPTION COLOR (POUNDS) EACHDR-LOCK OVERHEAD DOOR LOCK YELLOW 10 $114.00Safety Lift GatesDC-25/FC-60The Lift Gate can be lifted out of the way with a single finger. Simply lift and the self foldingaction folds the gate in a vertical position. With the assistance of the air assist cylinder thegate can be lifted with the slightest effort. The Lift Gate is manufactured of steel tubing witha corrosion resistant coating. The unique design can be either wall or floor mounted. Ideal onloading dock doors to help reduce the possibility of people falling. Units fold up completely toa vertical height of 159", clearance required is 111".ECONOMY WARNING BARRIER • model ODG-121-FDELUXE WARNING BARRIER • model ODG-133-BLNewPROTECTIVE BARRIERSMODELNUMBER LENGTH BASE PLATE HEIGHTNET WT.(POUNDS)LIST PRICEEACHSLG-6 6' 6" 43" 18 $325.00SLG-10 10' 6" 43" 30 405.00DC-20/FC-250TWO SIX FOOT SECTIONS SHOWNwww.vestil.com Phone (800) 348-0868
PROTECTIVE BARRIERS164PLASTIC CONSTRUCTIONmodel PEXGATE-30DVD or VIDEOAVAILABLESTEEL CONSTRUCTIONmodel EXGATE-30-CNewNewMezzanine Safety GateThe Mezzanine Safety Gate provides an OSHA required 42" high handrail, 21" highmid-rail and 4" high kickplate for mezzanines without sacrificing load accessibility. Thegate rotates to allow a usable area of 58 3 /16"W x 76 5 /8"H x 75½"D. Gate design is balancedto allow for easy operation without use of springs. Safety yellow powder coat finish.Welded steel construction.MODEL OVERALL OVERALL OVERALL USABLE NET WT. LIST PRICENUMBER HEIGHT WIDTH DEPTH WIDTH (POUNDS) EACHMEZZ-200 78¼" 69 3 /16" 78 1 /16" 58 3 /16" 180 $874.00Expand-A-GateMODELNUMBERCOLLAPSEDWIDTHEXPANDEDWIDTH*OVERALLHEIGHTNET WT.(POUNDS)DC-25/FC-50/150Designed to set up quickly and easily wherever and whenever they are needed. Ideal forpreventing potential accidents. Lightweight design allows personnel to quickly retrieve thegate and limit access to unsafe areas. Smooth operating scissor action. Interlocking andnestable. Suffix -C features casters.Model PEXGATE is constructed of heavy-duty molded yellow and black plastic. One sideof gate includes reflectors for better visibility. End pieces are hollow and may be filled withliquid for added weight. Assembly required.LIST PRICEEACHSTEEL CONSTRUCTIONEXGATE-30 15½" 139" 37" 52 $369.00EXGATE-30-C 15½" 139" 43" 54 414.00ALUMINUM CONSTRUCTIONALEXGATE-30 15½" 139" 37" 19 $470.00ALEXGATE-30-C 15½" 139" 43" 21 515.00PLASTIC CONSTRUCTIONPEXGATE-30 11½" 122" 38" 12 $165.00*OVERALL HEIGHT WHEN COLLAPSEDDC-25/UPS/FC-70PLASTIC UNIT IS EASY TOFILL FOR ADDED WEIGHTASSEMBLY REQUIREDON MODEL PEXGATE-30Heavy Duty Swinging Traffic DoorThis multi-purpose lightweight door is tough enough to take the abuse of personnel,stock carts and motorized pallet jacks. The door panels are constructed with ⅛" thickrotationally molded cross-linked polyethylene outer shell and foamed-in-place Non-CFCurethane foam core. The panels are corrosion resistant, making it ideal for wash downapplications as it has no gaps or joint seams. The door comes standard with 24" blackbumpers on both sides of the door. Includes a ⅛" thick polycarbonate window.SPECIFY COLOR WHEN ORDERING • series HDSWFOREST GREEN MEDIUM BROWNJADEROYAL BLUECADET BLUENAVYWHITEBLACKMETALLIC GRAY BEIGECLOUD GRAYBURGUNDYREDCHOCOLATE BROWNPhone (800) 348-0868MODELNUMBERMODELNUMBER*MAXIMUMHEIGHTSIZE(W x L)MAXIMUMWIDTHNET WT.(POUNDS)NET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONHDSW-37 SINGLE DOOR PANEL 36" x 84" 73 $1,248.00HDSW-57 DOUBLE DOOR PANEL 60" x 84" 128 $2,300.00HDSW-58 DOUBLE DOOR PANEL 60" x 96" 140 2,426.00HDSW-67 DOUBLE DOOR PANEL 72" x 84" 145 $2,497.00HDSW-68 DOUBLE DOOR PANEL 72" x 96" 160 2,623.00HDSW-88 DOUBLE DOOR PANEL 96" x 96" 200 $2,994.00SPECIFY COLOR WHEN ORDERINGDC-20/FC-70Galvanized Door Scissor GatesPrevent access to rooms with standard pedestrian Door Scissor Gates. Ideal for departmentstore door openings, offices, warehouse inventory rooms, etc. Steel construction.Installation hardware not included.LIST PRICEEACHVD-63 63" 48" 42 $135.00VD-68 66" 48" 54 140.00VD-73 73" 48" 56 145.00VD-79 79" 48" 60 151.00VD-81 81" 48" 61 157.00VD-83 83" 48" 62 161.00*MAXIMUM HEIGHT WHEN COLLAPSEDDC-20/UPS/FC-70www.vestil.com
Galvanized Folding GatesSecure outside access during the day and add security at night with heavy-duty 15 gauge steel folding gates. Durable 3" steel wheels allowoperator to quickly and fully retract gate when not in use. Center drop pin rests in pre-drilled hole to secure gate when extended. Easyinstallation! Lock is located on right side on single gates. Galvanized for durability. Constructed of steel U-channels riveted back to back usingaircraft quality rivets and heavy-duty 1½" x 1½" vertical angles. Installation hardware included. Contact factory for additional sizes.165CENTER DROP PINCENTER DROP PINSINGLE FOLDING GATESCOLLAPSEDMODEL WIDTHNUMBER (INCHES)VSSG-465* 11USABLEWIDTH(FEET)COLLAPSEDHEIGHT(FEET)IN USEHEIGHT(FEET)NETWT.(LBS.)LIST PRICEEACH6½ 6 69 $193.00VSSG-470* 11 7 6½ 73 209.00VSSG-475 11 3 to 4 7½ 7 77 227.00VSSG-480 11 8 7½ 80 249.00VSSG-485 11 8½ 8 84 255.00VSSG-565* 116½ 6 73 $203.00VSSG-570* 11 7 6½ 74 217.00VSSG-575 11 4 to 5 7½ 7 78 238.00VSSG-580 11 8 7½ 80 257.00VSSG-585 11 8½ 8 82 268.00VSSG-665* 116½ 6 76 $217.00VSSG-670* 11 7 6½ 79 238.00VSSG-675 11 5 to 6 7½ 7 81 257.00VSSG-680 11 8 7½ 84 277.00VSSG-685 11 8½ 8 86 286.00VSSG-765* 116½ 6 82 $237.00VSSG-770* 11 7 6½ 85 258.00VSSG-775 11 6 to 7 7½ 7 87 278.00VSSG-780 15 8 7½ 90 295.00VSSG-785 15 8½ 8 92 307.00VSSG-865* 146½ 6 88 $267.00VSSG-870* 14 7 6½ 92 288.00VSSG-875 14 7 to 8 7½ 7 96 307.00VSSG-880 15 8 7½ 99 328.00VSSG-885 15 8½ 8 104 350.00VSSG-970 147 6½ 102 $350.00VSSG-975 14 8 to 9 7½ 7 104 364.00VSSG-980 15 8 7½ 106 385.00VSSG-1070 14 9 to 10 7 6½ 109 355.00VSSG-1080 15 8 7½ 112 393.00DC-20/UPS*/FC-70Galvanized Portable GateDOUBLE FOLDING GATES (PER INDIVIDUAL GATE)COLLAPSEDMODEL WIDTHNUMBER (INCHES)VPFG-865* 11Gates are perfect for many locations; hospitals, schools, and warehouses. Use for blocking equipment,personnel, and entrances. Portable gates expand and lock to close off any opening which allows formobile safety and security. When not in use simply fold up, roll away, and store. Purchase optional addonsections to expand to any distance. Hardware, brackets and center drop in pin included.USABLEWIDTH(FEET)COLLAPSEDHEIGHT(FEET)IN USEHEIGHT(FEET)NETWT.(LBS.)LIST PRICEPER PAIR6½ 6 120 $325.00VPFG-870* 11 7 6½ 124 355.00VPFG-875 11 6 to 8 7½ 7 129 365.00VPFG-880 11 8 7½ 134 382.00VPFG-885 11 8½ 8 139 393.00VPFG-1065* 116½ 6 144 $345.00VPFG-1070* 11 7 6½ 148 365.00VPFG-1075 11 8 to 10 7½ 7 153 382.00VPFG-1080 11 8 7½ 158 405.00VPFG-1085 11 8½ 8 162 422.00VPFG-1265* 116½ 6 168 $372.00VPFG-1270* 11 7 6½ 172 394.00VPFG-1275 11 10 to 12 7½ 7 177 414.00VPFG-1280 11 8 7½ 182 451.00VPFG-1285 11 8½ 8 187 475.00VPFG-1465* 116½ 6 180 $425.00VPFG-1470* 11 7 6½ 184 445.00VPFG-1475 11 12 to 14 7½ 7 189 470.00VPFG-1480 15 8 7½ 196 493.00VPFG-1485 15 8½ 8 199 515.00VPFG-1665* 146½ 6 192 $483.00VPFG-1670* 14 7 6½ 196 503.00VPFG-1675 14 14 to 16 7½ 7 199 530.00VPFG-1680 15 8 7½ 201 575.00VPFG-1685 15 8½ 8 206 618.00VPFG-1870 147 6½ 204 $603.00VPFG-1875 14 16 to 18 7½ 7½ 208 651.00VPFG-1880 15 8 7 211 679.00VPFG-2070 14 18 to 20 7 6½ 216 679.00VPFG-2080 15 8 7½ 230 775.00DC-20/UPS*/FC-70PROTECTIVE BARRIERSMODELNUMBERCOLLAPSEDWIDTHEXPANDEDWIDTHCOLLAPSEDHEIGHTUSABLEHEIGHTCASTERSTYLENET WT.(POUNDS)LIST PRICEEACHVXL-1265 78" 144" 79½" 72" 3" RUBBER 144 $699.00VXL-665 ADD-ON SECTION 6 FEET LONG WHEN EXPANDED 72 408.00DC-20/UPS/FC-70www.vestil.com Phone (800) 348-0868
166NewAdjustable Perimeter Guard SystemsDesigned for use as perimeter barrier around equipment and machinery. Several differentsizes to choose from to custom-fit each application. Panels may be installed at any angle from0° - 180°. Hinged door includes a keyed lock. Industrial powder-coat finish for durability.Components are sold separately and must be assembled/installed on-site. Comply with OSHA,EPA and ANSI specifications.PROTECTIVE BARRIERSS-STANDNewS-STAND-WvestilgreenNewRDSPB-YL-GRNMODELNUMBERDESCRIPTIONHEIGHT(FEET)MODELNUMBER DESCRIPTION HEIGHTWIDTH(FEET)BASEDIAMETERNET WT.(POUNDS)NET WT.(POUNDS)LIST PRICEEACHAPG-M-35 PANEL 3 5 28 $77.00APG-M-38 PANEL 3 8 41 103.00APG-M-45 PANEL 4 5 34 87.00APG-M-48 PANEL 4 8 50 120.00APG-M-55 PANEL 5 5 40 100.00APG-M-58 PANEL 5 8 59 139.00APG-M-65 PANEL 6 5 46 110.00APG-M-85 PANEL 8 5 59 139.00APG-P6-L IN-LINE POST 6 N/A 16 $76.00APG-P6-C CORNER POST 6 N/A 21 74.00APG-P8-L IN-LINE POST 8 N/A 20 82.00APG-P8-C CORNER POST 8 N/A 25 79.00APG-DR-54 HINGED DOOR 5 4 73 358.00Sign StandsDC-25/UPS/FC-70Display your signs anywhere. Surface mounted with a weighted base. Includes (3)holes, 9 /16" diameter with 1⅜" diameter counter-bore for permanent mounting ofsign. Removable post will accept virtually any sign (sign & mounting hardware notincluded). Available with or without wheels. Wheels allow you to tip and roll unit.Steel construction with bright zinc finish.LIST PRICEEACHS-STAND NO WHEELS 48" 18" 42 $77.00S-STAND-W WHEELS INCLUDED 48" 18" 43 110.00Sign Post BasesDC-35/UPS/FC-60Perfect for displaying signs where a post cannot be permanently mounted in the ground. 100%recycled tire rubber, will not rust, chip, crack, crumble or corrode. Withstands high winds andbad weather; low center of gravity, aerodynamic and attractive design. Supports various signsfrom No Parking, to Stop Signs up to 30", and post is removable from base for easy storage.Traffic signs and custom colors available, contact factory.SQSPB-BL-GRNMODELNUMBERHOLE SIZE& DESCRIPTIONBASE SIZE(D x H)TYPE OFPOSTBASECOLORNET WT.(POUNDS)LIST PRICEEACHRDSPB-BL-GRN 2 3 /8" ROUND 18" x 14" 5' PVC BLACK 72 $175.00RDSPB-YL-GRN 2 3 /8" ROUND 18" x 14" 5' PVC YELLOW 76 198.00SQSPB-BL-GRN 1¾" SQUARE 18" x 14" 5' METAL BLACK 80 $198.00SQSPB-YL-GRN 1¾" SQUARE 18" x 14" 5' METAL YELLOW 82 238.00DC-25/UPS/FC-60Warning SirensABCDAn ideal method to warn people of dangerous situations including: severe weatherwarnings, emergency circumstances, terror situations, military alerts and correctionalfacility alerts. Easy hand crank operation. Type A-D include a convenient carryingbag. Type E-G are easy to install thru your local contractors or electricians.ENewFGMODELNUMBERAUDIBLEDISTANCE TONE CONSTRUCTIONNET WT.(POUNDS)LIST PRICEEACHTYPEA SIREN-100-P-C 1/4 MILE SINGLE PLASTIC 2 $96.00B SIREN-100-P-R 1/4 MILE SINGLE PLASTIC 2 96.00C SIREN-100-C 1/4 MILE SINGLE STEEL 3 $138.00D SIREN-100-S 1/4 MILE SINGLE STEEL 3 138.00-- SIREN-100-BM 1/4 MILE SINGLE STEEL 3 138.00F SIREN-100-TP 1/4 MILE SINGLE STEEL 3 138.00G SIREN-120 1/2 MILE SINGLE STEEL 20 342.00E SIREN-SV 1/4 MILE SINGLE STEEL 6 $130.00-- SIREN-SV-AR 1/4 MILE SINGLE STEEL/RED 6 130.00-- SIREN-100-P-GN 1/4 MILE SINGLE PLASTIC 3 39.00DC-25/UPSPhone (800) 348-0868www.vestil.com
DVD or VIDEOAVAILABLERemovable drum crushingplaten and a two positionkey switch to select crushor compact. Weight 70 lbs.Hydraulic Drum Crusher/Compactor167460V 3-PHASE STD, OPTIONS BELOWCrushes 55-gallon steel drums to approximately 6” high and resets automatically to crushanother drum in only 25 seconds. 38,000 pounds of crushing power. The included drumcompacting feature allows you to compact contents inside the drum by simply removingthe drum crushing platen. Crushing feature will work with any drum size up to 55-gallons.Compacting feature will only work with 55-gallon drums. This convenient design givesyou two pieces of equipment in one. Safety features include a pressure relief valve, whichprevents overload, and a door interlock system that will prevent the motor from runningunless the door is closed. 6.5 hp motor is 460V, 3-phase, 60 hz. Meets OSHA and JICstandards. Built-in fork pockets aid in transporting. Aluminum Drip Pan, model HDC-DPN, is available for catching any excess liquid that may be expelled during the crushingoperation. The pan holds 7½ gallons and measures 30"W x 20"D x 3"H.Crating is recommended for international shipments, contact factory.DVD or VIDEOAVAILABLENewNewCrushes 55-gallon steeldrums to only 6" high.BOOM ATTACHMENTshown in use aboveSHOWN WITHPOWERED LIFT OPTIONMODELNUMBERNET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONHDC-900-IDC DRUM CRUSHER/COMPACTOR 1641 $8,325.00HDC-900-HC HIGH CYCLE PACKAGE DRUM CRUSHER 1700 $12,400.00HDC-DPN ALUMINUM DRIP PAN 31 $156.00HDC9-1 SINGLE PHASE, 3HP POWER UNIT$1,055.00115V (REQUIRES 50 AMP BREAK) CYCLE TIME INCREASES TO APPROX. 70 SECONDS)HDC-900-WD WASHDOWN MOTOR & NEMA 4 ENCLOSURE $715.00DC-20/FC-100/250Mobile Gasoline Powered Drum CrusherTake the Drum Crusher to where the drums are! Save time and trips by transportingdrums that are already crushed. Features an 18 HP 4 stroke Briggs & Stratton gasolineengine. Hydraulic reservoir holds up to 30 gallons of hydraulic oil. Power tilt and integraltrailer with tail and brake lights is included. Exterior tension mounted twin cylinderseliminate rod buckling and damage.MODELNUMBERMODELNUMBERDRUM TYPE(GALLON)SERVICERANGEUNIFORMCAPACITYOVERALL SIZE(W x D x H)NET WT.(POUNDS)NET WT.(LBS.)LIST PRICEEACHDESCRIPTIONHDC-900-GPT GAS POWERED DRUM CRUSHER 2750 $15,679.00DC-20/FC-FLATBEDManual Trash CompactorThis easy to use product is designed for compacting the contents of 30 and 55 gallon drums.Manual ratcheting mechanism will generate up to 7,000 lbs. of compacting force. Ratchetmechanism is also used to retract compacting plate. Compacting plate direction is adjustedwith selector levers. Ratchet lever is secured in the UP position with locking pin. Includestwo wheels for tilt-and-roll portability of unit when empty. Drum not included.LIST PRICEEACHMTC-55 55 3¾" to 40½" 7,000 28¾" x 24¼" x 92" 200 $845.00MTC-30 30 3¾" to 40½" 7,000 28¾" x 24¼" x 92" 200 845.00MTC-RB OPTIONAL ROLL-OUT BASE ASSEMBLY $545.00Portable Hydraulic Drum Carrier/Rotator/BoomMODELNUMBERROTATIONMETHODLIFTHEIGHTUNIFORMCAPACITYNET WT.(POUNDS)DC-25/FC-92.5The product allows one person to lift, transport, and dispense fully loaded 55-gallon steeldrums with ease. It features a manual foot pump hydraulic lift and rolls on 5" rear swivelcasters and 8" front rigid wheels. There is a hand crank on the 60" model and chainrotation on the other models to rotate the drum 360°. All models feature a lifting boomattachment which stores on the outriggers. Optional power units available for the liftingoperation. See page 162 for options to handle plastic and fiber drums.LIST PRICEEACHHDC-305-60 HAND CRANK 60" 800 483 $1,807.00HDC-305-72 PULL CHAIN 72" 800 517 1,880.00HDC-305-84 PULL CHAIN 84" 800 552 2,010.00HDC-305-96 PULL CHAIN 96" 800 572 2,096.00LIFT OPTIONSHDC-DC 12V DC POWER UNIT 36 $710.00HDC-AC 115V AC POWER UNIT 36 710.00HDC-AIR AIR/OIL OPERATED POWER UNIT 36 501.00ROTATION OPTIONSHDC-R-DC 24V DC POWER 160 $1,800.00HDC-R-HC HAND CRANK (IN PLACE OF PULL CHAIN) 0 120.00DRUMS MUST BE FULL TO ROTATE AT RATED CAPACITYDC-20/FC-100/250www.vestil.com Phone (800) 348-0868DRUM, CYLINDER, PAIL EQUIPMENT
168Hydraulic Drum StackersThe Drum Stacker is perfect for positioning 55-gallon steel drums horizontally on shelves. Thesolid steel construction provides stability during transit. Drums are held in place with a ratchetmechanism. Fully loaded drums rotate 360°. Unit rolls easily on (2) 8" x 2" glass-filled nyloncasters and (2) 5" x 2" swivel polyurethane casters. Comes standard with hydraulic foot pump.Optional power units available for the lifting operation.NewDVD or VIDEOAVAILABLEMODELNUMBERDRUM ROTATIONMETHODLIFTHEIGHTUNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHHDC-450-60 HAND CRANK 60" 800 604 $1,901.00HDC-450-72 PULL CHAIN 72" 800 659 1,971.00HDC-450-84 PULL CHAIN 84" 800 709 2,092.00HDC-450-96 PULL CHAIN 96" 800 798 2,175.00LIFT OPTIONSHDC-DC 12V DC POWER UNIT OPTION 36 $710.00HDC-AC 115V AC POWER UNIT OPTION 36 710.00HDC-AIR AIR/OIL OPERATED POWER UNIT OPTION 36 501.00ROTATION OPTIONSHDC-R-DC 24V DC POWER 160 $1,800.00HDC-R-HC HAND CRANK (IN PLACE OF PULL CHAIN) -- 120.00Drum PositionersDC-20/FC-100/250Allows fork truck driver to rotate standing drums to the horizontal racking position and viceversa.Positive latching system ensures safe handling of drums weighing up to 800 lbs. Slide thepositioner extensions over the vertical drum. With the aid of the Drum Positioner, rotate drumto horizontal position. Latching system will engage to allow horizontal positioning of drum.It’s now ready to slide into the rack. Mechanical operation relies on fork truck to rotate and liftdrums. Fork pockets measure 7½"W x 2½"H usable on 20½" centers. Units now feature awelded spacer to protect drum fixtures from damage when rotating.MODELNUMBERUNIFORMCAPACITY (LBS)NET WT.(LBS.)LIST PRICEEACHDESCRIPTIONDRUM-P-55 55-GALLON STEEL DRUMS 800 321 $928.00DRUM-P-30 30-GALLON STEEL DRUMS 800 315 926.00DC-20/FC-70Economy Drum PositionerDrum Positioner is a unique design to manipulate drums without leaving fork truck seat.Designed to lift 55-gallon steel and plastic drums from horizontal to the vertical position andvise verse using completely mechanical operation. Ideal for use with drum stands, pallets andracking. Suitable for loading drums into vehicles. Hinged tines lock automatically whenlowered to ground in horizontal position. Fork pockets measure 5½"W x 2"H usable.DRUM, CYLINDER, PAIL EQUIPMENTPDR-SHFNewMODELNUMBERMODELNUMBERDRUMCAPACITYOVERALL SIZE(W x D x H)UNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHDRUM-RACK-2 (2) 55 GAL. 45" x 30" x 12¾" 1,600 60 $108.00DRUM-RACK-3 (3) 55 GAL. 71" x 30" x 12¾" 2,400 95 159.00DC-20/FC-50/250MODELNUMBERDRUMCAPACITYOVERALL SIZE(W x D x H)UNIFORMCAPACITYUNIFORMCAPACITYCONTAINMENTCAPACITYNET WT.(LBS.)NET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONVEDP-55 55-GALLON STEEL & PLASTIC DRUMS 800 170 $465.00DC-20/FC-70Stackable Drum RacksSteel Drum Racks have four-way fork truck access. Not recommended for stacking more thanfour racks high. All steel construction with ¼" formed steel cradles. Bolt together assembly withhardware included. Works well with the Hydraulic Drum Stacker and the Drum Positioner.Polyethylene Drum RacksPolyethylene Drum Racks capture spills while keeping your workplace clean and safe. Allmodels tilt the drums slightly forward, allowing maximum drainage-optimizing your use ofchemicals while minimizing waste. These improve worker safety by keeping slippery chemicalsand oils off the floor. Works well with the Hydraulic Drum Stacker and the Drum Positioner.LIST PRICEEACHPDR-2 (2) 55 GAL. 53" x 53" x 44¾" 1,500 66 GAL. 137 $590.00PDR-4 (4) 55 GAL. 53" x 53" x 77¾" 3,000 66 GAL. 189 764.00PDR-SHF OPTIONAL DISPENSING SHELF (22"W x 17"L x 5"H) 12 $75.00DC-20/FC-100Phone (800) 348-0868www.vestil.com
Hydraulic Drum Dumpers115 V 1-PHASE STD, OPTIONS ON PG. 43The Hydraulic Drum Dumper is what you need to dump drums that weigh up to 1,500pounds. Works with 55 and 30-gallon plastic, steel, and fiber drums. The unit has a solidsteel chute. Portable units have two rigid and two swivel casters with floor lock screws.All steel construction.Standard features include: 56 frame, ¾ HP motor, 115V single phase, 60hz with an8 foot long power cord and plug. Upper travel limit switch, emergency brass safetyvelocity fuse in cylinder, and vertical adjustment drum restraints are standard. Dumper isoperated with a hand held control on an 8 ft. long coil cord standard.169PORTABLE HYDRAULIC DRUM DUMPERSMODELNUMBERDUMPHEIGHTROTATIONHEIGHTLEVELHEIGHTUNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHHDD-36-7-P 36" 91¾" 60¼" 750 798 $3,090.00HDD-48-7-P 48" 113¾" 72¼" 750 871 3,248.00HDD-60-7-P 60" 134¼" 84¼" 750 966 3,394.00HDD-72-7-P 72" 155¾" 97¼" 750 1008 3,525.00HDD-36-10-P 36" 91¾" 60¼" 1,000 819 $3,335.00HDD-48-10-P 48" 113¾" 72¼" 1,000 892 3,482.00HDD-60-10-P 60" 134¼" 84¼" 1,000 997 3,627.00HDD-72-10-P 72" 155¾" 97¼" 1,000 1039 3,757.00HDD-36-15-P 36" 91¾" 60¼" 1,500 960 $3,721.00HDD-48-15-P 48" 113¾" 72¼" 1,500 1023 3,896.00HDD-60-15-P 60" 134¼" 84¼" 1,500 1128 4,058.00HDD-72-15-P 72" 155¾" 97¼" 1,500 1176 4,201.00STATIONARY HYDRAULIC DRUM DUMPERSHDD-36-7-S 36" 91¾" 60½" 750 735 $2,850.00HDD-48-7-S 48" 112¼" 72½" 750 876 3,005.00HDD-60-7-S 60" 132¾" 84½" 750 971 3,153.00HDD-72-7-S 72" 153" 96" 750 1013 3,284.00HDD-36-10-S 36" 91¾" 60½" 1,000 824 $3,094.00HDD-48-10-S 48" 112¼" 72½" 1,000 897 3,244.00HDD-60-10-S 60" 132¾" 84½" 1,000 1002 3,383.00HDD-72-10-S 72" 153" 96" 1,000 1055 3,516.00HDD-36-15-S 36" 91¾" 60½" 1,500 966 $3,478.00HDD-48-15-S 48" 112¼" 72½" 1,500 1029 3,653.00HDD-60-15-S 60" 132¾" 84½" 1,500 1134 3,816.00HDD-72-15-S 72" 153" 96" 1,500 1186 3,962.00STANDARD POWER IS 120V 1 PHASE ACDC-20/FC-100/250OPTIONAL 12VDC SYSTEM WITH 115V ON-BOARD CHARGER, MODEL HDD-DC, N/COPTIONAL 5-GALLON PAIL ADAPTOR FINGERS, MODEL HDD-5G-ADP, $68.00Stainless Steel Chute UpgradeSSC upgrade is constructed with type 304 Stainless Steel in a Mill Finish. Includesstainless steel chute and base plate. Chute is painted with Steel-It coating on back ofchute. Adjustable height clamps are stainless steel. Frame is painted enamel blue. Thisoption must be ordered with Drum Dumper.UPGRADE TO STAINLESS STEEL CHUTE (must be ordered with above drum dumpers)UNIFORM CAPACITY750 POUNDSUNIFORM CAPACITY1,000 POUNDSUNIFORM CAPACITY1,500 POUNDSMODELNUMBERLIST PRICEEACHMODELNUMBERLIST PRICEEACHMODELNUMBERLIST PRICEEACHSSC-36-7 $1,533.00 SSC-36-10 $ 1,782.00 SSC-36-15 $ 2,013.00SSC-48-7 1,650.00 SSC-48-10 1,897.00 SSC-48-15 2,159.00SSC-60-7 1,773.00 SSC-60-10 2,031.00 SSC-60-15 2,285.00SSC-72-7 2,093.00 SSC-72-10 2,308.00 SSC-72-15 2,530.00• All Stainless Chutes Available - Contact FactoryDC-20/FC-100• We can quote different grades of stainless polishing on chutes.• Optional FDA white powder coat is acceptable for incidental food contact.Manual Drum Carrier/RotatorHere is an efficient, economical way to handle 55-gallon steel drums. Sturdy handleprovides leverage for heavy lifting and easily locks drum in position 5" to 11" off floor.Drum rotates 360°. Rolls smoothly on 8" front wheels and a 4" rear swivel caster. Not foruse with drums on pallets.MODELNUMBERACCEPTABLEDRUM TYPESROTATIONMETHODUNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHDCR-110-55 55-GALLON STEEL MANUAL 800 159 lbs. $338.00DRUM MUST BE FULL TO ROTATE AT RATED CAPACITYDC-25/FC-70DVD or VIDEOAVAILABLECustom FinishAvailableSSC Option Includes• 304 Stainless Steel chutein Mill Finish• Chute includes Steel-Itcoating standard on anymild steel welded to backof chute• Mild steel frame is paintedwater base enamel blue• Adjustable height clampsare stainless steelContact Factory for Pricing45° DUMP ANGLE(135° TOTAL ROTATION)Image shows 304 StainlessSteel chute in Mill Finish.Optional FDA white powdercoat is acceptable forincidental food contact.SPECIALTY POLISHESAND FINISHESPAIL ADAPTOR FINGERSHDD-5G-ADPwww.vestil.com Phone (800) 348-0868DRUM, CYLINDER, PAIL EQUIPMENT
170DRUM, CYLINDER, PAIL EQUIPMENTNYLON STRAPmodel FDA-250DUAL RATCHET STRAPmodel FDRSCHAIN CONTAINERSee below for options to handleplastic and fiber drums.Phone (800) 348-0868model DCR-205-8DCR-205-15ADJUSTING ARMmodel FDA-550STEEL SADDLEmodel FDC-30DVD or VIDEOAVAILABLEmodel DCR-205-12-DCLift-and-Dump Hydraulic Drum DumpersThe Lift-and-Dump Hydraulic Drum Dumper is what you need to dump drums at variableheights. The HLD works similarly to the HDD but includes a lift cylinder that allows you todump at various heights. Features a (4) push button pendant which allows the operator fullindependent control of both lift height and the dump angle. All typical 60Hz and DC voltagesavailable.MODELNUMBERDUMP HEIGHT(MIN / MAX)ROTATIONHEIGHTLEVELHEIGHTUNIFORMCAPACITYFRAME(W x L)NET WT.(POUNDS)LIST PRICEEACHPORTABLE LIFT AND DUMP DRUM DUMPERS (40° DUMP ANGLE)HLD-94-10-P 48" / 94" 166" 87" 1,000 44" x 69" 1372 $8,099.00HLD-116-10-P 60" / 116" 195" 87" 1,000 44" x 77" 1460 8,672.00HLD-94-15-P 48" / 94" 166" 87" 1,500 44" x 69" 1392 $8,487.00HLD-116-15-P 60" / 116" 195" 87" 1,500 44" x 77" 1480 9,090.00STATIONARY LIFT AND DUMP DRUM DUMPERS (45° DUMP ANGLE)HLD-94-10-S 48" / 94" 165" 86" 1,000 44" x 58" 1434 $7,772.00HLD-116-10-S 60" / 116" 194" 86" 1,000 44" x 66" 1522 8,343.00HLD-94-15-S 48" / 94" 165" 86" 1,500 44" x 58" 1454 $8,158.00HLD-116-15-S 60" / 116" 194" 86" 1,500 44" x 66" 1542 8,760.00DC-20/FC-100Fork Truck Drum Carrier/RotatorsThis product allows you to easily transport and rotate 55-gallon steel drums using a fork truck.Drums are held securely in place by a durable chain locking system. Each unit is provided with a15 foot long chain to allow the drum to be rotated up to 360° from the fork truck operator's seat.Fork pockets measure 7½"W x 2½"H usable. DC powered units include battery, on-board charger,and hand held control on an 4 ft. to 20 ft. long coil cord. Model DCR-205-20 includes a modelFDRS, dual ratchet strap. Safety restraint is used to secure unit to fork truck. Bung Nut Wrench,model BNW-I, is also included for opening and closing drums.MODELNUMBERCRANK TURNSPER 90° ROTATIONROTATIONMETHODUNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHDCR-205-8 10 8' CHAIN 800 221 $570.00DCR-205-15 10 8' CHAIN 1,500 259 697.00DCR-205-20 15 8’ CHAIN 2,000 280 2,095.00DCR-205-8-DC -- 24V DC BATTERY 800 321 $2,371.00DCR-205-12-DC -- 24V DC BATTERY 1,200 359 2,497.00DCR-R-HC HAND CRANK (IN PLACE OF PULL CHAIN) 0 $120.00RRC-2PB WIRELESS REMOTE CONTROL use w/DC units 2 $721.00DRUM MUST BE FULL TO ROTATE AT RATED CAPACITYDC-20/FC-70Hoist Mounted Drum Carrier/RotatorsRotate and position a fully loaded 55-gallon steel drum with ease. Best when used with anoverhead hoist. Features a chain crank that allows the operator to rotate 360° drums that are outof reach. Drums are held in place with a drum locking system.MODELNUMBERACCEPTABLEDRUM TYPESROTATIONMETHODUNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHDCT-75 55-GALLON STEEL 8' CHAIN 800 97 $421.00DCT-85 55-GALLON STEEL 8' CHAIN 1,500 102 614.00DCT-R-HC HAND CRANK (IN PLACE OF PULL CHAIN) 0 $120.00DRUM MUST BE FULL TO ROTATE AT RATED CAPACITYDC-20/FC-70Plastic & Fiber Drum Adapters and UpgradesDesigned to hold and support fiber and plastic drums. Each adapter can be utilized inconjunction with models HDC-305, DCR-205, DCR-110, and DCT.Model FDA-800 comes complete with both an adjusting arm and a high strength nylon strap.Fits drums measuring 12" to 21" in diameter and 28" to 36" high.30-gallon Adapter, model FDC-30, attaches to the inner rim of the drum saddle so a 30-gallonsteel drum can be used.Dual Ratchet Strap, model FDRS, accommodates 30 and 55-gallon drums.MODELNUMBERNET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONFDA-800 FIBER DRUM ADAPTER 14 $201.00FDA-550 ADJUSTING ARM (SOLD SEPARATELY) 24 139.00FDA-250 NYLON STRAP (SOLD SEPARATELY) 12 44.00FDC-30 STEEL SADDLE 36 177.00FDRS DUAL RATCHET STRAP (FACTORY INSTALLED ONLY) 12 125.00DC-20/FC-70www.vestil.com
Automatic Eagle Beak Drum LiftersThis time tested and proven design allows a fork truck operator to easily secure, move, and releasedrums without leaving the seat of the fork truck. For use with open and closed head 30 and55-gallon plastic, steel and fiber drums with a top lip strong enough to support the weight of thedrum. Choose single-drum or double-drum configuration. Includes safety restraint to secure unitto the fork truck. Welded steel construction. Powder coat finish. Fork pockets measure 7½" widex 2½" high usable. A ratchet strap is supplied to secure the drum to the unit when traveling overrough terrain.MODELNUMBERNUMBER OFDRUMSUNIFORMCAPACITY (LBS)OVERALL SIZE(W x L x H)NET WT.(POUNDS)LIST PRICEEACHFMDL-1 1 1,000 26½" x 46½" x 29" 240 $783.00FMDL-2 2 2,000 42" x 49½" x 29" 340 1,072.00DC-20/FC-70Fork Mounted Poly Drum HandlersThese easy to use plastic drum handlers are designed to handle odd-shaped plastic drums.Includes safety restraint for securing unit to the fork truck. Durable powder coat finish.Model FPDL-8-L has adjustable arms that are designed to fit 55-gallon tapered round bottomplastic drums. Low drum attachment point allows for use with both open and closed head drums.A ratchet strap is supplied to secure the drum to the unit when traveling over rough terrain.Model FPDL-11-H is a top lip plastic drum lifter for use with 30 and 55-gallon plastic closedhead drums. 7½" wide x 2½" high usable fork tubes on 20½" centers. High drum attachmentpoint for use with top lip at least 3/16" high. Will also work with steel and fiber drums.model FPDL-8-L171model FMDL-1model FMDL-2MODELNUMBERMODELNUMBERDESCRIPTIONDESCRIPTIONUNIFORMCAPACITYOVERALL SIZE(W x L x H)OVERALL SIZE(W x L x H)NET WT.(POUNDS)NET WT.(LBS)LIST PRICEEACHFPDL-8-L BOTTOM GRIP 800 26½" x 56½" x 23" 160 $511.00FPDL-11-H TOP GRIP 1,100 26½" x 48½" x 23" 185 651.00DC-20/FC-70Deluxe Combination Fork Mounted Drum LifterDeluxe Combination Fork Mounted Drum Lifter includes attachments to lift any type of drum; 30 and55-gallon, steel, plastic, fiber, and open or closed head drums. Includes single Eagle Beak unit and bothbottom and top lip Poly Drum Lifters. Uniform capacity will vary depending on which attachment youuse. Fork pockets have an inside measurement of 7½" wide by 2½" high. Includes safetyrestraint for securing unit to fork truck. Welded steel construction. Powder coat finish. Aratchet strap is supplied to secure the drum to the unit when traveling over rough terrain.LIST PRICEEACHDFDL-3 DELUXE COMBO DRUM LIFTER 26½" x 52" x 30" 313 $1,136.00DC-20/FC-70Fork Mounted Drum LiftersFork truck attachments utilize a light duty single automatic clamping mechanism for handlingany size steel or plastic chimed drum. Scales available, contact factory.Model FMDL-850 is a knockdown unit that bolts together. Fork pockets and safety chain providequick and easy installation.Model FMDDL-1700 attaches to the carriage of most fork trucks and walkie stackers.The following are fork mounted drum lifters that enable fork truck operators to install or removethe attachment in seconds without any tools. Totally enclosed fork pockets with attached safetychain and cam lock secures the attachment to the fork truck.FMDL-1500 & FMDDL-3000 - Fork truck attachments utilize a heavy-duty single automatic clampingmechanism for handling steel, fiber, and plastic chimed drums in high volume applications.Models FMDL-2000 & FMDDL-4000 feature heavy-duty double articulating clamping mechanismsfor handling any steel, plastic, or fiber chimed drums in high volume applications. Each drum isgripped with two upper and lower jaws in heads that are spaced about 6 inches apart.MODELNUMBERACCEPTABLEDRUM TYPESUNIFORMCAPACITYOVERALL SIZE( W x L x H)NET WT.(POUNDS)model FMDL-1500model FMDDL-3000LIST PRICEEACHFMDL-850* (1) STEEL, POLY OR FIBER 750 31" x 34" x 35" 160 $722.00FMDL-1500 (1) STEEL, POLY OR FIBER 1,500 33" x 47" x 37" 340 2,058.00FMDL-2000 (1) STEEL, POLY OR FIBER 2,000 33" x 47" x 37" 366 2,796.00FMDDL-1700* (2) STEEL, POLY OR FIBER 1,500 38" x 34" x 35" 207 $1,275.00FMDDL-3000 (2) STEEL, POLY OR FIBER 3,000 33" x 47" x 37" 430 3,300.00FMDDL-4000 (2) STEEL, POLY OR FIBER 4,000 33" x 47" x 37" 483 4,413.00* LIGHT-DUTY UNIT TO HANDLE 100 OR FEWER DRUMS PER MONTH DC-20/FC-70model FPDL-11-Hmodel DFDL-3DVD or VIDEOAVAILABLEmodel FMDL-850model FMDL-2000model FMDDL-4000www.vestil.com Phone (800) 348-0868DRUM, CYLINDER, PAIL EQUIPMENT
172Drum GrippersThe Drum Gripper makes it easy to pick up one or two steel drums without leaving the seat of the fork truck. Simply slip the forks into the forktubes, fasten the safety restraint and the Drum Gripper is ready to go. The knuckle gripping system is lowered around the drum, gripped tightly,and then lifted into the air. Drum is automatically released by lowering the forks. All models feature hinged folding design for storage. ModelsDGS-A and DGD-A feature adjustable-width arms for use with both 30-gallon and 55-gallon steel drums. Safety restraint included. Weldedsteel construction. Powder coat finish.model DGS-Amodel DGD-AmodelDGS-55-DmodelDGD-55-DDVD or VIDEOAVAILABLEMODELNUMBERACCEPTABLEDRUM SIZEUNIFORMCAPACITYOVERALL SIZE(W x D x H)FORK POCKETCENTERSFORK POCKETSIZE (W x H)NET WT.(POUNDS)LIST PRICEEACHDGS-A (1) 30 & 55-GALLON 800 26" x 35" x 8" 19¾" 7¼" x 2½" 105 $225.00DGS-55-D (1) 55-GALLON 1,500 28¼" x 24" x 8" 13½" 6¼" x 2" 109 278.00DGD-A (2) 30 & 55-GALLON 1,500 45" x 36" x 8" 24" 7¼" x 2½" 96 $284.00DGD-55-D (2) 55-GALLON 2,000 46" x 24¼" 9½" 24" 7¼" x 2¼" 185 335.00DC-20/FC-70Fork Mounted Drum GrippersDesigned for use with fork trucks fitted with hydraulic lateral fork positioners only. Easilyattaches to your forks for easy drum positioning. Available for use with 30 and 55-gallonsteel drums. Usable fork openings are 5½"W x 2½"H. Secure to forks with friction-lockscrew mechanism. Safety restraint included. Welded steel construction.DVD or VIDEOAVAILABLEMODELNUMBERACCEPTABLEDRUM SIZESUNIFORMCAPACITYUSABLEFORK OPENINGNET WEIGHT(POUNDS)LIST PRICEEACHFDG-55 55-GALLON 800 5½"W x 2½"H 45 $156.00FDG-30 30-GALLON 800 5½"W x 2½"H 45 156.00DC-20/FC-70Electric Hydraulic Fork Mounted Drum GrippersDRUM, CYLINDER, PAIL EQUIPMENTmodel DRUM-HYD-1DVD or VIDEOAVAILABLENewWhen the maximum in performance and control is required. The Electric Hydraulic ForkMounted Drum Grippers accommodate 30 and 55-gallon steel, plastic, and fiber drums.12V DC power standard. Battery included. Allows for lifting and moving of drums in thevertical position only. Includes hand control on coil cord for controlling the gripping armsfrom the seat of the fork truck. Safety restraint is included to secure the gripper to the forktruck. Welded steel construction. Painted finish.MODELNUMBERACCEPTABLEDRUM SIZESUNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHOPERATIONDRUM-HYD-1 55 & 30 GALLON 1,000 12V DC 525 $3,085.00DC-20/FC-70Horizontal Drum CarrierDesigned to load and unload open or closed head drums horizontally in racks. Safetyrestraint secures cradle to the forks to maximize safety and productivity. Drum lock engagesand disengages automatically as a function of the fork angle. Fork pockets measure 7½"wide by 2½" high usable.MODELUNIFORM NET WT. LIST PRICENUMBERACCEPTABLE DRUM SIZECAPACITY (POUNDS) EACHHORIZ-70 55-GALLON STEEL DRUMS 650 lbs. 191 $329.00Horizontal Drum PositionerMODELNUMBERACCEPTABLEDRUM SIZEOVERALL SIZE(W x L x H)UNIFORMCAPACITY12V DC POWER STANDARDNET WT.(LBS.)DC-20/FC-70Ideal for loading/unloading drums stored horizontally on drum racking and stands. Suitablefor loading drums onto vehicles. Fork opening is 24½" apart and fork pockets are 5½" x 2".Accommodates 22½" diameter by 36" high steel, plastic and fiber drums.LIST PRICEEACHHDT-500 55-GALLON DRUMS 16½" x 55½" x 4¾" 650 98 $308.00DC-20/FC-70Phone (800) 348-0868www.vestil.com
Economy Portable Drum Lifter/Rotator/TransporterEasy to lift, transport and tilt 55 gallon drums. Ideal for use in warehouse environmentswhen moving drums to and from racks. Drums can be locked in a vertical position toavoid spills or a horizontal position for draining through a faucet. A manual hand crankallows the drum to tilt up to 120°. Raise the drums up to 53" with a manual foot pumpoperation. Capacity is 800 lbs.Model DRUM-LRT-EC has a clamp style cradle which securely grips around the drum.Model DRUM-LRT-ESJ features a steel jaw which securely grips the top lip of the drum.MODELNUMBERMODELNUMBEROVERALL SIZE(W x D x H)OVERALL SIZE(W x D x H)RAISEDHEIGHTRAISEDHEIGHTUNIFORMCAPACITYUNIFORMCAPACITYNET WT.(POUNDS)NET WT.(POUNDS)LIST PRICEEACHDRUM-LRT-EC 53" x 33" x 78" 53" 800 420 $986.00DRUM-LRT-ESJ 53" x 33" x 78" 53" 800 420 988.00DC-20/FC-92.5Portable Drum Lifter/Rotator/TransporterModel DRUM-LRT features a hand pump to lift drums from ground level to a raisedheight of 68" to bottom of drum in horizontal position. For use with steel, plastic,and fiber drums 16" to 24" in diameter. A hand crank gear mechanism provides thecontrolled 360° rotation of the drum. A floor lock is standard to stabilize the unit in afixed position.Model DRUM-LRT-II features pivoting straddle legs for access to drums on pallets. Legswill manually pivot and lock into place with locking pin.Model DRUM-LRT-DC has a 12V DC battery powered lift operation and a manual handcrank gear mechanism rotation (on-board charger standard). Minor assembly required.Model DRUM-LRT-DC-II features a 24V DC powered rotation mechanism whichprovides 360° rotation of the drum. A 12V DC powered mechanism raises and lowersdrums (on-board charger standard).LIST PRICEEACHMANUAL OPERATIONDRUM-LRT 36¼" x 61" x 88" 68" 550 402 $1,377.00DRUM-LRT-II 72" x 61" x 88" 68" 550 426 $1,437.0012V DC POWERDRUM-LRT-DC 36¼" x 61" x 88" 63" 550 629 $3,352.00DRUM-LRT-DC-II 36¼" x 61" x 88" 63" 550 620 4,551.00AIR POWEREDDRUM-LRT-AIR 36¼" x 61" x 88" 63" 550 618 $4,024.00DC-20/FC-92.5Portable Drum JacksThese Drum Jacks are the perfect solution to any of your drum transporting needs.Compact design allows for maximum maneuverability in restrictive areas. All steelconstruction.Model DRUM-55-36 accepts both 30 and 55-gallon plastic, steel, and fiber drums witha top lip. The front rigid wheels are 6" x 2", while the rear swivel casters are 3" x 1½".Model DRUM-55FP has an adjustable beak design which allows it to grab 30 and55-gallon steel, plastic, or fiber drums. Drums can easily be placed on or removed frompallets, spill containers, and scales. Available with built-in scale feature, see below.Model DRUM-55S has a unique grapple to hold 55-gallon drums securely into thesteel saddle prior to lifting it vertically. The drum is held in this position during transit,enabling open drums to be handled without spillage.Model DRUM-SCLG & DRUM-SCLF have a scale readout built into Drum Jack modelDRUM-55FP. The scale allows the drum to be weighed and moved all with the samepiece of equipment. The scale features a uniform capacity of 1,000 pounds with anaccuracy of +/-0.5 lbs. 12V DC operation with battery and charger included. Stainless steelscale components. NEMA 4 scale read-out housing swivels 360° for maximum viewingconvenience.MODELNUMBEROVERALL SIZE(W x D)LIFTHEIGHTUNIFORMCAPACITYNET WT.(LBS.)LIST PRICEEACHDRUM-55-36 34¾" x 29" 18" 500 168 $672.00DRUM-55FP 43½" x 39" 20" 1,000 373 3,343.00DRUM-55S 29" x 41" 4" 1,000 180 644.00DRUM-SCLG DRUM-55FP WITH GENERAL READOUT SCALE 389 $8,144.00DRUM-SCLF DRUM-55FP WITH INTRINSICALLY SAFE READOUT SCALE 397 9,196.00DC-20/FC-92.5modelDRUM-LRT-ESJNewNewDC POWER LIFTmodel DRUM-LRT-DCNewmodel DRUM-55-36model DRUM-55FPSHOWN WITH SCALE,model DRUM-SCLFmodel DRUM-SCLFmodelDRUM-LRT-ECDC POWER LIFTmodel DRUM-LRT-DC-IIHAND PUMP LIFTmodel DRUM-LRTSWING LEGmodel DRUM-LRT-IImodel DRUM-55FPmodel DRUM-55Smodel DRUM-SCLGwww.vestil.com Phone (800) 348-0868173DRUM, CYLINDER, PAIL EQUIPMENT
174model DCR-H-HP-DCSECURE GRIPDVD or VIDEOAVAILABLEDCR-SCALEmodelDCR-880-MmodelDCR-880-HEconomical Drum TransportersUnique portable unit designed to lift and transport plastic, steel, and fiber drums with atop lip. Steel jaw securely grips the top lip of the drum. Available with either a manualmechanical ratchet or a foot pump hydraulic lift mechanism. Straddle legs rotate foraccess to drums on pallets. Unit rolls on (4) 8" x 2" glass-filled casters. The push handlefolds down for easy access to ratchet and foot pump. All welded steel construction.Powder coated with a safety yellow finish. Optional scale weighs drums to an accuracyof +/-0.5 lbs. Optional scale includes (6) D cell batteries and an AC adaptor.MODELNUMBERJAW SERVICERANGEUNIFORMCAPACITYNET WT.(LBS.)LIST PRICEEACHDESCRIPTIONDCR-880-M HAND RATCHET 31" to 46½" 880 170 $819.00DCR-880-H FOOT PUMP 31" to 48½" 1,500 190 934.00DCR-880-H-HP FOOT PUMP 31" to 72" 880 240 1,022.00DCR-880-H-DC DC POWERED 31" to 48½" 1,500 200 $2,568.00DCR-880-H-HP-DC DC POWERED 27" to 74" 880 250 2,656.00DCR-SCALE OPTIONAL WEIGHT SCALE 1,500 70 $1,342.00DC-25/FC-70Drum ControllerTransport 55-gallon steel drums from work area to work area with the heavy-duty DrumController. This unit lifts drums off the ground 2¼" with minimal effort (all this is donewithout straps or ratchet). To lift drums, center the arms around the drum below theupper rib then pull the handle down. Inside straddle width is 25". Unit rolls smoothlyon 8" x 2" phenolic casters. Steel construction.MODELNUMBEROVERALL SIZE(W x D x H)LIFTHEIGHTUNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHDC-550 33" x 33¾" x 63" 2¼" 550 140 $516.00DC-25/FC-70Lo-Profile Drum Caddies with Bung Wrench HandleReduce injuries caused by manually lifting and moving drums. Transport (1) 55 or 30-gallon drum or (2) 5-gallon pails with the Lo-Profile Drum Caddy. To use: align unitin front of drum, remove handle, and grip drum with the handle. Tip drum up whileguiding the caddy base under the drum. Re-attach handle and transport drum to desiredlocation. Unit rolls easily on two 6" x 2" rigid wheels and one 3" x 1" swivel caster. Theremovable handle doubles as a bung nut wrench and seal remover. Cradle height is ½".Inside cradle diameter is 23½". Steel construction. Yellow painted finish.DRUM, CYLINDER, PAIL EQUIPMENTPhone (800) 348-0868NewNewMODELNUMBERSTRADDLE(W x D)UNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHWHEEL TYPELO-DC-MR 26" x 16" 1,000 MOLD-ON-RUBBER 38 $109.00LO-DC-CI 26" x 16" 1,200 STEEL 40 123.00LO-DC-PU 26" x 16" 1,200 POLY-ON-STEEL 38 109.00LO-DC-PH 26" x 16" 1,200 PHENOLIC 38 132.00DC-25/FC-70Manual Low Profile Hydraulic Drum TruckIdeal for loading and unloading 55 gallon steel, plastic and fiber drums when no forktruck is available. This device allows a single operator to engage elevated drums as wellas to transport and position drums. A spring-loaded clamp securely grasps the rim ofa drum. To elevate the rim clamp up to 5 feet, the truck incorporates a foot-operatedhydraulic pump. Unit rolls smoothly on 2 rigid 2½" x 1½" front wheels and 3⅛" x 1¼"poly rear wheels. Truck is easy to assemble/disassemble for storage.MODELNUMBEROVERALL SIZE(W x D x H)LOWEREDHEIGHTRAISEDHEIGHTUNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHLPDT 34" x 37" x 60" 32 7 /8" 64 9 /16" 600 155 $605.00DC-25/FC-70Pallet Straddling Drum TruckA single operator can engage, lift and transport drums stored either on the center ofpallets or the corner of containment skids. Works with 30 and 55 gallon steel, plastic andfiber drums. To engage a drum, the truck uses a rim clamp that securely grasps the toplip of the drum. Two rigid and two swivel polyurethane wheels provide a high degree ofmaneuverability; each swivel wheel is protected by guards and is equipped with brakes.MODELNUMBEROVERALL SIZE(W x D x H)LOWEREDHEIGHTRAISEDHEIGHTUNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHPSDT 38 9 /16" x 32" x 47" 35¾" 46 3 /8" 550 110 $521.00DC-25/FC-70www.vestil.com
Barrel/Drum TrucksThe Barrel/Drum Truck handles 30 and 55-gallon steel and fiber drums that are 24" to48" high. Adjustable chime hook helps to secure the drum. Wheels measure 12" x 2"and are available in rubber-on-steel or polyurethane-on-steel. Uniform capacity is 800pounds. DBT-1200 series features a kickstand for holding unit at a tilt.POLY-ON-STEELmodel DBT-1200-P175MODELNUMBEROVERALL SIZE(W x L)WHEELTYPENET WT.(POUNDS)LIST PRICEEACHDBT-1200 24½" x 60" RUBBER-ON-STEEL 58 $186.00DBT-1200-P 24½" x 60" POLY-ON-STEEL 61 153.00DBT-RED 24¼" x 60¼" POLYURETHANE 60 $172.00DC-25/FC-100Deluxe Tilt Back Drum TruckMove, tilt and unload heavy 30 or 55-gallon steel drums with ease. A foot rest helps inloading and supports a loaded drum truck. Unit rolls quietly on 10" x 2" mold-on-rubberwheels. Deluxe chime gripper for quick and easy drum transportation. Assembly required.MODELNUMBEROVERALL SIZE(W x D x H)UNIFORMCAPACITYWHEELTYPENET WT.(LBS.)LIST PRICEEACHDBT-1000 22½" x 24 3 /8" x 59" 1,000 POLY-ON-STEEL 52 $230.00DC-25/FC-100Drum Truck with Spring AssistHand truck designed for moving 55-gallon steel, plastic, and fiber drums weighing up to1,000 lbs. Special design features spring mechanism for easy use. Spring allows for easiertilting of fully-loaded drums. Removable hook bar includes built-in bung nut wrenches. Steelconstruction with powder coat yellow finish. 10" x 2½" wheels standard.POLYURETHANEmodel DBT-REDRUBBER-ON-STEELmodel DBT-1200MODELNUMBERDRUMTYPESOVERALL SIZE(W x D x H)WHEELTYPENET WT.(POUNDS)LIST PRICEEACHDBT-SA-MR STEEL 23½" x 14½" x 61" MOLD-ON-RUBBER 58 $312.00DBT-SA-PO STEEL 23½" x 14½" x 61" POLY-ON-STEEL 61 289.00DBT-P-SA-MR PLASTIC 23½" x 22" x 62¼" MOLD-ON-RUBBER 64 $345.00DBT-P-SA-PO PLASTIC 23½" x 22" x 62¼" POLY-ON-STEEL 67 322.00DC-20/FC-70Multi-Purpose Drum & Hand TruckMulti-purpose unit serves as a drum truck, drum cradle, and a hand truck. Extra-long handlesgive leverage for access to drums on pallets. Unit lies horizontally for use as a drum cradle toempty drum contents. Steel nose plate and drum tines are interchangeable. Features large 16"x 4" diameter wheels for use over rough terrain. Includes built-in bung nut wrench. Ships fullyassembled ready for immediate use. Drum is 14½" high when in cradle position.MODELNUMBEROVERALL SIZE(W x L x H)UNIFORMCAPACITYWHEELTYPENET WT.(POUNDS)LIST PRICEEACHDCHT-1 25" x 31½" x 61" 500 PNEUMATIC 59 $425.00DCHT-1-FF 25" x 31½" x 61" 750 FOAM FILLED 63 561.00DC-25/FC-70Multi-Purpose Drum Truck/CradleOne of the most versatile drum trucks in the industry. This innovative productallows the operator to easily tip back the truck in order to transport drumsergonomically on four wheels. Unit doubles as a drum cradle for storage anddispensing all in one. Top angle is 3° when used as a Drum Cradle. This uniquedesign also allows the operator to place drums and retrieve off of a pallet.Accommodates 55-gallon steel, plastic, or fiber drums. Rolls smoothly on (2) 3"x 1¼", (2) 8" x 2", and (2) 6" x 2" casters. Standard with a wheeled undercarriagethat positions the drum horizontally for drainage or storage. The drum height is 13"high in the cradle position. An integral self-storing bung wrench is standard. Thisattractive feature not only opens numerous drums, but helps to keep the drum snugon the truck. A convenient kickstand allows for upright storage. Powder coat finish.Optional drip pan available.MODELNUMBEROVERALL SIZE(W x L x H)UNIFORMCAPACITYWHEELTYPENET WT.(POUNDS)LIST PRICEEACHRDBT-MR 23½" x 20" x 61" 1,000 MOLD-ON-RUBBER 70 $268.00RDBT-SS 23½" x 20" x 61" 1,000 STEEL 72 291.00RDBT-PO 23½" x 20" x 61" 1,000 POLYOLEFIN 70 256.00RDBT-PAN OPTIONAL DRIP PAN W/BRACKETS (8¼"W x 11"L x 4"H) 2 $40.00DC-20/FC-70www.vestil.com Phone (800) 348-0868DRUM, CYLINDER, PAIL EQUIPMENT
176Economy Rotating Drum CartsEasy to operate. Includes two rigid and two swivel casters. Handle is NOT included -- must bepurchased separately. Optional handle includes bung nut wrench and a built-in drum tipper toassist with liquid drainage. Rugged steel construction with painted finish. Assembly required.RDC-60-5-HRRDC-60-NCRDC-60-HDLRDC-1000-5PUMODELNUMBERUNIFORMCAPACITYWHEELSIZEWHEELTYPENET WT.(POUNDS)LIST PRICEEACHRDC-60-NC 800 -- NONE 44 $91.00RDC-60-5-HR 800 5" HARD RUBBER 52 162.00RDC-60-5-PO 800 5" POLYOLEFIN 52 117.00RDC-60-5-SS 800 5" STEEL 52 133.00RDC-60-HDL OPTIONAL HANDLE 6 $19.00RDC-60-DPN OPTIONAL DRIP PAN 2 39.00DC-20/FC-70Deluxe Rotating Drum CartsPractical design is easy to operate and features a capacity of 1,000 pounds. Includes two rigidand two swivel casters. Two retractable wooden handles included for easy operation. Steelstops enable operator to hold drum during tipping operation and includes a built-in bung nutwrench as a bonus. Rugged steel construction with painted finish. Assembly required.DRUM, CYLINDER, PAIL EQUIPMENTNewvestilgreenPhone (800) 348-0868model VCRD-PRDC-1000-DPNmodel RDC-100model VCRDvestilgreenmodel DHDC-66MODELNUMBERUNIFORMCAPACITY (LBS)WHEELSIZEWHEELTYPENET WT.(LBS.)LIST PRICEEACHRDC-1000-5PU 1,000 5" POLY-ON-STEEL 58 $193.00RDC-1000-5PO 1,000 5" POLYOLEFIN 58 166.00RDC-1000-5SS 1,000 5" STEEL 60 171.00RDC-1000-DPN OPTIONAL DRIP PAN W/BRACKETS(8¼"W x 11"L x 4"H)2 $39.00Revolving Drum CartsMODELNUMBERMODELNUMBERDESCRIPTIONOVERALL SIZE(W x L x H)SUMPCAPACITYUNIFORMCAPACITYUNIFORMCAPACITY (LBS)NET WT.(POUNDS)NET WT.(POUNDS)DC-20/FC-70These carts are designed to rotate 55-gallon drums from the vertical position to the horizontalposition so their contents may be emptied. Equipped with rollers for mixing. Includes a builtin drip pan to provide a clean safe work floor. Rolls on two 3" swivel casters and two 5" rigidcasters. Simple one-person operation. Steel construction. Powder coat finish.LIST PRICEEACHRDC-100 CART/ DISPENSER 21" x 37" x 25" 1,000 60 $208.00DC-20/UPS/FC-100/250Poly Drum CradlesDispense drum contents into smaller containers and avoid messy clean-ups with our PolyDrum Cradles. The horizontal drum cradle collection system captures all spills and leaks andstores them in the interior of the hollow cradle for reuse or safe, clean disposal. 2" NPT drainplug is standard. Fork entry measures 6" x 3". Made from 100% virgin polyethylene.Model VCRD-P features retractable handles for tilting and positioning drums. Includes around contoured lower back for easier rotation of drums from horizontal to vertical positionand 6" x 2" polyolefin wheels.LIST PRICEEACHDESCRIPTIONSTANDARDVCRD STATIONARY 41-GALLONS 800 30 $180.00VCRD-P PORTABLE 30-GALLONS 800 45 349.00“GREEN” 100% RECYCLED MATERIALVCRD-GRN STATIONARY 41-GALLONS 800 30 $180.00VCRD-P-GRN PORTABLE 30-GALLONS 800 45 349.00Dispensing Containment CartDC-20/FC-125Drum handling, dispensing and containment all in one unit. Unlike alternative products, theopen containment sump does not require spills to flow inside the double walls to meet EPAregulations -- easy to clean; eliminates residue concerns as related to compatibility. Can be usedwith 55 or 30 gallon drums, nylon strap keeps drums secure. Large 10" wheels roll easily overshop and factory floors.MODEL OVERALL SIZESUMPUNIFORM NET WT. LIST PRICENUMBER (W x D x H)CAPACITY CAPACITY (LBS) (POUNDS) EACHDHDC-66 32" x 72¼" x 27" 66-GALLONS 600 118 $554.00DC-20/FC-125www.vestil.com
Steel Retention Basin CartsTransfer 55-gallon steel drums from area to area and then safely dispense the drums with thisnonflammable Retention Basin Cart. This unit is constructed of steel to resist extreme heatenvironments. Portability is made easy with the (2) rigid and (2) swivel with lock polyurethanecasters. A push handle is located at one end for easy maneuverability. Removable grating isstandard. Model SRBC-HR-YL features a stand which measures 20"W x 32"L x 18"H.MODELNUMBEROVERALL SIZE(W x L x H)UNIFORMCAPACITYNET WT.(LBS.)LIST PRICEEACHDRUM CAPACITYCOLORSRBC-1 (1) VERTICAL 34" x 34" x 40" 600 BLUE 300 $910.00SRBC-YL-2 (2) VERTICAL 52" x 30" x 42" 1,200 YELLOW 155 601.00SRBC-HR-YL (1) HORIZONTAL 52" x 30" x 60" 1,200 YELLOW 193 671.00MEETS EPA 40 CPR - 264.175 & UFC 8003.1.3.4DC-20/FC-100Horizontal Steel Retention BasinsDispense or store 55-gallon steel drums with this non-flammable heavy-duty Horizontal SteelRetention Basin. This unit is constructed of steel to resist extreme heat environments. Therugged steel construction provides durability and repairability. Portability is made easy with thebuilt in fork pockets. The built-in horizontal drum cradles are sloped.MODELNUMBERDRUMCAPACITYOVERALL SIZE(W x L x H)UNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHCOLORHSRB-YL-1 1 27" x 49" x 32" 1,200 YELLOW 146 $449.00HSRB-YL-2 2 49" x 49" x 32" 1,200 YELLOW 248 812.00HSRB-4 4 61" x 52" x 48" 2,400 BLUE 441 1,172.00MEETS EPA 40 CPR - 264.175 & UFC 8003.1.3.4DC-20/FC-100Vertical Steel Retention BasinsStore 55-gallon steel drums in the vertical position with these new non-flammable heavy-dutyDrum Basins. The basin is constructed of steel to resist extreme heat environments. The ruggedsteel construction provides durability and repairability. Four way fork entry. Basins are stackablewhen empty to provide more space in a warehouse or storage area.vestilgreenmodel HSRB-YL-2vestilgreenmodel HSRB-YL-1177model SRBC-YL-2NewMODELNUMBERDRUMCAPACITYOVERALL SIZE(W x L x H)UNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHCOLORVSRB-1 1 DRUMS 34" x 34" x 18" 600 BLUE 195 $354.00VSRB-YL-2 2 DRUMS 27" x 49" x 14" 1,200 YELLOW 108 505.00VSRB-YL-4 4 DRUMS 49" x 49" x 14" 2,400 YELLOW 166 659.00VSRB-IN-4 4 DRUMS 107" x 34" x 10" 2,400 BLUE 380 $778.00MEETS EPA 40 CPR - 264.175 & UFC 8003.1.3.4DC-20/FC-100Stackable Transport Pallets with Side RailsMost spills occur when transporting chemicals. Safely and securely move your chemicals withour Transport Pallets. Welded all steel construction with a durable finish. Galvanized gratingis easily removable for sump cleanup. 66-gallon sump capacity. Each unit is individually testedafter being welded and before paint for leaks with a low viscous die penetrant test. Four-wayforklift access. Meets EPA and UFC requirements.MODELNUMBEROVERALL SIZE(W x L x H)UNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHDRUM CAPACITYCOLORSTP-2 2 DRUMS 55" x 34" x 55" 1,200 BLUE 310 $830.00STP-4 4 DRUMS 55" x 50" x 54" 2,400 BLUE 385 869.00STP-BAR SECURITY BAR 54" -- -- 4 $65.00MEETS EPA 40 CPR - 264.175 & UFC 8003.1.3.4DC-20/FC-100Vertical Steel Retention Basins with Separation WallsThese retention basins with splash walls protect and provide additional separation of yourchemicals while transporting drums. Durability of all steel construction insures years of use ineven the harshest industrial conditions. Arms snap into place on uprights to provide optionalself system available for storing smaller drums or other containers. Arms measures 23"L x18½"D. Enamel blue finish is standard; galvanized is available, contact factory.MODELNUMBERDRUMCAPACITYOVERALL SIZE(D x L x H)UNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHCOLORVSRB-WS-2 2 DRUMS 34" x 54" x 55" 1,200 BLUE 320 $900.00VSRB-WS-4 4 DRUMS 50" x 55" x 53" 2,400 BLUE 410 1,075.00VSRB-SAU 1 PAIR SHELF UPRIGHT ARMS & UPRIGHTS 10 $197.00VSRB-SA 1 PAIR SHELF ARMS 5 115.00DC-20/FC-100model VSRB-IN-4vestilgreenNewmodel STP-4model VSRB-WS-4shown with model VSRB-SAUvestilgreenwww.vestil.com Phone (800) 348-0868DRUM, CYLINDER, PAIL EQUIPMENT
178model DR-1-DPmodel DR-4-DP-GRNmodel DR-3-DPvestilgreenNewseries VLPDPmodel DR-2-DP-GRNPlastic Pallets & Drum Spill ContainersLow Profile Spill Decks are designed to catch spills. Manufactured from chemical resistantpolyethylene. Removable decking standard.Drum Spill Pallets, series DR, industrial strength molded polyethylene pallets with unique patentedgrid pattern drainage deck capture container spills and leaks of expensive materials for reuse. Uniquedesign minimizes sloshing when transporting. Excellent for collecting most hazardous products.Dozens of applications when coordinated with many other containment products.MODELNUMBERDRUMSCAPACITYOVERALL SIZE(W x L x H)SUMPCAPACITYUNIFORMCAPACITYNET WT.(LBS.)LIST PRICEEACHSTANDARDVLPDP-2448•• 2 24" x 48" x 2¼" 9 gal. 1,600 24 (UPS) $148.00VLPDP-4848•• 4 48" x 48" x 2¼" 18 gal. 3,200 40 254.00DR-1-DP 1 36" x 36" x 16" 61 gal. 800 40 $195.00DR-2-DP 2 26¼" x 50" x 16" 61 gal. 1,600 40 195.00DR-3-DP 3 26¼" x 76" x 11" 65 gal. 2,400 60 275.00DR-4-DP 4 49" x 49" x 16" 110 gal. 3,200 80 300.00"GREEN" 100% RECYCLED MATERIALVLPDP-2448-GRN •• 2 24" x 48" x 2¼" 9 gal. 1,600 24 (UPS) $148.00VLPDP-4848-GRN •• 4 48" x 48" x 2¼" 18 gal. 3,200 40 254.00DR-1-DP-GRN 1 36" x 36" x 16" 61 gal. 800 40 $246.00DR-2-DP-GRN 2 26¼" x 50" x 16" 61 gal. 1,600 40 246.00DR-3-DP-GRN 3 26¼" x 76" x 11" 65 gal. 2,400 60 334.00DR-4-DP-GRN 4 49" x 49" x 16" 110 gal. 3,200 80 403.00Utility TraysDC-20/DC-25*/FC-100/FC-150••Keep messy drips and spills off warehouse and factory floors. Heavy duty polyethyleneconstruction will not rust or corrode. Ribbed bottoms keep cans, pails, and other containerselevated above any spills or leaks. Stackable for easy storage, when not in use.vestilgreenNewMODELNUMBERINSIDE(W x D x H)OUTSIDE(W x D x H)UNIFORMCAPACITY (GAL)NET WT.(LBS.)LIST PRICEEACHUT-TRAY-2436 24" x 36" x 4¾" 28¼" x 40¼" x 5" 18 8 $62.00UT-TRAY-2448 24" x 48" x 4¾" 28¼" x 52¼" x 5" 24 11 73.00UT-TRAY-3048 30" x 48" x 4¾" 33¾" x 52" x 5" 30 16 $94.00UT-TRAY-4048 40" x 48" x 3½" 44" x 52" x 4" 30 18 118.00DC-20/FC-125DRUM, CYLINDER, PAIL EQUIPMENTmodel OCT-275 with Optional Pull Over CoverNewmodel DSHRT-2Phone (800) 348-0868vestilgreenFuel Tank Containment with DrainComplete containment for 275 & 550 gallon oval tanks, indoors or outdoors! Eliminate costlyspills while storing fuels, oils and other hazardous liquids. Rugged, all polyethylene constructionwill not rust or corrode. Optional Pull Over Cover available.MODELNUMBEROVERALL SIZE(W x D x H)INSIDE TOP(W x D)INSIDE BOTTOM(W x D)NET WT.(POUNDS)LIST PRICEEACHOTC-275 84½" x 43¾" x 29" 80" x 39" 73" x 31" 90 $392.00OTC-550 87" x 60" x 33" 82" x 54" 75¾" x 47¾" 108 692.00Drum Storage Hard Top ContainerMODELNUMBEROVERALL SIZE(W x D x H)SUMPCAPACITYDRUMCAPACITYUNIFORMCAPACITYNET WT.(POUNDS)DC-20/FC-300Store hazardous drums safely outdoors with pumps and funnels in place. Tall 23¾" headspace easily accommodates rotary drum pumps and large conical funnels. Low profile (8¾")containment pallet positions drum-top funnels at safe, convenient level to pour hazardouswastes. Roll-top covers can be easily lifted from waist height to access drum tops -- no need toreach near ground level. Fork liftable, lockable, all polyethylene construction, will not rust orcorrode.vestilgreenLIST PRICEEACHDSHRT-2 67¼" x 41¼" x 74" 66-GAL. 2 4,500 260 $997.00DSHRT-4 64½" x 62" x 79" 75-GAL. 4 9,000 440 1,506.00DC-20/FC-250www.vestil.com
Overpack Drum Dollies & ContainersTransport containment units with Overpack Drum Dollies, series DRUM-SP. Designed tohold drum spill containers. Dollies roll smoothly on four swivel casters. Steel construction withpowder coat finish.The Containment Units, series SCC, are specially designed to contain leaks and spills from55-gallon drums during transportation and storage. Units can be transported with a fork truck.MODELNUMBEROVERALL SIZE(W x L x H)SUMPCAPACITYUNIFORMCAPACITYNET WT.(LBS.)LIST PRICEEACHCONTAINMENT UNITS - STANDARDSCC-55 29" x 29" x 26" 65-GALLON 800 20 $129.00SCC-2-55 31½" x 58" x 22½" 120-GALLON 1,600 48 144.00SCC-CVR COVER/LID 12 $80.00CONTAINMENT UNITS - "GREEN" 100% RECYCLED MATERIALSCC-55-GRN 29" x 29" x 26" 65-GALLON 800 20 $129.00SCC-2-55-GRN 31½" x 58" x 22½" 120-GALLON 1,600 48 144.00SCC-CVR-GRN COVER/LID 12 $67.00vestilgreenOVERPACKCONTAINERmodel SCC-55179OVERPACK DRUM DOLLYseries DRUM-SPOVERPACK DRUM DOLLIESMODELNUMBEROUTSIDEDIAMETERINSIDEDIAMETERCASTERTYPEUNIFORMCAPACITYFITSSERIESNET WT.(LBS.)LIST PRICEEACHDRUM-SP-28-12-C 28 3 /8" 28" STEEL 1,200 SCC-55 54 $81.00DRUM-SP-28-9-H 28 3 /8" 28" HR* 900 SCC-55 51 69.00DRUM-SP-32-12-C 32" 31 5 /8" STEEL 1,200 N/A 59 $87.00DRUM-SP-32-9-H 32" 31 5 /8" HR* 900 N/A 57 72.00DRUM-SP-SSC-2 25" x 52" x 6½" POLY 1,600 SSC-2-55 36 $167.00*HARD RUBBERALSO FITS "GREEN" VERSIONDrum LiftersMODELNUMBERACCEPTABLEDRUM TYPEOPERATIONMETHODUNIFORMCAPACITYNET WT.(POUNDS)DC-20/FC-70Model FDT-22 can be used to lift both 30 and 55-gallon steel drums with either an overheadchain or hoist. This unique lifting system holds drums securely with a locking safety handle.Steel construction with powder coat finish.Model DL-31 may be used to lift 30 and 55-gallon steel drums with either an overhead chain orfork truck. Hook opening measures 4"W x 2"H. Steel construction with powder coat finish.LIST PRICEEACHFDT-22 55 & 30-GALLON STEEL CHAIN 1,000 26 $131.00DL-31 55 & 30-GALLON STEEL FORK/CHAIN 1,500 37 132.00DC-25/UPS/FC-100Automatic Overhead Drum LifterDesigned to handle 55-gallon steel, plastic, and fiber closed head drums with a top lip.Automatic secure and release eccentric lock makes this drum handler a real time saver. Includesadjustable positioning feature for increased adaptability. Requires assistance from an overheadlifting device. Not for use with open head drums.MODELACCEPTABLEUNIFORM NET WT. LIST PRICENUMBERDRUM STYLESCAPACITY (POUNDS) EACHPDL-800 55-GALLON STEEL, PLASTIC & FIBER 800 60 $501.00Multi-Purpose Overhead Drum Lifter/WrenchDC-25/UPS/FC-100Simple three-arm design for use with closed head 30 and 55-gallon steel, plastic, and fiberdrums with a top lip. Each removable arm also functions as a wrench for use on drum plugs,faucets, and rim ring bolts. Mechanical operation. Requires assistance from an overhead liftingdevice. Durable powder coat finish. Steel construction.MODELACCEPTABLEUNIFORM NET WT. LIST PRICENUMBERDRUM STYLESCAPACITY (LBS) (POUNDS) EACHPDL-800-M STEEL, PLASTIC & FIBER 800 20 $135.00Vertical Drum ClampMODELNUMBERACCEPTABLEDRUM TYPEUNIFORM CAPACITY(POUNDS)NET WT.(POUNDS)DC-25/UPSEasily moves and handles open or closed head loaded steel drums. Allows quick, gentle loadinginto overpacks and keeps drums upright during lift, reducing spills and injuries.LIST PRICEEACHVDC-1000 STEEL, PLASTIC & FIBER 1,000 11 $52.00DC-25/UPSmodel DRUM-SP-SSC-2model FDT-22model PDL-800DVD or VIDEOAVAILABLEDVD or VIDEOAVAILABLEmodel DL-31DVD or VIDEOAVAILABLEmodel PDL-800-MNewmodel VDC-1000www.vestil.com Phone (800) 348-0868DRUM, CYLINDER, PAIL EQUIPMENT
180model DCL-1000DVD or VIDEOAVAILABLEmodel CDL-2000model VDL-22.5DVD or VIDEOAVAILABLEDrum ClutchersAllows for easy lifting and transporting of steel drums with an overhead lifting chain or hoist.The Drum Clutcher is ideal for placing drums in secondary containment and salvage drums.Designed for steel drums with a top lip or chime. Not for use with open head drums.MODELNUMBERACCEPTABLEDRUM TYPEUNIFORM CAPACITY(POUNDS)NET WT.(POUNDS)LIST PRICEEACHDCL-550 30-GALLON STEEL 1,000 18 $95.00DCL-1000 55-GALLON STEEL 1,000 23 102.00DC-25/UPSVertical Drum LifterThe Vertical Drum Lifter provides for easy lifting and transporting of drums. Solid steelconstruction. To use, simply lower unit onto the drum and as the lifter is elevated the positivegripping pads secure the drum. When the drum is lowered to the ground, the carriage dropsdown, automatically locking the drum lifter in an open position, ready for another drum. Useon 55-gallon steel drums with a top lip or chime. Not for use with open head drums.MODELNUMBERACCEPTABLEDRUM TYPEUNIFORM CAPACITY(POUNDS)NET WT.(POUNDS)LIST PRICEEACHVDL-22.5 55-GALLON STEEL 1,000 60 $132.00DC-25/UPSChain Drum LifterDesigned for drum lifting and transporting with an overhead lifting device. Constructed ofgrade 80 chain for OSHA & ANSI compliance. Easy to use design. Drum clamps includespring-loaded latch for positive drum grip. For use with closed head steel, plastic, and fiber 30and 55-gallon drums with a top lip.MODELNUMBERACCEPTABLEDRUM TYPESUNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHCDL-2000 PLASTIC, STEEL & FIBER DRUMS 2,000 8 $75.00DC-25/UPSCrane/Hoist Drum LiftersThe Crane/Hoist Drum Lifter has an automatic mechanical operation. Great for positioningdrums in and out of overpacks. Steel construction with spring loaded arms for safety.Accommodates steel, plastic, or fiber drums. Overall dimensions are 16"W x 9½"L x 21½"D.Drums weighing over 500 pounds must have top lid secured before lifting.DRUM, CYLINDER, PAIL EQUIPMENTNewPhone (800) 348-0868model CHDL-1620model TDR-55model DTH-1000model TDR-55-GMODELNUMBERACCOMMODATESDRUM DIAMETERUNIFORM CAPACITY(POUNDS)NET WT.(POUNDS)LIST PRICEEACHCHDL-1620 16" TO 20" 1,000 21 $292.00CHDL-2025 20" TO 25" 1,000 21 292.00DC-25/UPSTilting Drum RingsEasily transport steel drums with your fork truck and the Tilting Drum Ring. Pivoting forkpockets allow you to manually rotate drum to dispense light materials. To use, slip the bandover the belly of the steel drum and tighten the lock to secure the band around the belly of thedrum. Usable fork openings are 5¾"W x 3"H each. Welded steel constructionMODELNUMBERUSABLEDRUM SIZEMATERIAL & FINISHUNIFORM*CAPACITYNET WT.(LBS)LIST PRICEEACHTDR-30 30-GAL PAINTED CARBON STEEL 1,200 16 $61.00TDR-55 55-GAL PAINTED CARBON STEEL 1,200 24 69.00TDR-30-G 30-GAL GALVANIZED CARBON STEEL 1,200 16 79.00TDR-55-G 55-GAL GALVANIZED CARBON STEEL 1,200 24 89.00TDR-30-SS 30-GAL GRADE 304 STAINLESS STEEL 1,200 16 189.00TDR-55-SS 55-GAL GRADE 304 STAINLESS STEEL 1,200 24 199.00*CAPACITY IS BASED ON FULL DRUMSDC-25/UPSHALF-FULL DRUMS ARE RATED AT 600 LBS. UNIFORM CAPACITYHorizontal Semi-Automatic Drum TongMade to lift drums with an overhead hoist. Suitable for open top or tight head steel drum andplastic drums which have a ring. To operate set locking lever in locked open position. Whencentral over the horizontal drum release lever to allow hooks to fall and locate under both rims.Hook automatically engage as it is lifted and disengage as drum is set down.MODELNUMBERACCEPTABLEDRUM TYPEUNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHDTH-1000 55-GALLON STEEL, PLASTIC & FIBER 1,000 17 $55.00DC-25/UPSwww.vestil.com
181Drum SlingsLift drums in the horizontal position quickly and easily with these Drum Slings. Handle open orclosed head steel drums. The large steel lifting ring accommodates most overhead lifting systems.Choose from brass, iron, or galvanized iron construction. Accepts 30 and 55-gallon steel drums.MODELNUMBERACCEPTABLEDRUM TYPESUNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHSTYLEDCS-750-B 30 & 55-GALLON STEEL BRASS 750 6 $105.00DCS-1000-I 30 & 55-GALLON STEEL IRON 1,000 6 37.00DCS-2000-G 30 & 55-GALLON STEEL GALVANIZED 2,000 11 69.00DC-20/UPS/FC-70Near Vertical Drum LifterThis product is designed for the transportation of 55-gallon closed head steel drums with anoverhead lifting device. Adjustable attachment point allows drum to be lifted from a horizontal to anear-vertical position. Easily attaches to any drum with both a top and bottom lip. Adjustable topattachment point for use with different height drums. Steel construction. Powder coat blue finish.MODELNUMBERACCEPTABLEDRUM HEIGHTSUNIFORM CAPACITY(POUNDS)NET WT.(POUNDS)LIST PRICEEACHNVD-40 16" TO 40" 1,000 40 $179.00DC-20/UPS/FC-70Manual Drum UpenderManual Drum Upender provides the leverage needed for tilting horizontal drums to the verticalposition. Constructed of solid steel for long life. Wide toeplate prevents denting on barrel sides.Narrow top plate grabs a variety of chimes. Powder coat finish. Steel construction.MODELNUMBERHANDLELENGTHNET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONDTP-11 UPENDER FOR HORIZONTAL DRUMS 40" 13 $30.90DC-20/UPS/FC-70Drum WedgeDrum wedge allows residual liquids to flow to one side of drum for efficient pumping. Valuablechemicals can be used, and not wasted. Durable, all polyethylene construction, designed for usewith 30 or 55 gallon drums.NewMODELNUMBEROVERALL SIZE(W x H)NET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONDRUM-WEDGE DRUM WEDGE 11½” x 11½” 2 $25.00DC-20/UPS/FC-250Drum ChocksEliminate the need for expensive specialty racks and stands to store your drumshorizontally. Now, with the Drum Chock, you can store your drums horizontally onstandard pallet racks or on wooden pallets. The chock eliminates rolling while drums arestored on their side. Models are also available to tilt drums forward for better drainagefrom standard faucets. Front stops are included on tilted models to eliminate drum slideoff. Constructed of recycled polyethylene.MODELNUMBER WIDTH DEPTH HEIGHTPIECESPER BOXNET WT.(POUNDS)NewLIST PRICEPER BOXSTANDARDVDRCH-1 15" 6" 2" 4 8 $50.00VDRCH-2 15" 29½" 2" 2 10 75.00VDRCH-3 15" 36" 4" 1 9 57.00VDRCH-4 18" 36" 5½" 1 12 75.00“GREEN” 100% RECYCLED MATERIALVDRCH-1-GRN 15" 6" 2" 4 8 $50.00VDRCH-2-GRN 15" 29½" 2" 2 10 75.00VDRCH-3-GRN 15" 36" 4" 1 9 57.00VDRCH-4-GRN 18" 36" 5½" 1 12 75.00DC-20/FC-100DRUM WEDGEMINI CHOCKmodel VDRCH-1INCLINED SHELFmodel VDRCH-3SHELF CHOCKmodel VDRCH-2INCLINED SHELFWITH FORK OPTIONmodel VDRCH-4www.vestil.com Phone (800) 348-0868DRUM, CYLINDER, PAIL EQUIPMENT
182USE WITHPALLET TRUCKSUSE WITHFORK TRUCKSDrum StandsDrum Stands provide economical and convenient portability. These stands offer a uniquelydesigned understructure that allows for transporting of drums with either a pallet truck orfork truck. Fork lock tabs minimize the possibility of the drum stands accidentally tippingwhile being transported with a fork truck. Accepts steel, plastic, and fiber drums.The Drum Stand also allows for single drum stacking for easy storage of drums up to threehigh (empty stands are nestable and stackable). All welded steel construction. Stands includea safety yellow powder coat finish.MODELNUMBERACCEPTABLEDRUM STYLESOVERALLSIZE (D x W)UNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHDRUM-ST 30 & 55-GALLON DRUMS 25" x 5" 1,500 35 $99.00DC-20/UPSDrum Tiers for safer drum stackingIncrease storage space by stacking your drums with our Drum Tier. The economical DrumTier is designed to help maximize floor space in a safe and convenient manner. The lightweightdesign utilizes one person operation. Handles steel drums up to five units high. Tabs keepdrums aligned when stacked.MODELNUMBERACCEPTABLEDRUM TYPESOVERALLDIAMETERNET WT.(POUNDS)LIST PRICEEACHDTR-20 30-GALLON STEEL DRUMS 20" 16 $66.00DTR-24 55-GALLON STEEL DRUMS 24" 22 70.00DTR-28 85-GALLON STEEL DRUMS 28" 26 74.00DC-20/UPSPolyethylene Drum DolliesManufactured from high impact strength polyethylene, these drum dollies are lightweight yetstrong. Dollies come standard with (4) 3" swivel poly casters, and they are suited for both indoorand outdoor applications. Specify blue, black, green, red, yellow, or white when ordering.DRUM, CYLINDER, PAIL EQUIPMENTmodel POLY-D-55-GRNACMODELNUMBERBDMODELNUMBERDRUM TYPE(GALLON)ACCEPTABLEDRUM TYPESCASTERTYPEPOLYDIAMETERAPPROX.HEIGHTUNIFORMCAPACITYUNIFORMCAPACITYNET WT.(POUNDS)NET WT.(POUNDS)LIST PRICEEACHSTANDARDPOLY-D-30 30-GALLON 20" 600 12 $70.00POLY-D-55 55-GALLON 24" 600 15 76.00“GREEN” 100% RECYCLED MATERIALPOLY-D-30-GRN 30-GALLON 20" 600 12 $70.00POLY-D-55-GRN 55-GALLON 24" 600 15 76.00MODELNUMBERACCEPTABLEDRUM STYLESOVERALL SIZE(D x H)UNIFORMCAPACITYNET WT.(POUNDS)DC-20/UPSLIST PRICEEACHDRUM-PDD 30 & 55-GALLON 24¼" x 7" 600 15 $89.00DC-25/UPSMobile Drum DolliesTransport ordinary or specialty drums easily withthese multipurpose Drum Dollies. Variousconstructions, designs, caster types and sizes toaccommodate your application. Assembly required.A) The cross arm dolly accommodates 30, 55, 85 and95 gallon drums or adjusts to fit multiple square andrectangular crates. Blue powder coat finish.LIST PRICEEACHTYPEDESCRIPTIONA DRUM-X-H ADJUSTABLE 30, 55, 85 & 95 HARD RUBBER 5¼" 1,000 20 $108.00A DRUM-X-C ADJUSTABLE 30, 55, 85 & 95 CAST STEEL 5¼" 1,200 24 125.00B DDO-P103-HT3 CAST IRON 55 & 30 HARD RUBBER 4½" 550 29 $69.00B DDO-P103-SS3 CAST IRON 55 & 30 SEMI-STEEL 4½" 600 32 69.00C DRUM-SS-55-H STAINLESS STEEL 55 HARD RUBBER 6" 800 22 $113.00E DDO-P105-SS3 DRUM HALO 55 SEMI-STEEL 4½" 750 57 $118.00E DRUM-DRH-HR WITH HANDLE 55 HARD RUBBER 6" 1,000 34 $79.00DC-25/UPS/FC-70Phone (800) 348-0868model DRUM-PDDvestilgreenNewMulti-Level Plastic Drum DollyHeavy-duty molded plastic (HDPE) construction with support rib understructure. Two tierdesign for use with both 55 and 30-gallon drums. Usable opening is 23⅜" for 55-gallon drumsand 18⅞" for 30-gallon drums. Rolls smoothly on five swivel 3" x 1¼" hard rubber casters.DVD or VIDEOAVAILABLENewEwww.vestil.com
Multi-Purpose DolliesThese multi-purpose dollies have a high polished bright zinc finish for corrosion resistance and(4) 3" x 1¼" swivel casters. Each unit comes with a 4 foot long nylon pull strap that helps intransporting down aisles or over thresholds. Rubber-coated hook allows strap to hook on top ofdrum for storageQuad Dolly, series DRUM-QUAD, can transport a 5-gallon pail, 30 or 55-gallon drum or LPgas tank. Available with hard rubber or cast iron wheels. Also available in Stainless Steel.Tri Dolly, series DRUM-TRI, will transport 5-gallon pails, 30-gallon drums, or LP gas tank.MODELNUMBERCASTERTYPEUNIFORM CAPACITY(POUNDS)NET WT.(POUNDS)LIST PRICEEACHDRUM-QUAD-H HARD RUBBER 900 30 $71.00DRUM-QUAD-C CAST IRON 1,200 31 94.00DRUM-QUAD-CS-SS* HARD RUBBER 900 30 146.00DRUM-TRI-H HARD RUBBER 900 30 $60.00DRUM-TRI-C CAST IRON 1,200 31 80.00*STAINLESS STEELDC-25/UPS/FC-70Octo & Heavy-Duty Drum DolliesThe Octo Drum Dolly, model OCTO-55, will transport 55-gallon drums weighing up to2,000 pounds. Rolls on (8) 4" x 1¼" cast iron swivel casters for maximum stability.Transport 55-gallon drums with the Heavy-Duty Drum Dolly, model DRUM-HD. With acapacity of 2,000 lbs., this dolly will transport your heavier drums from location to location.(4) 4" x 2" locking swivel glass-filled nylon casters with brakes standard.seriesDRUM-TRImodel OCTO-55183series DRUM-QUADMODELNUMBERACCEPTABLEDRUM TYPESCASTERTYPEUNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHOCTO-55 55-GALLON CAST IRON 2,000 51 $103.00DRUM-HD 55-GALLON GLASS-FILLED NYLON 2,000 42 95.00DC-25/UPS/FC-70Tilting Drum DolliesTilt drums 10° for better liquid extraction. Fits onto a variety of round steel drum dolly.Tilting feature is foot-operated and locks into place when activated. Patent pending.MODELNUMBERACCEPTABLEDRUM TYPESUNIFORM TILTCAPACITYUNIFORMCAPACITY (LBS.)NET WT.(LBS.)LIST PRICEEACHTILT-DOL-55-C 55-GALLON 200 1,200 24 $114.00TILT-DOL-55-H 55-GALLON 200 900 23 100.00DRUM-QUAD-H-TLT LP TANK 200 900 32 $114.00DRUM-QUAD-C-TLT 5, 30, 55 GAL. 200 1,200 33 137.00DRUM-TRI-C-TLT200 1,200 34 $123.005, 30, 55 GAL.DRUM-TRI-H-TLT 200 900 33 103.00DRUM-DRH-HR-TLT 55-GALLON 200 1,000 37 122.00*STAINLESS STEELDC-25/UPS/FC-70Drum StickProvides an ergonomic solution to pushing/pulling a drum while on a dolly. Make drumtransporting on a dolly easier and cleaner. Easily and quickly attaches to drum ring. Featuresrubber hand grips and a safety yellow powder coat finish. Works on open and closed headdrums. This multipurpose tool can open and close almost any size bung plug.MODELNUMBEROVERALLLENGTHOVERALLHEIGHTNET WT.(POUNDS)LIST PRICEEACHDRUM TYPEDRUM-STIK 30 & 55-GALLON 18" 5¼" 4 $39.95DC-25/UPSIntermediate Bulk ContainersSpace-savings storage containers are great for multi-trip applications. Designed for storage ofboth hazardous and nonhazardous contents. Easy to fill, stack and load. FDA compliant steelcage is hot-dipped galvanized. Pallet base is made from both steel and plastic. Includes innerstorage tank made from white plastic with UV-blocking additive. Includes 2" butterfly valvewith Viton gasket. Top fill cap is 6" diameter with 2" bung. Complete unit is UN approved.MODELNUMBEROVERALL SIZE(W x L x H)UNIFORM VOLUMECAPACITYNET WT.(POUNDS)LIST PRICEEACHIBC-275 45" x 47" x 39" 275-GALLON 130 $389.00IBC-330 53" x 47" x 39" 330-GALLON 140 419.00DC-20/FC-200model DRUM-HDwww.vestil.com Phone (800) 348-0868NewNewDRUM, CYLINDER, PAIL EQUIPMENT
184CLOSED HEADSTEEL DRUMQUICK RELEASELEVER OPTIONNewOPEN HEADSTEEL DRUMDrum HeatersQuickly and efficiently heat-up your steel drums or pails. Solves a wide range of freezeprotection, viscosity control, and process temperature applications. Easily adjust thermostatset-point: 50 to 425°F. for steel drums and 50 to 160°F. on poly drums. This extra-wide 4"silicone rubber band heater is moisture and chemical resistant. Multi-stranded groundedheating element provides uniform heat and a long service life. Spring closure can be expanded3". Unit comes with a 6-foot-long power cord, grounded 3-prong.MODELNUMBERUNIFORM DRUMCAPACITY VOLTS WATTSSTRAPSIZENET WT.(POUNDS)LIST PRICEEACHAMPSSTEEL DRUM HEATERSDRH-S-5 5 120 550 4" 4.5 3 $215.00DRH-S-15 15 120 700 4" 4.5 3 235.00DRH-S-30 30 120 1000 4" 4.5 4 270.00DRH-S-55 55 120 1200 4" 4.5 5 290.00DRH-S-55-240 55 240 1200 4" 2.3 5 290.00POLY DRUM HEATERSDRH-P-5 5 120 150 4" 4.5 3 $215.00DRH-P-55 55 120 300 4" 4.5 5 290.00DC-20/UPSSteel Drums Standard and U.N. RatedSteel DrumsQuality cold rolled drums meet most U.N. requirements for shipping and packaging. Druminterior is coated with a corrosion inhibitor. Open head drums have removable lids and 12 gaugebolt ring closure. Closed head drums have a 2" and ¾" bung. Additional sizes and stainless steeldrums available, contact factory. Steel surcharges may apply, contact factory.Stainless Steel DrumsHigh quality 304 stainless drums are finished in a 2B polish. Meets most U.N. requirements forshipping and packaging. Excellent corrosion resistance makes these Stainless Steel Drums superiorfor storage and shipping of foods and chemicals. Open head drums have removable lids and 12gauge bolt ring closure. Closed head drums have a 2" and ¾" bung.Quick Release Lever OptionThis option is used with open head drums only. Lever automatically tightens drum lids to U.N.specifications. Replaces standard 12 gauge bolt ring closure.DRUM, CYLINDER, PAIL EQUIPMENTSTANDARD STEEL DRUMSMODEL UNIFORM GALLONNUMBERCAPACITYGAUGETOP/BODY/BOTTOMUNSOLIDUNLIQUIDNET WT.(POUNDS)LIST PRICEEACHSTYLESD-30-OH-02 30-GALLON 20 / 20 / 20 OPEN HEAD 1A2 / X200 / S 1A2 / Y1.2 / 100 26 $93.00SD-30-OH-05 30-GALLON 18 / 18 / 18 OPEN HEAD 1A2 / X235 / S 1A2 / Y1.5 / 150 33 112.00SD-30-OH-07-Q 30-GALLON 16 / 18 / 18 OPEN HEAD 1A2 / X225 / S 1A2 / Y1.5 / 150 37 122.00SD-55-OH-04 55-GALLON 18 / 20 / 20 OPEN HEAD 1A2 / Y228 / S 1A2 / Y1.2 / 100 38 $115.00SD-55-OH-06 55-GALLON 18 / 18 / 18 OPEN HEAD 1A2 / X435 / S 1A2 / Y1.5 / 150 48 131.00SD-55-OH-07-Q 55-GALLON 16 / 18 / 18 OPEN HEAD 1A2 / X400 / S 1A2 / Y1.5 / 150 55 137.00SD-55-TH-15 55-GALLON 18 / 18 / 18 CLOSED HEAD N/A 1A1 / X1.8 / 300 48 111.00SUFFIX “Q” INDICATES THE QUICK RELEASE LEVER OPTIONDC-20/FC-CONTACT FACTORYSTAINLESS STEEL DRUMSMODEL UNIFORM GALLONNUMBERCAPACITYGAUGETOP/BODY/BOTTOMMODELNUMBERUNIFORMCAPACITYUNSOLIDUNIFORMCAPACITY DIAMETER HEIGHTUNLIQUIDUNSPECIFICATIONSNET WT.(POUNDS)NET WT.(LBS.)LIST PRICEEACHSTYLESSD-30-TH-03 30-GALLON 18 / 18 / 18 CLOSED HEAD N/A 1A1 / X1.2 / 300 33 $742.00SSD-30-OH-04 30-GALLON 18 / 18 / 18 OPEN HEAD 1A2 / X225 / S 1A2 / Y1.5 / 150 35 749.00SSD-55-OH-01 55-GALLON 16 / 16 / 16 OPEN HEAD 1A2 / X430 / S 1A2 / Y1.5 / 200 60 1,125.00SSD-55-TH-04 55-GALLON 16 / 16 / 16 CLOSED HEAD N/A 1A1 / X1.8 / 550 60 1,012.00DC-20/FC-CONTACT FACTORYPhone (800) 348-0868NewRound All-Fiber DrumsLightweight cost effective design for an alternative to steel drums. For use with dry or solidmaterials. All-fiber construction, does not include any steel components. Features flat topsand bottoms for better stacking and save storage space.LIST PRICEEACHFDR-5 5 GAL. 130 LBS. 11¼" 12¼" UN 1G/X60/S 2.5 $21.00FDR-12 12 GAL. 130 LBS. 12½" 22 2 /3" UN 1G/X60/S 4.5 23.00FDR-30 30 GAL. 260 LBS. 18½" 25 7 /8" UN 1G/Y120/S 12 38.00FDR-55 55 GAL. 260 LBS. 21½" 35" UN 1G/Y120/S 17.5 49.00DC-20/FC-125www.vestil.com
185Fiber DrumsA lightweight and cost effective alternative to steel drums. Open Head Fiber Drums are a greatchoice for storage and shipping of dry or solid materials. Steel chime reinforces the top andbottom to keep drum shape and secure contents. Lock rim side lever lock with steel lid cover.NewMODELNUMBERMODELNUMBER MATERIAL COLORMODELNUMBERMODELNUMBERACCEPTABLEDRUM TYPESOVERALL SIZE(H x D)OVERALLSIZENET WT.(POUNDS)NET WT.(POUNDS)LIST PRICEEACHTRASH-TOP-R STEEL RED 8½" x 24½" 8 $103.00TRASH-TOP-G STEEL GREEN 8½" x 24½" 8 103.00TRASH-TOP-B STEEL BLACK 8½" x 24½" 8 103.00FTT-RD FIBERGLASS RED 8½" x 24½" 4 $109.00FTT-GN FIBERGLASS GREEN 8½" x 24½" 4 109.00FTT-BK FIBERGLASS BLACK 8½" x 24½" 4 109.00DC-25/UPS/FC-250MODELNUMBERUNIFORMCAPACITYUNIFORMCAPACITY DIAMETER HEIGHTACCEPTABLEDRUM TYPESUNSPECIFICATIONSINSIDEDIAMETERNET WT.(POUNDS)NET WT.(POUNDS)LIST PRICEEACHFD-15 15 GAL 150 LBS 16" 20" UN 1G/Y72/S 7 $33.30FD-30 30 GAL 225 LBS 19" 27" UN 1G/X106/S 12 45.50FD-55 55 GAL 550 LBS 22" 36" UN 1G/Y260/S 18 62.80DC-20/FC-125Waste Disposal Tops for DrumsConvert empty drums into waste recycling, general or disposal containers. Spring-loaded frontdoor closes automatically to prevent bugs and bees from entering. Fits standard 55-gallon steeldrum, 23½" outside diameter. Secures to drum top with set screws. Powder coat finish.Galvanized Steel Drum CoversGalvanized steel drum covers for 55-gallon drums. Manufactured from 26 gauge galvanized steel.Cover drum tops for added protection. Perimeter rim is beaded for safety.Recycling Top, model CAN-CAP-G, includes a “CANS ONLY” decal. The disposal hole measures 3½".LIST PRICEEACHDC-235 CLOSED HEAD (tight head) 24½" 3½ $12.40DC-245 OPEN HEAD (tight head) 24½" 3½ 13.40DC-245-H OPEN HEAD (tight head) (WITH HANDLE) 24½" 3¾ 21.80CAN-CAP-G OPEN HEAD (tight head) 24½" 3½ $39.60Recycling LidsDC-35/UPS/FC-70Collecting aluminum cans or plastic bottles could not be easier with Recycling Lids. Fits plastic orsteel 55 gallon drums. Molded of blue (recycling) dent proof polyethylene for rust resistance andeasy cleaning. Recycling lid fits snug to the drum to resist blowing off in outdoor environments orbeing tampered with by people or animals. Optional colors available. 7" center opening.LIST PRICEEACHCAN-CAP-P STEEL OR PLASTIC DRUMS 24"O.D. x 4 3 /16"H 3 $27.00CAN-CAP-P-GRN STEEL OR PLASTIC DRUMS 24"O.D. x 4 3 /16"H 3 $27.00Drum CoversProtect your drums from bung seepage and unprotected outdoor storage situations.Convenient, and designed for years of reliable use.Series DC-TP is constructed of flexible 60 mil thick polyethylene.Features an ultraviolet screen. Temperature range is -50 to +212°F.Series VDC, simply set on top of the drum. The 2½" side lip keeps rain water out.This durable cover will allow other drums to be stacked on top of it. Overall heightis 3". Rigid Polyethylene construction. Specify color when ordering. Choose fromblue, black, green, red, yellow, or white.DC-20/UPS/FC-70model DC-TPvestilgreenNET WT.(POUNDS)model DC-235model DC-TPOLIST PRICEPER PKG.DESCRIPTIONDC-TP CLEAR PLASTIC, 55-GALLON CLOSED STEEL HEAD DRUMS (5 PER PKG.) 6 $70.00DC-TPO PLASTIC COVER, 55-GALLON OPEN STEEL HEAD DRUMS (5 PER PKG.) 6 70.00DC-TP-B BLACK PLASTIC, 55-GALLON CLOSED STEEL HEAD DRUMS (5 PER PKG.) 6 70.00VDC-30 30-GALLON OPEN OR CLOSED HEAD DRUMS (DIAMETER 20") (1 PER PKG.) 2 $14.00VDC-55 55-GALLON OPEN OR CLOSED HEAD DRUMS (DIAMETER 25") (1 PER PKG.) 3 15.00VDC-30-GRN 30-GALLON OPEN OR CLOSED HEAD DRUMS (DIAMETER 20") (1 PER PKG.) 2 $14.00VDC-55-GRN 55-GALLON OPEN OR CLOSED HEAD DRUMS (DIAMETER 25") (1 PER PKG.) 3 15.00NewmodelCAN-CAP-PNewvestilgreenDC-20/UPS/FC-100Newmodel DC-245-Hmodel CAN-CAP-Gvestilgreenmodel CAN-CAP-P-GRNmodel DC-TP-Bvestilgreenseries VDCwww.vestil.com Phone (800) 348-0868DRUM, CYLINDER, PAIL EQUIPMENT
186Manual Drum Deheadersmodel DD-9Convert your closed head steel drums into storage containers with our Drum Deheaders.The DD-9 can be adjusted to open steel drums with different thicknesses. The blade is angledfor maximum penetration and flattens the cut edge so there are no sharp or jagged edges.Replacement blades available.Quickly remove the head of a steel drum with our new Express-Open Drum Deheader! Uniquedesign, model D-HEAD-1, is similar to a household can-opener and is very easy to use. Includesvice-grip style mechanism for securely attaching unit to drum. A standard ½" ratchet drive(manual or pneumatic) must be used to operate the deheader (ratchet drive not included). Insidecutting blade does not leave a sharp edge on the drum. Replacement blades available separately,model D-HEAD-B. Both styles open 30 and 55-gallon steel drums and 5-gallon pails.model D-HEAD-1model DD-MNewMODELNUMBERNET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONDD-9 STANDARD DRUM DEHEADER 11 $70.00DDB-1 REPLACEMENT BLADE FOR DD-9 1 16.00D-HEAD-1 EXPRESS-OPEN DRUM DEHEADER 10 $113.00D-HEAD-B REPLACEMENT BLADE FOR D-HEAD-1 1 17.00D-HEAD-GK REPLACEMENT GEAR/BUSHING KIT FOR D-HEAD-1 1 17.70DC-25/UPS/FC-85Drum Deheadersmodel DD-EZ-MNewmodel DD-EZ-EManual Drum Deheader, model DD-M is for use with occasional drum deheading. Ribbed gripfor comfort of use and work on all 30-55 gallon drums.Burr-Free Manual Drum Deheader, model DD-EZ-M is a ratchet style manual drum deheader.For use with moderate drum volumes and leave a burr-free edge.Electric Drum Deheader, model DD-EZ-E is a compact, portable, self-propelled, electric unit. It isalso quiet, easy to use and designed for moderate drum deheading and leaves a burr-free edge.High Duty Drum Deheader, model DD-EX-E (electric) and model DD-EX-A (air powered) aredesigned for moderate to high drum deheading. Deheads a drum in less than 1 minute, leaves aburr-free edge, and is long lasting.model DD-EX-Emodel DD-EX-AMODELNUMBERNET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONDD-M MANUAL DRUM DEHEADER 7 $182.00DD-EZ-M BURR-FREE MANUAL DRUM DEHEADER 32 787.00DD-EZ-E ELECTRIC DRUM DEHEADER 32 1,350.00DD-EX-E HIGH DUTY ELECTRIC DRUM DEHEADER 73 $2,614.00DD-EX-A AIR POWERED DRUM DEHEADER 70 2,864.00NFCW** BRONZE NON-FERROUS CUTTING WHEEL 1 $173.00**FOR USE WITH DD-EZ-M & DD-EX-ADC-25/UPS/FC-85DRUM, CYLINDER, PAIL EQUIPMENTBNW-ABNW-I-WBNW-B-WBNW-IX-WBNW-PNewDrum Bung Nut WrenchesBung Nut Wrenches are available in several different materials to meet many applications.These multipurpose drum tools not only open and close drum bungs or plugs, they also workas a bung wrench, ring wrench and faucet wrench all in one! Wrenches are universal in thatthey fit all types of industrial drum plugs and bungs in metal or plastic. The angled handles onmodel BNW-I-W and BNW-B-W protect knuckles in most positions. These durable wrencheswill not bend, break or chip. Eliminate the need for extra tools with these multifunctional drumwrenches! Patent pending.MODELNUMBEROVERALLLENGTHNET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONBNW-A NON-SPARKING ALUMINUM (SINGLE ENDED) 10½" 1 $13.00BNW-I-W POLISHED ZINC CAST STEEL 12" 5 $29.00BNW-B-W NON-SPARKING BRONZE ALLOY 12" 6 80.00BNW-IX-W POLISHED ZINC CAST STEEL 12" 2 23.00BNW-BX-W NON-SPARKING BRONZE ALLOY 12" 2 44.00BNW-P NON-SPARKING SOLID NYLON-66 10” 1 $12.10DC-25/UPSPhone (800) 348-0868www.vestil.com
Drum Bung SocketsOpen drum bungs easily! Tighten or remove with a socket wrench (wrench not included).Manufactured from high quality steel alloy for use with impact drive tools. Available in nonsparkingbronze alloy or zinc plated cast steel. Fits ¾" and 2" drum plugs.MODELNUMBERDRIVESIZENET WT.(LBS)LIST PRICEEACHPRICEFOR 2+DESCRIPTIONBUNG-S-B1 NON-SPARKING BRONZE ALLOY 3/8" 1 $42.00 $36.00BUNG-S-B2 NON-SPARKING BRONZE ALLOY ½" 1 42.00 36.00BUNG-S-S1 BRIGHT ZINC PLATED CAST STEEL 3/8” 1 19.00 17.00BUNG-S-S2 BRIGHT ZINC PLATED CAST STEEL ½" 1 19.00 17.00BUNG-S BRIGHT ZINC PLATED CAST STEEL ¾" 1 19.00 17.00DC-25/UPSDrum Impact SocketDesigned for opening and closing 2" and ¾" drum plugs. Use with a ½" ratchet drive.Manufactured from heat treated chrome vanadium steel for strength when using with pneumaticimpact driver. Works with several ¾" and 2" drum plugs, see illustration.MODELNUMBERDRUM SOCKETACCOMMODATESRATCHETDRIVENET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONBUNG-X IMPACT SOCKET 2" & ¾" ½" 2 $95.00DC-25/UPSBrass Drum Vent AdaptorAllows for use of 2" drum vents in ¾" drum plugs. No need to remove drum faucets to use drumvents. Top features 2" female threads. Bottom feature ¾" male threads. Solid brass construction isnon-sparking. Drum Vents are sold separately.MODELNUMBERRATCHETDRIVENET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONDVA-B BRASS DRUM VENT ADAPTOR 3 $65.00DC-25/UPSDrum VentsTwo styles available for use with drums in horizontal or vertical positions. Use with standard 2"drum plug openings. Each vent includes a flash arrestor for safety. FM approved.FITS 3/4” AND 2” DRUMPLUGS AS SHOWN ABOVE.NewNew187MODELNUMBER DESCRIPTION DISPLACEMENTMODELNUMBERDRIVESIZETORQUERATINGOVERALLLENGTHNET WT.(POUNDS)LIST PRICEEACHTW-38 3/8" 10 - 80 ft-lbs. 11" 5 $41.60TW-12 ½" 10 - 150 ft-lbs. 11" 5 41.60DC-25/UPSMODELNUMBERTHREADDIAMETERNET WT.(POUNDS)NET WT.(POUNDS)LIST PRICEEACHVENT-V VERTICAL DRUM VENT FITS 2" OPENINGS 2 $75.00VENT-H HORIZONTAL DRUM VENT FITS 2" OPENINGS 1 55.00DC-25/UPSTorque WrenchesReversible ratchet-head style torque wrench. Easy to set torque setting - wrench ‘clicks’ when settingis reached. Knurled handle grip surface for extra grip during use. Use with bung sockets to complywith UNC standards.Drum LocksPrevent unauthorized access to drum contents. Simply screw drum lock into place, insert zincplated steel rod, and secure with padlock (padlock not included). Steel rod is pre-drilled with a5/16" diameter padlock hole. Works with both ¾" and 2" bungs.LIST PRICEEACHDESCRIPTIONBLD-80 BRASS DRUM LOCK 2" & ¾" 4 $65.00DTL-22 POLYCARBONATE DRUM LOCK 2" & ¾" 1 29.00DC-25/UPSHorizontal Drum Gauge Level IndicatorThe Horizontal Drum Gauge Level Indicator allows personnel to read the level of contents in adrum. Gauge accepts a ¾" faucet (sold separately). 18⅜" site gauge. For use with plastic or steeldrums. Works well with most oils, solvents, and chemicals. Faucet is not included.MODELNUMBER DESCRIPTION DISPLACEMENTNET WT.(POUNDS)LIST PRICEEACHDGLI-4 HORIZONTAL DRUM GAUGE ¾" BUNGS 4 $64.00DC-25/UPSmodel VENT-Vmodel BLD-80model VENT-Hwww.vestil.com Phone (800) 348-0868DRUM, CYLINDER, PAIL EQUIPMENT
188Horizontal Drum TapThis unique product will allow you to open a 2" drum bung, empty the contents of the drum, and closethe drum bung, all with the drum in the horizontal position. Eliminates the need to rotate the druminto the vertical position to gain access. Operation is simple: attach Drum Tap to bung with lockingring, push handle towards drum and twist to unscrew bung, pull handle out away from drum to emptydrum contents. Reverse operation to close drum and remove Drum Tap from bung. This product savestime, energy, and reduces the risk of spills. May be used to fill drums in the horizontal position with thebung positioned at the top of the drum. Constructed of fiberglass reinforced polypropylene. O-rings aremade of nitrile rubber.THE TAP-3 WILL ONLYWORK WITH THIS TYPEOF DRUM PLUG.MODELNUMBER DESCRIPTION ACCOMMODATESNET WT.(POUNDS)LIST PRICEEACHTAP-3 HORIZONTAL DRUM TAP 2" DRUM OPENINGS 4 $97.00DC-25/UPSSteel Drum Funnel (with self-closing lid)Allows for quick filling of 55-gallon drums with 2" plug. Includes 8¾" long brass flame arrestor forsafety. Hinged lid with fusible link automatically closes at 160°. Lid latch may be locked for security(lock not included). Fits 2" NPS threaded drum bung. Gasket included for tight seal. Steel funnelconstruction with painted finish.MODELNUMBERDRUMSIZEFITS DRUMBUNGSNET WT.(POUNDS)LIST PRICEEACHCONSTRUCTIONDF-S STEEL 55-GALLON 2" 13 $156.00DC-25/UPSDrum Pump FunnelEliminate spills, drips, and the need for absorbent pads on top of drums with this easy to use DrumFunnel. A ¾" drain fits into one opening of your 55-gallon drum, while the drum pump (soldseparately) is installed into the opposite adjustable opening in the funnel.vestilgreenMODELNUMBERVOLUMECAPACITYNET WT.(POUNDS)LIST PRICEEACHCONSTRUCTIONDIAMETERDP-FUN POLYETHYLENE 5-GALLON 24" 6 $78.00DP-FUN-GRN POLYETHYLENE 5-GALLON 24" 6 $78.00DC-25/UPSDRUM, CYLINDER, PAIL EQUIPMENTManual Drum FaucetsQuickly and easily dispense drum contents with our Drum Faucets. Available in plastic, stainless steel, aluminum, and brass.Polyethylene Drum Faucet, model VDFT, is constructed of corrosion-resistant polyethylene. Handles viscous materials. Instant on/off controlensures fast, smooth flow. Padlock not included. Integral hook allows uses to hang pail on faucet (51 lbs.).The Jumbo Drum Faucets, model JDFT, are ideal for dispensing viscous, non-corrosive flammables such as adhesives, paint, heavy oils, grease,and varnish. Padlock not included. Integral hook allows uses to hang pail on faucet (51 lbs.).model VDFTNon-Adjustable Nozzlemodel DFT-RIGIDNon-Adjustable NozzlePhone (800) 348-0868model DFT-ADJAdjustable Nozzlemodel JDFTNon-Adjustable NozzleMODELNUMBERmodel JDFT-BNon-Adjustable Nozzlemodel DFT-SSAdjustable NozzleACCOMMODATESBUNG SIZEmodel DFT-AS-SCNon-Adjustable NozzleNET WT.(LBS.)LIST PRICEEACHDESCRIPTIONVDFT POLYETHYLENE (MANUAL HANDLE) ¾" 1 $2.40JDFT POLYETHYLENE (MANUAL HANDLE) 2" 1 $13.80JDFT-B BRASS (MANUAL HANDLE) 2" 8 118.00DFT-SS STAINLESS STEEL (SPRING-LOADED HANDLE) ¾" 2 $139.00DFT-AL BRASS-PLATED ALUMINUM (LOCKABLE HANDLE) ¾" 1 $9.00DFT-AS-SC BRASS-PLATED ZINC (LOCKABLE HANDLE) ¾" 1 27.00DFT-RIGID BRASS (LOCKABLE HANDLE) ¾" 2 42.00DFT-ADJ BRASS (SPRING-LOADED HANDLE) ¾" 2 51.00DC-25/UPSwww.vestil.com
Manual Drum & Pail PumpsDesigned for dispensing and transferring liquids out of 55-gallon drums and 5-gallon pails. Choose rotary, lever, piston, orelectric action dispensing. Constructed of either steel, aluminum,polypropylene, or stainless for application specific chemicalresistance.RDP-55 - Ideal for light oils, anti-freeze, and other light nonflammableand non-combustible liquids.ADP-55 - High-speed drum pump for light oils up to 40 weight.VDP & VDPX - Exceptional resistance to corrosive chemicals(non-flammable solvents). VDP includes a 2 piece dip tube withconnector 32" long totalVLDP - Handles viscous liquids up to 12,000 cPs (equivalentto SAE 90 oil). Not for use above 125°F or with heated drums.Includes 35" long dip tube.LDP-ST - For petroleum products up to 200 cPs.PAIL-PST-SS - Handles most liquids**NOT RECOMMENDED FOR: Ammonium Chloride, Aqua Regia, Bromine Water,Calcium Chloride, Chloracetie Acid, Chlorine Water, Ferric Chloride, Ferrous Chloride,Freon 12, Hydrobrmic Acid, Hydrofluoric Acid, Sodium Hydroxide, Stannic Chloride,and Sulfuric Acid.189RDP-55 ADP-55 PDP-55 & RP-90RVDPVLDPLDP-ST LDP-POLY LDP-RYT LDP-SS-316MODELNUMBER DESCRIPTION CONSTRUCTIONDISPLACEMENTPER STROKEBUNGSIZENET WT.(POUNDS)LIST PRICEEACHRDP-55 ROTARY DRUM PUMP STEEL 11.8 oz. 2" 12 $39.40ADP-55 ROTARY DRUM PUMP ALUMINUM 11.8 oz. 2" 12 131.00PDP-55 ROTARY DRUM PUMP POLYPROPYLENE 11.8 oz. 2" 8 102.00RP-90R** ROTARY DRUM PUMP RYTON 11.8 oz. 2" 7 103.00VDP SELF-VENTING POLYPROPYLENE 8 oz. ¾" & 2" 1 $19.00VDPX SELF-VENTING POLYPROPYLENE 16 oz. ¾" & 2" 1 19.00VLDP LEVER ACTION POLYPROPYLENE 10 oz. 2" 1 $68.00LDP-ST LEVER ACTION STEEL 12 oz. 2" 9 28.00LDP-POLY LEVER ACTION POLYPROPYLENE 12 oz. 2" 4 30.00LDP-RYT LEVER ACTION RYTON, 316 SS ROD 12 oz. 2" 4 45.00LDP-POLY-304 LEVER ACTION POLYPROPYLENE 304 SS 12 oz. 2" 4 33.00LDP-SS-316 HAND PUMP 316 STAINLESS STEEL 16 oz. 2" 12 $113.00PAIL-PST PISTON PAIL PUMP STEEL 8 oz. 1" 3 $24.00PAIL-PST-SS PISTON PAIL PUMP STAINLESS STEEL 8 oz. 1" 3 101.00**USE WITH ACETONE, MEK, LACQUER THINNERSDC-20/UPSElectric Drum Pumps115V 1-PHASE STANDARDReduce time required to dispense or transfer liquids. Electric drum pumps allow you to move fluid easily and efficiently.Pumps come complete with tube for 2" bung, hose, and 115V motor.MODELNUMBERDESCRIPTIONMAXIMUMVISCOSITYNET WT.(POUNDS)LIST PRICEEACHEDP ELECTRIC DRUM PUMP - 115 VOLT 400 CPS 18 $449.00FHL-PUMP FLAMMABLES, HAZARDOUS LOCATIONS500 CPS 20 3,290.00(CLASS I GROUP C&D, CLASS II GROUPS F&G (EXPLOSION PROOF)ODF-PUMP THIN-BODIED OILS AND DIESEL 500 CPS 30 1,125.00ABS-PUMP ACIDS AND BASE SOLUTIONS 600 CPS 37 935.00HCB-PUMP CORROSIVE ACIDS AND BASE SOLUTIONS 500 CPS 22 2,261.00DC-20/UPSmodel PAIL-PST-SSmodel EDP model FHL-PUMP model ODF-PUMP model ABS-PUMPmodel HCB-PUMPwww.vestil.com Phone (800) 348-0868NewDRUM, CYLINDER, PAIL EQUIPMENT
190model CB-W-3SWall Mounted Cylinder BracketsSimple design is easy to install. Simply bolt to wall and then secure cylinder with strap. Edges areprotected with rubber guards on the steel units. Choose either steel or molded plastic construction.Maximum 12" cylinder diameter. Installation hardware is not included.MODELNUMBERACCOMMODATESCYLINDERSNET WT.(POUNDS)LIST PRICEEACHMATERIALCB-W-S STEEL 1 3 $19.30CB-W-2S STEEL 2 7 39.90CB-W-3S STEEL 3 12 59.00CB-W-P PLASTIC 1 2 $15.10CB-W-2P PLASTIC 2 3 26.00DC-30/UPSmodel CB-W-Smodel CB-W-2Smodel CB-W-Pmodel CB-W-2PCYL-D-1-PNNewCYL-DLX-1-PNNewCylinder DolliesTransport cylinders up to 11½" in diameter from workstation to workstation. Nose plate measures12"W x 15½"D. The deluxe version feature roller guides attached to the nose plate. The hardrubber roller guides measure 4" x 1¼". These wheels allow for easier entry onto the nose plate.Secure the cylinder with the included restraint chains. Tilt unit back and transport.MODELNUMBEROVERALL SIZE(W x L x H)WHEELTYPEWHEELSIZENET WT.(POUNDS)LIST PRICEEACHDELUXECYL-DLX-1-HR 19" x 26 15 /16" x 51 5 /16" HARD RUBBER 10" x 2½" 68 $119.00CYL-DLX-1-PN 19" x 26 15 /16" x 51 5 /16" PNEUMATIC 10" x 3½" 60 139.00ECONOMYCYL-D-1-HR 16½" x 25 1 /16" x 54 1 /16" HARD RUBBER 10" x 2½" 89 $105.00CYL-D-1-PN 16½" x 25 1 /16" x 54 1 /16" PNEUMATIC 10" x 3½" 47 125.00DC-25/FC-100Magnetic Cylinder Hand TruckDesigned and built to transport gas cylinders with ease, this hand truck uses strong magnets tohold the tanks in place. Units rolls easily on (2) 10" x 2" rubber tires and (2) 4" x 1½" swivelcasters. The tilt back design allows for effortless transportation.DRUM, CYLINDER, PAIL EQUIPMENTNewMODELNUMBERMODELNUMBEROVERALL SIZE(W x L x H)OVERALL SIZE(W x L x H)NOSE PLATE(W x D)UNIFORMCAPACITYUNIFORMCAPACITYNET WT.(LBS.)NET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONMCHT-350 MAGNETIC HAND TRUCK 18" x 39" x 46½" 350 104 $569.00DC-25/FC-100Cylinder Tilt Back Hand TruckIdeal for transporting cylinders from storage to work space. Tilt back design for effortlesstransportation. Chains and contoured back cradle provide utmost safety. The two mountedchains measure 28" long. Unit rolls smoothly on (2) 10" x 2" mold-on-rubber wheels and(2) 4" x 1⅜" phenolic casters.LIST PRICEEACHCYHT-350 16" x 36" x 50" 24½" x 5½" 350 75 $122.00DC-25/FC-100Cylinder Lifter/TransporterPerfect for transporting gas cylinders and loading them onto a truck. This unit raises cylinders bysimply turning a mechanical hand crank to the desired height. Cylinder is held in place with atough polyester webbing strap that guards against damage and slipping.MODELNUMBEROVERALL SIZE(W x L x H)HEIGHT TO BOTTOMOF CYLINDERUNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHCYL-HLT 37" x 44" x 126" 40" 300 266 $897.00DC-25/FC-100Phone (800) 348-0868www.vestil.com
Portable Cylinder LifterThis product allows you to easily move and lift cylinders for placement into portable welders. Liftcylinders up to 14" high. For use with maximum cylinder height of 56". Cylinder is securedto cart with manual ratchet strap. Cylinder is raised and lowered with manual hand crank cablewinch. Portable with two wheels. Steel construction with painted yellow finish.MODELNUMBEROVERALL SIZE(W x L x H)WHEELTYPEWHEELSIZENET WT.(POUNDS)LIST PRICEEACHCYL-LT-1-HR 17 5 /8" x 23 3 /8" x 79 3 /16" HARD RUBBER 10" x 2½" 91 $206.00CYL-LT-1-PN 17 5 /8" x 23 3 /8" x 79 3 /16" PNEUMATIC 10" x 3½" 78 226.00DC-25/FC-100Portable Cylinder ClutcherDesigned for lifting and moving gas cylinders with automatic operation. Simply raise and lowerhandle to operate. Unit raises cylinders 2" off the ground. Works with cylinder diameters between8½" to 12½". Includes two rigid and one swivel caster. Welded steel construction with paintedyellow finish.NewTELESCOPICDESIGN191MODELNUMBEROVERALL SIZE(W x L x H)UNIFORMCAPACITYACCOMMODATESCYLINDERSNET WT.(POUNDS)LIST PRICEEACHOCC-2 30" x 23" x 53" 200 8½" to 12½" 89 $597.00DC-25/FC-100Cylinder CaddiesTransport cylinders safely with these fork mounted or pallet jack style cylinder caddies. Theseunits can hold anywhere from 2 to 6 cylinders and they come complete with safety chains tosecure the cylinders in place. Made of all steel construction, these units hold cylinders up to9½" in diameter. The optional caster kit allows for portability without the need of a fork truckor pallet truck. Features all swivel casters.MODELNUMBERNUMBER OFCYLINDERSNET WT.(POUNDS)LIST PRICEEACHUSE WITHCYL-P-4 FORK TRUCK 4 158 $316.00CYL-P-6 FORK TRUCK 6 190 390.00CYL-P-8 FORK TRUCK 8 252 427.00PJ-CYL-2 PALLET TRUCK 2 50 $283.00PJ-CYL-4 PALLET TRUCK 4 108 389.00CYL-CK CASTER KIT (FOR CYL) -- 48 $202.00PJ-CYL-CK CASTER KIT (FOR PJ-CYL) -- 48 210.00CYL-LUGMODELNUMBEROVERHEAD LIFTING ASSEMBLYFACTORY INSTALLED ONLY. FITS ONLY CYL-P SERIESWelding Cylinder Torch CartsDesigned for transporting cylinders and cutting torch. Includes two tankcompartments with heavy-duty ratchet straps. Brackets are included for holdingcutting torch and hose. Sturdy handles and large 16" diameter wheels for tilt-ngoportability. Heavy-duty uniform capacity rating is 500 lbs. Convenient opentopstorage tray included on all models. CYL-2 models include lockable storagebox for regulators. Box includes hose opening so regulator does not need to bedisconnected for storage. Lifting eye is 2" maximum diameter, material thicknessis 7/16". Fork pockets for transportation is included on CYL-2 models. Usablesize of each fork pocket is 7½"W x 2½"H. Units with fire protection include ½"(approx. 13mm) Marinite 1 material which provides a 30 minute fire protectionbarrier as prescribed by OSHA standards 1910.253 and 1926.350. Welded steelconstruction with painted finish. Not designed for use as a storage means for gascylinders.WHEELTYPECUTTING OVERHEADTORCH BOX LIFT EYEFORKPOCKETSOVERALL SIZE(W x L x H)40 $149.00DC-25/FC-125/250FIREPROTECTIONmodel CYL-P-6Shown with CasterKit model CYL-CKmodel PJ-CYL-4Shown with Caster Kitmodel PJ-CYL-CKNET WT.(LBS.)LIST PRICEEACHCYL-E PNEUMATIC NO NO NO 33¼" x 23 1 /16" x 57 11 /16" NO 88 $365.00CYL-E-FF FOAM-FILLED NO NO NO 35½" x 23 1 /16" x 57 11 /16" NO 88 393.00CYL-EH PNEUMATIC NO YES NO 33¼" x 23 1 /16" x 66½" NO 120 $685.00CYL-EH-FF FOAM-FILLED NO YES NO 35½" x 23 1 /16" x 66½" NO 120 713.00CYL-EH-FP PNEUMATIC NO YES NO 33¼" x 23 1 /16" x 66½" YES 149 $1,146.00CYL-EH-FP-FF FOAM-FILLED NO YES NO 35½" x 23 1 /16" x 66½" YES 149 1,174.00CYL-2 PNEUMATIC YES YES YES 40" x 29" x 65" NO 200 $641.00CYL-2-FF FOAM-FILLED YES YES YES 40” x 29” x 65” NO 200 669.00CYL-2-FP PNEUMATIC YES YES YES 40” x 29” x 65” YES 230 $1,098.00CYL-2-FP-FF FOAM-FILLED YES YES YES 40” x 29” x 65” YES 230 1,126.00DC-20/FC-70Newmodel CYL-Emodel CYL-EH-FPOVERHEADLIFTING ASSEMBLYmodel CYL-LUGmodel CYL-2Raise with hoist,lift with fork truckor manually pusharound.www.vestil.com Phone (800) 348-0868DRUM, CYLINDER, PAIL EQUIPMENT
192model CYL-V-510Newmodel CYL-H-8Cylinder Storage Cabinets (only for sale in the USA)Steel cabinets for storage of cylinders. Cylinder storage capacity is based on cylinder size.Sides are made of expanded steel mesh. Top is made of solid sheet steel. Lockable doorsprotect cylinders (padlock not included). Base includes lag holes for securing cylinders.Vertical units include chains for securing cylinders. Includes red lettered signage noting“Flammable” contents. Meets NFPA 58 and OSHA sec. 1910.110 design standards. Ruggedsteel construction with safety yellow finish. Powder coat finish on unassembled units.MODELNUMBERUNIFORM CYL.CAPACITYOVERALL SIZE(W x L x H) TYPENET WT.(LBS.)LIST PRICEEACHHORIZONTAL STORAGE CABINETSCYL-H-4-KD 4 33" x 38" x 37" UNASSEMBLED 185 $495.00CYL-H-8-KD 8 33" x 38" x 70" UNASSEMBLED 305 759.00CYL-H-12-KD 12 49" x 38" x 70" UNASSEMBLED 390 959.00CYL-H-16-KD 16 65" x 38" x 70" UNASSEMBLED 495 1,318.00CYL-H-4 4 33" x 38" x 37" ASSEMBLED 185 $510.00CYL-H-8 8 33" x 38" x 70" ASSEMBLED 305 749.00CYL-H-12 12 49" x 38" x 70" ASSEMBLED 390 897.00CYL-H-16 16 65 x 38" x 70" ASSEMBLED 495 1,273.00VERTICAL STORAGE CABINETSCYL-V-1020-KD 10-20 60" x 38" x 72" UNASSEMBLED 305 $1,100.00CYL-V-510 5-10 33" x 37" x 72" ASSEMBLED 205 688.00CYL-V-1020 10-20 60" x 38" x 72" ASSEMBLED 315 1,080.00DC-25/FC-70DRUM, CYLINDER, PAIL EQUIPMENTCYL-LP-4-CAPhone (800) 348-0868model CYL-T-COMBONewCylinder Storage Cabinets (only for sale in CANADA)Durable steel cabinets for storage of cylinders. Cylinder storage capacity is based on cylindersize. Sides are made of expanded steel mesh. Top and bottom is made of solid sheet steel.Lockable doors protect cylinders (padlock not included). Base includes lag holes for securingunit to floor (hardware is not included). Vertical units include chains for securing cylinders.Includes red lettered signage noting “No Smoking” message in English and French. MeetsCSA B-149.2, NFPA 58 and OSHA sec. 1910.110 design standards. Rugged welded steelconstruction with safety yellow finish. All units shipped fully assembled.MODELNUMBERMODELNUMBERUNIFORM CYL.CAPACITYUNIFORM STORAGECAPACITYOVERALL SIZE(W x L x H)OVERALL SIZE(W x L x H)NUMBEROF SHELVESNET WT.(LBS.)NET WT.(POUNDS)LIST PRICEEACHLP CYLINDER STYLECYL-LP-4-CA 4 43" x 30" x 37" 1 191 $597.00CYL-LP-8-CA 8 43" x 30" x 72" 1 333 851.00CYL-LP-16-CA 16 68" x 30" x 72" 0 533 1,224.00OTHER GAS CYLINDER STYLECYL-G-8-CA 8 43" x 30" x 72" 0 261 $826.00CYL-G-12-CA 12 68" x 30" x 72" 0 409 1,306.00DC-25/FC-70Galvanized Cylinder Storage CabinetsStore LP tanks horizontally and acetylene tanks vertically in these heavy-duty Cylinder StorageCabinets. Made of all steel construction, these rust resistant units have 4 gauge galvanizedwelded wire sides with sturdy 1½" square steel angle frames. Durable 12 gauge galvanized steelroof. The galvanized rust resistant finish stands up to harsh outdoor environments. Features apadlock hasp for security (padlock not included), “Danger Flammable <strong>Material</strong>s” sign, and allnecessary hardware. Meets OSHA 1910.110 requirements. Assembly required.LIST PRICEEACHHORIZONTAL STORAGE CABINETSCYL-T-4 4 HORIZONTAL 29" x 29" x 40" 72 $480.00CYL-T-8 8 HORIZONTAL 29" x 29" x 66" 175 737.00CYL-T-16 16 HORIZONTAL 58" x 29" x 66" 240 1,479.00VERTICAL STORAGE CABINETSCYL-T-10 9 VERTICAL 29" x 29" x 66" 100 $548.00CYL-T-20 18 VERTICAL 58" x 28" x 66" 180 1,064.00COMBINATION STORAGE CABINETSCYL-T-COMBO 8 HORIZONTAL& 9 VERTICAL58" x 29" x 66" 210 $1,254.00DC-25/FC-70www.vestil.com
LP Tank TruckFinally an easy answer to lifting, storing, and transporting problems associated with LP tanks.This all-in-one cart allows users to transport LP tanks where needed. The built-in cranecan be used to safely load full tanks into fork trucks. The crane pivots 360° for maximumversatility. The crane boom is raised and lowered with a manual hand pump hydrauliclift. The tank attachment at the end of the boom automatically clamps to each end of thecylinder. The built-in racks are ideal for LP tank storage-racks store two tanks in the verticalposition and four tanks in the horizontal position. Unit includes a push handle with tworigid and two swivel casters for portability. Welded steel construction with a painted finish.DVD or VIDEOAVAILABLE193MODELNUMBERMODELNUMBERUNIFORM STORAGECAPACITYOVERALL SIZE(W x L x H)OVERALL SIZE(W x L x H) CASTERSACCOMMODATESCYLINDERSNET WT.(LBS)NET WT.(POUNDS)LIST PRICEEACHLP-6 6 TANKS 33" x 80" x 73" 8" x 2" PHENOLIC 750 $2,390.00DC-25/FC-100Fork Truck LP Tank CaddyHolds up to (6) LP tanks up to 12" in diameter each. Made of all steel construction. Safetychains to hold the tanks in place are standard. Portable with fork truck.LIST PRICEEACHLP-170 38" x 41" x 29" 12" DIAMETER x 24" HIGH 278 $367.00CYL-CK CASTER KIT 48 $202.00DC-25/FC-125/250Air Powered Oil Filter CrusherReduce storage space and disposal costs! Removes up to 95% of used oil while crushing filtersdown to 20% of the original size. Accommodates standard oil filters and 1-gallon cans. Powered100% from air operation. Safety door interlock system standard. Solid steel construction.MODELNUMBERMODELNUMBEROVERALL SIZE(W x L x H)AIRREQUIREDNET WT.(POUNDS)LIST PRICEEACHOFC-200 20½" x 16¾" x 77 1 /8" 100-160 PSI 275 $820.00DC-20/FC-70Oil Filter CrushersRecycle used filters and oil quickly, safely, and easily.The CrushMaster 1 oil filter crusher operates on normal shop air, delivers over 13,000 lbs.of crushing force at 120 PSI, accommodates all standard oil filters, and is designed for highvolumeuse. Will crush up to four automotive spin-on filters at one time. Crushing chamberdoor is prevented from opening if the ram is in any position other than fully raised. Can beconnected to a variety of waste oil containers.The CrushMaster 2 accommodates standard size filters and heavy-duty truck filters up to16" high. Convenience and safety features include waste oil drain connections, easily locatedon/off switch for safe operation, and heavy-duty totally enclosed fan cooled 4HP motordelivering 37,500 pounds of crushing force. Electric-hydraulic operation.The Tubular Stand accommodates model CM-1. Requires 29"W x 22½"D of floor space.The Deluxe Stand accommodates both the CM-1 and CM-2. It is designed with a heavy-dutygrated top for drainage of filters before crushing. The floor space required is 30"W x 26"D.Also allows for placement of 55-gallon drum, sold separately, under crusher to contain oil.OVERALL SIZE( W x D x H)CYCLE TIME(SECONDS)NET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONCM-1 AIR OPERATED, 100-180 PSI 13¾" X 18" X 27" 11-20 255 $2,221.00CM-2 ELECTRIC-HYDRAULIC, 208-230V, 1PH 25" X 27" X 41½" 12 400 6,383.00CM-T TUBULAR STAND 41" HIGH -- 183 $245.00CM-D DELUXE STAND 44" HIGH -- 405 653.00DC-20/FC-85Aerosol Can Recycle System208-230V 1-PHASE STANDARDvestilgreenTurn aerosol cans into scrap metal, exempting them from disposal regulations for hazardous waste.This system safely punctures aerosol cans to relieve pressure, and then empties any residual contentsinto your drum. Thread the recycler body into the 2" diameter threaded bung of your 30 or 55gallon drum. Push the lever to puncture the can, and two piece filter with a carbon cartridge drainsout odors and harmful emissions. Unit includes puncturing device, safety goggles, carbon filter, andanti-static wire, which prevents static buildup by grounding the drum as required by OSHA.MODELOVERALL SIZE MAXIMUM MAXIMUM NET WT. LIST PRICENUMBER(D x H)CAN HEIGHT CAN DIAMETER (LBS.) EACHCAN-RECY 5 13 /16" x 14 3 /8" 14-5/8” 3” 5 $650.00DC-25/UPSNewmodel CM-1Shown with OptionalTubular Stand, model CM-Tmodel CM-2Shown with OptionalDeluxe Stand, model CM-Dwww.vestil.com Phone (800) 348-0868NewDRUM, CYLINDER, PAIL EQUIPMENT
194NewSteel Pail Lid Closing ToolQuickly and easily secure steel pail lids onto steel pails with the Steel Pail Lid Closing Tool.Manually crimps and closes 16 lugs in a single motion. Long handles provide leverage reducingthe effort necessary to secure lids to pails. Intended for use with non-UN Vestil Steel Lids andSteel Pails on pages 195 and 196.MODELNUMBERACCOMMODATESPAIL TYPESNOMINALDIAMETERGAUGERANGENET WT.(POUNDS)LIST PRICEEACHPLC-5 5-GALLON STEEL 11¼" 26 to 29 33 $499.00DC-25/UPSSteel Pail Pal (PAIL OPENER)A must-have product for anyone using five gallon plastic and steel pails. The cutter is used to cuta slit in the lid lip of the pail to enable the lid of the plastic pail to be removed. The side guideconveniently slides under the lid lip for easy removal of the lid. The end hook is used to open steelpails. Just hook the lid lip and rotate. The opposite end is used to close and seal the lid by bendingthe lip back around the steel pail top.NewMODELNUMBERACCOMMODATESPAIL TYPESOVERALL SIZE(W x L x T)NET WT.(POUNDS)LIST PRICEEACHPAIL-PAL 5-GALLON PLASTIC & STEEL 3" X 7" X ½" 2 $23.00DC-25/UPSMulti-Pail DollyMove your 5 gallon containers with ease. Ideal for job sites, tile and grout work, janitorial andcleaning tasks and other industrial uses. Designed to work with round and square 5 gallon pails;plastic or steel. Rolls smoothly with all swivel 3" polyurethane casters. Ground clearance is 1⅜".All steel construction with powder coat blue finish. Includes a 4 foot long pull strap.DRUM, CYLINDER, PAIL EQUIPMENTPhone (800) 348-0868NewmodelGAL-5-DOL-GRNvestilgreenMODELNUMBERMODELNUMBERACCOMMODATESPAIL TYPESOVERALL SIZE(W x H)DISPENSINGHEIGHTUNIFORMCAPACITY (LBS)UNIFORMCAPACITY (LBS)NET WT.(POUNDS)NET WT.(POUNDS)LIST PRICEEACHMPD-5 5-GALLON 25½" X 4¾" 150 15 $85.00DC-25/UPSPolyethylene Pail DollyAn easy way to move your 5 gallon round or square pails, outdoors or indoors. Features (4) 3"swivel phenolic casters. Rust resistant polyethylene and heavy duty design. Specify color whenordering; blue, black, yellow or white.MODELNUMBERACCOMMODATESPAIL TYPESOVERALL SIZE(W x L x H)UNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHGAL-5-DOL 5-GALLON 11½" X 11½" X 6" 100 11 $48.00GAL-5-DOL-GRN 5-GALLON 11½" X 11½" X 6" 100 11 $48.00Manual Pail TippersDC-25/UPSThe back saving Manual Pail Tipper is designed for dispensing 5-gallon plastic or steel pails.Variable height chime lock for quick loading and unloading. Sturdy steel or stainless steelconstruction available. The overall size is 12½"W x 14¼"D x 30"H. Ships knockdown. Someassembly required. Pail is rotated manually.LIST PRICEEACHCONSTRUCTIONCAN-A STEEL 10" 70 8 $44.00CAN-S STAINLESS STEEL 10" 70 12 103.00DC-25/UPSPail Hand TruckThis Pail Hand Truck allows one person to easily and efficiently move 5-gallon pails or othermiscellaneous items. The nose plate can be flipped down and pail retention fingers flipped up inorder for this cart to be used as a basic hand truck. Flip the pail retaining fingers down to utilizethe pail lifting feature. An arched back allows the pail to fit safely on the hand truck. Units rollsmoothly on large 10" x 2½" diameter wheels.MODELNUMBERNOSE PLATE(W x L)OVERALL SIZE(W x D x H)UNIFORMCAPACITY (LBS)NET WT.(POUNDS)LIST PRICEEACHPAIL-T 10¾" X 7 5 /8" 20" X 17" X 55 3 /8" 500 49 $139.00DC-25/UPSwww.vestil.com
Hydraulic Pail Crusher115V 1-PHASE STANDARDCrush 5-gallon steel pails quickly and easily. Crushes steel pails to approximately 2" high and resetsautomatically to crush another pail. Reduce storage space and disposal costs.Safety features include: pressure relief valve to prevent overload, door interlock system to preventthe motor fro m running if the door is unlatched, mushroom head emergency stop button. Otherfeatures include a hydraulic pump that provides 70 second cycle time, 10,000 pounds of crushingpower, removable legs for bench top mounting and 115 volt single phase for “plug in operation”.Meets OSHA and JIC standards. (Oil Filter Crusher can be found on page 193)195MODELNUMBEROVERALL SIZE( W x D x H)NET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONHPC-400 STEEL PAIL CRUSHER 28" X 28" X 65" 300 $2,535.00DC-20/FC-85Variable Height Pail DispensersVariable Height Pail Dumper provides 24 angle settings for dispensing 5 gallon plastic or steel pails.Dispense at any height between 1" and 52" by turning the hand cable winch. Steel constructionwith powder coat finish.Model LLW-PAILD-200, 6" x 2" mold-on-rubber wheels with tilt back “hand truck” design can govirtually anywhere. Includes 2" diameter front steel wheels and top wheels for easily loading unitinto a van or truck.MODELNUMBERPOUR HEIGHTLOWERED / RAISEDCRADLE HEIGHTLOWERED / RAISEDUNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHLLW-PAILD-100 1" TO 52" 6" TO 58" 125 150 $738.00LLW-PAILD-200 1" TO 52" 6" TO 58" 200 134 $585.00DC-25/FC-100model LLW-PAILD-100shown with Multi-Pail DollyLidsNewLids for use with plastic and steel pails. All plastic lids are constructed of 100% prime virgin highdensity polyethylene (HDPE) and comply with FDA regulations. Suitable for shipping according toD.O.T. standards. Steel crimp-style lids with and without spout available for steel pails.NewDVD or VIDEOAVAILABLEmodelLLW-PAILD-200MODELNUMBERACCOMMODATINGPAIL SIZE (GAL.) STYLE COLORNET WT.(LBS.)LIST PRICEEACHPLASTIC LIDSA LID-54-PW 3.5, 5 & 6 STANDARD WHITE 1 $3.13A LID-54-PB 3.5, 5 & 6 STANDARD BLUE 1 3.13A LID-54-PR 3.5, 5 & 6 STANDARD RED 1 3.13A LID-54-PG 3.5, 5 & 6 STANDARD GREEN 1 3.13A LID-54-PY 3.5, 5 & 6 STANDARD YELLOW 1 3.13A LID-54-UBK 3.5, 5 & 6 STANDARD BLACK 1 3.52B LID-1-PWT 1 TEAR TAB WHITE 1 $1.46B LID-2-PWT 2 TEAR TAB WHITE 1 $2.48B LID-54-PWT 3.5, 5 & 6 TEAR TAB WHITE 1 $2.82B LID-54-PBT 3.5, 5 & 6 TEAR TAB BLUE 1 3.24B LID-54-PRT 3.5, 5 & 6 TEAR TAB RED 1 3.24B LID-54-PGT 3.5, 5 & 6 TEAR TAB GREEN 1 3.24B LID-54-PYT 3.5, 5 & 6 TEAR TAB YELLOW 1 3.24B LID-54-UBKT 3.5, 5 & 6 TEAR TAB BLACK 1 3.65C LID-2-PWST 2 SPOUT TOP W/TEAR TAB WHITE 1 $2.80C LID-54-PWST 3.5, 5 & 6 SPOUT TOP W/TEAR TAB WHITE 1 $3.83C LID-54-PBST 3.5, 5 & 6 SPOUT TOP W/TEAR TAB BLUE 1 3.83C LID-54-PRST 3.5, 5 & 6 SPOUT TOP W/TEAR TAB RED 1 3.83C LID-54-PGST 3.5, 5 & 6 SPOUT TOP W/TEAR TAB GREEN 1 3.83C LID-54-PYST 3.5, 5 & 6 SPOUT TOP W/TEAR TAB YELLOW 1 3.83C LID-54-UBKST 3.5, 5 & 6 SPOUT TOP W/TEAR TAB BLACK 1 4.21A LID-UN-54-PW* 3.5, 5 & 6 UN RATED WHITE 1 $4.37C LID-UN-54-PWS* 3.5, 5 & 6 UN RATED W/SPOUT WHITE 1 5.11A LID-UN-54-UBK* 3.5, 5 & 6 UN RATED BLACK 1 4.77D LID-UN-54-UBKS* 3.5, 5 & 6 UN RATED W/SPOUT BLACK 1 5.83STEEL LIDSE LID-STL 5 STANDARD BLACK 1 $4.91F LID-STL-S 5 SPOUT TOP BLACK 1 6.86E LID-STL-UN* 5 UN RATED BLACK 2 5.78F LID-STL-S-UN* 5 UN RATED W/SPOUT BLACK 2 7.61G LID-STL-LL 5 LEVER LOCK BLACK 2 13.62G LID-STL-LL-UN* 5 UN RATED W/LEVER LOCK BLACK 2 16.82*UN RATEDDC-25/UPS/FC-70www.vestil.com Phone (800) 348-0868ABCDEGFDRUM, CYLINDER, PAIL EQUIPMENT
DRUM, CYLINDER, PAIL EQUIPMENT196A B CDEFGH I JNewNewKLMNOPQPhone (800) 348-0868NewPailsStrong enough for use in shipping applications and durable enough for the most demanding storageapplications. Our heavy duty pails come in variety of sizes ranging from 1 to 6.5 gallons. Whetheryou want color for aesthetics or utility, we offer a spectrum of colors. All plastic pails are constructedof 100% prime virgin high density polyethylene (HDPE) and comply with FDA regulations. Can beused with liquids up to 190°F as well as in freezer applications. Steel pails with rust inhibitor liningare also available.Regulations when used with UN RATED COVERS:PAIL-C-5-W: UN 1H1/Y1.8/100PAIL-SCR: UN 1H2/Y30PAIL-35, PAIL-54, PAIL-6: UN 1H1/Y1.8/50 PAIL-STL-RI-UN: UN 1A2/Y1.5/70MODELNUMBERUNIFORMCAPACITY (GAL) STYLE HANDLE COLORNET WT.(LBS.)LIST PRICEEACHPLASTIC PAILSA PAIL-1-PWP 1 OPEN HEAD PLASTIC WHITE 1 $3.61B PAIL-2-PWP 2 OPEN HEAD PLASTIC WHITE 1 $5.50C PAIL-2-PWS 2 OPEN HEAD STEEL WHITE 1 5.50D PAIL-35-PWP 3.5 OPEN HEAD PLASTIC WHITE 2 $8.31E PAIL-35-PWS 3.5 OPEN HEAD STEEL WHITE 2 8.31F PAIL-54-PWP 5 OPEN HEAD PLASTIC WHITE 3 $10.36F PAIL-54-PBP 5 OPEN HEAD PLASTIC BLUE 3 10.36F PAIL-54-PRP 5 OPEN HEAD PLASTIC RED 3 10.36F PAIL-54-PGP 5 OPEN HEAD PLASTIC GREEN 3 10.36F PAIL-54-PYP 5 OPEN HEAD PLASTIC YELLOW 3 10.36F PAIL-54-UBKP 5 OPEN HEAD PLASTIC BLACK 3 10.18G PAIL-54-PWS 5 OPEN HEAD STEEL WHITE 3 $9.41G PAIL-54-PBS 5 OPEN HEAD STEEL BLUE 3 10.36G PAIL-54-PRS 5 OPEN HEAD STEEL RED 3 10.36G PAIL-54-PGS 5 OPEN HEAD STEEL GREEN 3 10.36G PAIL-54-PYS 5 OPEN HEAD STEEL YELLOW 3 10.36G PAIL-54-UBKS 5 OPEN HEAD STEEL BLACK 3 10.18H PAIL-C-5-W 5 CLOSED HEAD PLASTIC WHITE 3 $20.09I PAIL-6-PWP 6 OPEN HEAD PLASTIC WHITE 3 $12.65J PAIL-6-PWS 6 OPEN HEAD STEEL WHITE 3 12.65PLASTIC PAILS WITH LIDSK PAIL-SCR-35-W 3.5 SCREW TOP PLASTIC WHITE 4 $19.52L PAIL-SCR-5-W 5 SCREW TOP PLASTIC WHITE 4 22.44L PAIL-SCR-65-W 6.5 SCREW TOP PLASTIC WHITE 5 24.56SQUARE PLASTIC PAILS WITH LIDSM PAIL-SQ-35-W 3.5 SNAP LID PLASTIC WHITE 2 $8.36M PAIL-SQ-5-W 5 SNAP LID PLASTIC WHITE 2 10.25STEEL PAILSN PAIL-STL-RI 5 OPEN HEAD STEEL BLACK 3 $14.12N PAIL-STL-RI-UN 5 UN RATED STEEL BLACK 4 17.03DC-25/UPS/FC-70Pail LinerPail liners protect and extend the life of plastic and steel pails by creating a barrier between thecontents and pail wall. For use with chemical, cosmetic, food & beverage and pharmaceuticalapplications. Virgin, FDA approved high density polyethylene (HDPE) construction.MODELNUMBERMODELNUMBERUNIFORM UNIFORMCAPACITY (GAL) CAPACITY (QTS)UNIFORM CAPACITY(GALLONS)QUANTITYPER PACKTOPDIAMETERNET WT.(LBS.)NET WT.(LBS.)LIST PRICEEACHDESCRIPTIONO PAIL-LINE PAIL LINER 5 5 1.8 $2.68DC-25/UPS/FC-70Galvanized and Stainless Steel BucketsGalvanized and stainless steel buckets are for use in industrial and commercial applications where durabilityis required. Buckets are nestable and come standard with a carrying handle/bail for easy transport.BKT-GAL: Galvanized steel construction 0.4mm thickness. Features a spout for more controlled pouring.BKT-SS: Constructed of grade 202 stainless steel. 1mm thickness for 3.25 gallon bucket, 2mmthickness for 5 gallon bucket.LIST PRICEEACHDEPTHGALVANIZED STEELP BKT-GAL-325 3.25 13 9½" 12 5 /8" 2.6 $16.88P BKT-GAL-500 5 20 10¾" 14" 3.2 21.35STAINLESS STEELQ BKT-SS-325 3.25 13 10" 12¾" 2.7 $64.20Q BKT-SS-500 5 20 11" 15 1 /8" 6.7 150.12DC-25/UPS/FC-70www.vestil.com
CarboysGeneral-purpose carboys with rugged design for use in industrial and commercial applications.All carboys are constructed of natural colored FDA compliant high-density polyethylene.Models with “S” suffix come standard with 3/4" polyethylene spigot. NOT designed for usewith gasoline diesel or kerosene.CARB-LP: Low profile “briefcase” design for optimum ease for handling. Fits easily into confined spaceswhile providing easy transport. Includes 3/4" polyethylene spigot.CARB-T: Designed for storage and easy dispensing of water. Tilt top design includes pour spout cap ventand recessed bottom hand grip for easy pouring. Rectangular shape for efficient use of space. Molded ingraduations listed in gallons and liters.CARB-SSH: Rectangular wide-mouth carboys are designed for easier filling and cleaning. Stainless steelhandle is standard for easy, ergonomic transport. Molded in graduations listed in gallons and liters.AB197NewMODELNUMBERUNIFORMCAPACITY (GAL) DESCRIPTION COLORNET WT.(LBS.)LIST PRICEEACHHANDLE- CARB-25 2.5 HANDLE NATURAL 1.5 $15.99A CARB-4-LP 4 LOW PROFILE NATURAL 3.1 102.97B CARB-5 5 HANDLE NATURAL 2.1 27.33TILT TOP WITH HANDLEC CARB-T-125 1.25 STEEL HANDLE NATURAL 1 $79.15D CARB-T-25 2.5 STEEL HANDLE NATURAL 1.9 46.95E CARB-T-25-S 2.5 STEEL HANDLE & SPOUT NATURAL 2 92.76F CARB-T-5 5 STEEL HANDLE NATURAL 2.35 66.45G CARB-T-5-S 5 STEEL HANDLE & SPOUT NATURAL 2.5 120.77STAINLESS STEEL HANDLE- CARB-2-SSH 2 STEEL HANDLE NATURAL 2 $56.25- CARB-2-SSH-S 2 SS HANDLE & SPIGOT NATURAL 2 97.64H CARB-5-SSH 5 STEEL HANDLE NATURAL 4 82.67I CARB-5-SSH-S 5 SS HANDLE & SPIGOT NATURAL 4 126.89ROUND WITH SPIGOTJ CARB-R-1-S 1 ROUND NATURAL 1 $55.68J CARB-R-2-S 2 ROUND NATURAL 2 81.42COLLAPSIBLE CARBOYSK CARB-COL-25 2.5 ROUND NATURAL 2 $8.62K CARB-COL-50 5 ROUND NATURAL 4 10.76DC-25/UPS/FC-70JugsJugs for use in industrial and commercial applications. Ideal for storing ortransporting a variety of liquids.JUG: Lightweight, natural color, FDA compliant high density polyethylene (HDPE) construction. HDPEclosure with EVA liner.JUG-W: Lightweight, white color, FDA compliant high density polyethylene (HDPE) construction. HDPEclosure with EVA liner.JUG-G: Clear and amber glass resist most chemicals and protect against permeation of oxygen, other gassesand moisture vapor. Choose amber for light or UV sensitive contents. Includes chemical resistant thermosetcaps with PTFE foam-backed liner.JUG-S: Tin-plated steel construction with threaded steel closure.MODELNUMBERUNIFORMCAPACITYCAPCOLORNET WT.(OUNCES)LIST PRICEEACHDESCRIPTIONPLASTICL JUG-64 64 OZ. ROUND NATURAL 4.8 $2.62L JUG-1 1 GAL. ROUND NATURAL 2.4 3.19M JUG-W-16 16 OZ. RECTANGULAR NATURAL 1.8 $2.55M JUG-W-32 32 OZ. RECTANGULAR NATURAL 2.6 4.31M JUG-W-64 64 OZ. RECTANGULAR NATURAL 3.4 4.74M JUG-W-1 1 GAL. RECTANGULAR NATURAL 6 5.18GLASSN JUG-G-64 64 OZ. CLEAR GLASS GREEN 28 $11.33N JUG-G-1 1 GAL. CLEAR GLASS GREEN 43 12.34O JUG-G-1A 1 GAL. AMBER GLASS GREEN 43 $14.88TIN-PLATED STEELP JUG-S-16 16 OZ. RECTANGULAR METALLIC 1.8 $2.89P JUG-S-32 32 OZ. RECTANGULAR METALLIC 3.6 3.43P JUG-S-64 64 OZ. RECTANGULAR METALLIC 7.2 5.19P JUG-S-1 1 GAL. RECTANGULAR METALLIC 14.4 5.36DC-25/UPS/FC-70HJC D EFNewL M Nwww.vestil.com Phone (800) 348-0868OPGIKDRUM, CYLINDER, PAIL EQUIPMENT
198NewMetal BottlesGeneral-purpose metal bottles for use in applications where glass and plastic are too fragile.BTL-MA: Aluminum bottles are lightweight and rigid. Includes polypropylene (PP) threaded capwith polyethylene (PE) foam liner.BTL-MT: Tin-plated steel construction is ideal for storing, transporting, or packaging liquids. Includesthreaded screw-on cap with polyethylene (PE) liner.series BTL-MANewMODELNUMBERUNIFORM CAPACITY(OUNCES)CAPCOLORNET WT.(OUNCES)LIST PRICEEACHDESCRIPTIONBTL-MA-2 2 ALUMINUM WHITE 0.8 $4.72BTL-MA-4 4 ALUMINUM WHITE 0.9 5.19BTL-MA-8 8 ALUMINUM WHITE 1 6.36BTL-MT-16 16 TIN METALLIC 2 $3.28BTL-MT-32 32 TIN METALLIC 4 6.71DC-25/UPS/FC-70Tin Bottles with Brush LidsMetal bottles are perfect for use in applications where glass and plastic are too fragile.Tin-plated steel construction is perfect for transportation and storage of paints and lacquers.Includes brush-cap for dispensing contents. Caps are constructed of tin with a polyethylene(PE) liner.MODELNUMBERUNIFORM CAPACITY(OUNCES)CAPCOLORNET WT.(OUNCES)LIST PRICEEACHDESCRIPTIONBTL-MTB-8 8 TIN METALLIC 2.8 $15.62BTL-MTB-16 16 TIN METALLIC 4 17.35BTL-MTB-32 32 TIN METALLIC 5 20.42DC-25/UPS/FC-70NewRound Metal Can with LidRound tin-plated steel cans are perfect for use with paints and lacquers. Each can includes apress-fit lid. 1 gallon can features a steel carrying handle for easy transportation.MODELNUMBERUNIFORM CAPACITY(OUNCES)CAPCOLORNET WT.(OUNCES)LIST PRICEEACHDESCRIPTIONMRC-4 4 TIN METALLIC 1.2 $1.75MRC-8 8 TIN METALLIC 2.0 1.95MRC-16 16 TIN METALLIC 3.2 2.15MRC-32 32 TIN METALLIC 5.2 2.45MRC-64 64 TIN METALLIC 7.4 3.80MRC-128 128 TIN METALLIC 11.8 4.50DC-25/UPS/FC-70DRUM, CYLINDER, PAIL EQUIPMENTABNewJarsWide-mouth jars are easy to fill and clean. Available in clear polystyrene (PS) or clear glass.Acceptable for a wide variety of industrial applications.JAR: Lightweight jars made of FDA compliant clear polystyrene (PS) material with natural threadedpolypropylene caps.JAR-G: Wide-mouth clear class jars used for salves, liquids, powders, food packaging and more. Includesthreaded chemical resistant thermoset caps with PTFE foam-backed liner.MODELNUMBERUNIFORMCAPACITY (OZ)CAPCOLORNET WT.(OUNCES)LIST PRICEEACHDESCRIPTIONPLASTICA JAR-1 1 WIDE-MOUTH JARS NATURAL 0.4 $1.46A JAR-2 2 WIDE-MOUTH JARS NATURAL 0.6 1.71A JAR-4 4 WIDE-MOUTH JARS NATURAL 1.4 1.91A JAR-6 6 WIDE-MOUTH JARS NATURAL 1.6 2.08A JAR-8 8 WIDE-MOUTH JARS NATURAL 2.0 2.17A JAR-16 16 WIDE-MOUTH JARS NATURAL 2.2 3.03A JAR-32 32 WIDE-MOUTH JARS NATURAL 4.0 4.73GLASSB JAR-G-2 2 CLEAR GLASS GREEN 3.2 $2.77B JAR-G-4 4 CLEAR GLASS GREEN 4.8 2.85B JAR-G-6 6 CLEAR GLASS GREEN 6.4 2.98B JAR-G-8 8 CLEAR GLASS GREEN 8.0 3.47B JAR-G-16 16 CLEAR GLASS GREEN 11.2 3.70B JAR-G-32 32 CLEAR GLASS GREEN 17.6 4.92DC-25/UPS/FC-70Phone (800) 348-0868www.vestil.com
Glass BottlesGeneral-purpose glass bottles make sampling and storage convenient. Glass bottles resist mostchemicals and are ideal for use with liquid as well as solid contents. All glass bottles includethreaded chemical resistant thermoset caps with PTFE foam-backed liner.BTL-UVN-G: Narrow-mouth amber glass bottles protect light or UV sensitive solutions. Narrow-mouthopening is ideal for smooth pouring of contents and reducing splash.BTL-UVW-G: Wide-mouth amber glass bottles protect light or UV sensitive solutions while providing awide-mouth for easy access and cleaning.BTL-GN: Narrow-mouth clear glass bottles are ideal for smooth pouring of contents and reducing splash.Clear glass construction allows for visual inspection of contents.BTL-SW-G: Square clear glass bottles feature a wide-mouth for easy access cleaning. Square shape of bottleconserves packaging and storage space. Clear glass construction allows for visual inspection of contents.BTL-SG-G: 32 ounce square clear glass bottle features graduations for measurement in both cubiccentimeters and ounces.MODELNUMBERUNIFORMCAPACITY (OZ)CAPCOLORNET WT.(OUNCES)LIST PRICEEACHDESCRIPTIONAMBER UV GLASS BOTTLESA BTL-UVN-G-4 4 NARROW-MOUTH GREEN 3.8 $2.38A BTL-UVN-G-8 8 NARROW-MOUTH GREEN 6.2 2.70A BTL-UVN-G-16 16 NARROW-MOUTH GREEN 11.4 3.55A BTL-UVN-G-32 32 NARROW-MOUTH GREEN 16.1 5.08B BTL-UVW-G-4 4 WIDE-MOUTH GREEN 4.0 $2.55B BTL-UVW-G-8 8 WIDE-MOUTH GREEN 6.4 3.41B BTL-UVW-G-16 16 WIDE-MOUTH GREEN 11.6 4.30B BTL-UVW-G-32 32 WIDE-MOUTH GREEN 16.3 5.66ROUND GLASS BOTTLESC BTL-GN-1 1 NARROW-MOUTH GREEN 1.6 $0.93C BTL-GN-2 2 NARROW-MOUTH GREEN 2.2 1.03C BTL-GN-4 4 NARROW-MOUTH GREEN 3.8 1.22C BTL-GN-8 8 NARROW-MOUTH GREEN 6.2 1.43C BTL-GN-16 16 NARROW-MOUTH GREEN 11.4 2.06C BTL-GN-32 32 NARROW-MOUTH GREEN 16.1 2.85SQUARE GLASS BOTTLESD BTL-SW-G-1 1 WIDE-MOUTH GREEN 2.0 $1.26D BTL-SW-G-2 2 WIDE-MOUTH GREEN 2.6 1.88D BTL-SW-G-4 4 WIDE-MOUTH GREEN 4.2 2.52D BTL-SW-G-8 8 WIDE-MOUTH GREEN 6.6 3.12D BTL-SW-G-16 16 WIDE-MOUTH GREEN 12 4.31-- BTL-SG-G-32 32 GRADUATED GREEN 16.3 $5.40DC-25/FC-70ABCD199NewPlastic VialsTranslucent polypropylene (PP) vials are ideal for storing samples and small quantities ofvarious contents. Available in two styles to best fit user applications. All vials are constructedof FDA compliant material.VIAL-A: Snap-inside hinged lids have a tab on the lid for opening. Lid clasps inside container to form atight-fitting seal.VIAL-B: Snap-outside hinged lids clasps outside the container to form a tight traditional closure.MODELNUMBERUNIFORMCAPACITY (OZ)QUANTITYPER PACKNET WT.(OUNCES)LIST PRICEPER PACKDESCRIPTIONC VIAL-A-100 1 SNAP-INSIDE LID 10 1.6 $ 10.19C VIAL-A-150 1½ SNAP-INSIDE LID 10 2.4 10.43C VIAL-A-200 2 SNAP-INSIDE LID 10 2.4 10.61C VIAL-A-250 2½ SNAP-INSIDE LID 10 3.2 10.89C VIAL-A-300 3 SNAP-INSIDE LID 10 4.0 12.59C VIAL-A-400 4 SNAP-INSIDE LID 10 4.8 14.28D VIAL-B-100 1 SNAP-OUTSIDE LID 10 1.6 $9.41D VIAL-B-150 1½ SNAP-OUTSIDE LID 10 2.4 10.32D VIAL-B-200 2 SNAP-OUTSIDE LID 10 2.4 13.49D VIAL-B-250 2½ SNAP-OUTSIDE LID 10 3.2 23.36D VIAL-B-300 3 SNAP-OUTSIDE LID 10 4.0 24.83D VIAL-B-400 4 SNAP-OUTSIDE LID 10 4.8 28.24DC-25/FC-70www.vestil.com Phone (800) 348-0868CDNewDRUM, CYLINDER, PAIL EQUIPMENT
200NewGraduated Plastic BottlesTranslucent graduated plastic bottles have a white label area to allow clear identification of bottlesand contents. Designed to allow easy labeling with a marker (not included). Bottles are graduated inmilliliters and ounces for content measurement. Bottles are made from FDA compliant low densitypolyethylene (LDPE); caps are made from FDA complaint polypropylene (PP). Available with assortedcap types.DRUM, CYLINDER, PAIL EQUIPMENTABCDEFPhone (800) 348-0868MODELNUMBERUNIFORMCAPACITY (OZ)CAPCOLORNET WT.(OUNCES)LIST PRICEEACHDESCRIPTIONSTANDARD GRADUATED BOTTLE WITH LABELA BTL-N-4-LBL 4 STANDARD CAP NATURAL 0.75 $1.99A BTL-N-6-LBL 6 STANDARD CAP NATURAL 1.12 2.27A BTL-N-8-LBL 8 STANDARD CAP NATURAL 1.15 2.53A BTL-N-16-LBL 16 STANDARD CAP NATURAL 3.8 4.33A BTL-N-32-LBL 32 STANDARD CAP NATURAL 4.2 6.35B BTL-W-4-LBL 4 STANDARD CAP NATURAL 0.75 $2.42B BTL-W-8-LBL 8 STANDARD CAP NATURAL 1.15 2.60B BTL-W-16-LBL 16 STANDARD CAP NATURAL 3.8 3.01B BTL-W-32-LBL 32 STANDARD CAP NATURAL 4.2 7.19GRADUATED DISPENSING BOTTLE WITH LABELC BTL-RC-4-LBL 4 RED CAP NATURAL 0.77 $2.04C BTL-RC-6-LBL 6 RED CAP NATURAL 1.15 2.56C BTL-RC-8-LBL 8 RED CAP NATURAL 1.15 2.96C BTL-RC-16-LBL 16 RED CAP NATURAL 3.8 3.79D BTL-RD-4-LBL 4 DROP CAP NATURAL 0.8 $4.15D BTL-RD-8-LBL 8 DROP CAP NATURAL 1.6 5.67E BTL-RF-4-LBL 4 FLIP TOP CAP NATURAL 2.56 $2.57E BTL-RF-8-LBL 8 FLIP TOP CAP NATURAL 3.2 2.99E BTL-RF-16-LBL 16 FLIP TOP CAP NATURAL 4.48 3.67F BTL-WN-4-LBL 4 NARROW MOUTH WASH NATURAL 0.8 $4.54F BTL-WN-8-LBL 8 NARROW MOUTH WASH NATURAL 1.44 4.85F BTL-WN-16-LBL 16 NARROW MOUTH WASH NATURAL 2.72 5.36F BTL-WN-32-LBL 32 NARROW MOUTH WASH NATURAL 3.84 7.12GRADUATED WASH BOTTLE WITH LABELG BTL-WW-4-LBL 4 WASH BOTTLE NATURAL 0.8 $4.54G BTL-WW-8-LBL 8 WASH BOTTLE NATURAL 1.44 4.85G BTL-WW-16-LBL 16 WASH BOTTLE NATURAL 2.72 5.36G BTL-WW-32-LBL 32 WASH BOTTLE NATURAL 3.84 8.00H BTL-WW-4B-LBL 4 WASH BOTTLE BLUE 0.8 $4.54H BTL-WW-8B-LBL 8 WASH BOTTLE BLUE 1.44 4.85H BTL-WW-16B-LBL 16 WASH BOTTLE BLUE 2.72 5.36H BTL-WW-32B-LBL 32 WASH BOTTLE BLUE 3.84 8.00I BTL-WW-4R-LBL 4 WASH BOTTLE RED 0.8 $4.54I BTL-WW-8R-LBL 8 WASH BOTTLE RED 1.44 4.85I BTL-WW-16R-LBL 16 WASH BOTTLE RED 2.72 5.36I BTL-WW-32R-LBL 32 WASH BOTTLE RED 3.84 8.00J BTL-WW-4G-LBL 4 WASH BOTTLE GREEN 0.8 $4.54J BTL-WW-8G-LBL 8 WASH BOTTLE GREEN 1.44 4.85J BTL-WW-16G-LBL 16 WASH BOTTLE GREEN 2.72 5.36J BTL-WW-32G-LBL 32 WASH BOTTLE GREEN 3.84 8.00K BTL-WW-4Y-LBL 4 WASH BOTTLE YELLOW 0.8 $4.54K BTL-WW-8Y-LBL 8 WASH BOTTLE YELLOW 1.44 4.85K BTL-WW-16Y-LBL 16 WASH BOTTLE YELLOW 2.72 5.36K BTL-WW-32Y-LBL 32 WASH BOTTLE YELLOW 3.84 8.00DC-25/UPS/FC-70G H IJKwww.vestil.com
Plastic Squeeze BottlesTranslucent bottles allow easy viewing of contents. All dispensing bottles and wash bottles hold liquids upto 150°F. Bottles are made from FDA compliant low density polyethylene (LDPE); caps are made fromFDA complaint polypropylene (PP).New201MODELNUMBERUNIFORMCAPACITY (OZ)DISPENSINGSTYLECAPCOLORQTY. PERPACKAGENET WT.(OUNCES)LIST PRICEPER PKG.DISPENSING BOTTLESA BTL-RC-1 1 RED CAP CLEAR 12 0.38 $12.22A BTL-RC-2 2 RED CAP CLEAR 12 0.38 15.12A BTL-RC-4 4 RED CAP CLEAR 12 0.77 20.41A BTL-RC-6 6 RED CAP CLEAR 12 1.15 25.58A BTL-RC-8 8 RED CAP CLEAR 12 1.15 29.61A BTL-RC-16 16 RED CAP CLEAR 12 3.8 37.93B BTL-RF-1 1 FLIP-TOP NATURAL 12 1.28 $23.13B BTL-RF-2 2 FLIP-TOP NATURAL 12 1.28 24.64B BTL-RF-4 4 FLIP-TOP NATURAL 12 2.56 25.70B BTL-RF-8 8 FLIP-TOP NATURAL 12 3.2 29.94B BTL-RF-16 16 FLIP-TOP NATURAL 12 4.48 36.74C BTL-RD-4 4 SINGLE DROP CLEAR 10 0.8 $34.55C BTL-RD-8 8 SINGLE DROP CLEAR 10 1.6 47.25D BTL-NT-4 4 SIDE DISPENSING NO TIP CLEAR 1 2.24 $5.51D BTL-NT-8 8 SIDE DISPENSING NO TIP CLEAR 1 3.2 6.35WASH BOTTLESE BTL-WN-4 4 NARROW MOUTH NATURAL 1 0.8 $3.78E BTL-WN-8 8 NARROW MOUTH NATURAL 1 1.44 4.04E BTL-WN-16 16 NARROW MOUTH NATURAL 1 2.72 4.46E BTL-WN-32 32 NARROW MOUTH NATURAL 1 3.84 5.93F BTL-WW-4 4 WIDE MOUTH CLEAR 1 0.8 $3.78F BTL-WW-8 8 WIDE MOUTH CLEAR 1 1.44 4.04F BTL-WW-16 16 WIDE MOUTH CLEAR 1 2.72 4.46F BTL-WW-32 32 WIDE MOUTH CLEAR 1 3.84 6.67G BTL-WW-4B 4 WIDE MOUTH BLUE 1 0.8 $3.78G BTL-WW-8B 8 WIDE MOUTH BLUE 1 1.44 4.04G BTL-WW-16B 16 WIDE MOUTH BLUE 1 2.72 4.46G BTL-WW-32B 32 WIDE MOUTH BLUE 1 3.84 6.67H BTL-WW-4R 4 WIDE MOUTH RED 1 0.8 $3.78H BTL-WW-8R 8 WIDE MOUTH RED 1 1.44 4.04H BTL-WW-16R 16 WIDE MOUTH RED 1 2.72 4.46H BTL-WW-32R 32 WIDE MOUTH RED 1 3.84 6.67I BTL-WW-4G 4 WIDE MOUTH GREEN 1 0.8 $3.78I BTL-WW-8G 8 WIDE MOUTH GREEN 1 1.44 4.04I BTL-WW-16G 16 WIDE MOUTH GREEN 1 2.72 4.46I BTL-WW-32G 32 WIDE MOUTH GREEN 1 3.84 6.67J BTL-WW-4Y 4 WIDE MOUTH YELLOW 1 0.8 $3.78J BTL-WW-8Y 8 WIDE MOUTH YELLOW 1 1.44 4.04J BTL-WW-16Y 16 WIDE MOUTH YELLOW 1 2.72 4.46J BTL-WW-32Y 32 WIDE MOUTH YELLOW 1 3.84 6.67DC-25/UPS/FC-70Series BTL-RC: Dispensing bottles with removable red cap are greatfor accurate dispensing in small areas. Caps are designed to dispensecontainer contents through a hole at the end of cone-shaped spout.Series BTL-RF: Dispensing bottles with flip-top caps. Flip the top opento dispense contents safely. When finished flip the cap down.Series BTL-RD: Dispensing bottles with single-drop caps are designedfor accurately dispensing very small quantities. Each dropper top is fittedwith a small attached cap to stay in place while bottle is in use.Series BTL-NT: No-Tip side dispensing bottles are designed to allowdispensing from bottle in an upright position. Contents are drawn fromthe bottom of the bottle to allow dispensing without tipping or shaking.Series BTL-WN: Narrow mouth wash bottles dispense by drawingcontents up the stem and out through the top cap.Series BTL-WW: Wide mouth wash bottles are designed for easy filling.Available with clear, blue, red, green and yellow caps. Color-coded capsallow for easy identification between contents and promote safer workingconditions.www.vestil.com Phone (800) 348-0868GIABCDEFHJDRUM, CYLINDER, PAIL EQUIPMENT
202ABPlastic Bottles & PitchersGeneral-purpose plastic bottles for storage or shipping. All bottles and caps are constructed of FDAcompliant materials.BTL-N & BTL-W: Narrow and wide mouth translucent low density polyethylene (LDPE) bottles with standardthreaded polypropylene (PP) cap.BTL-BW: Oversized natural high density polyethylene (HDPE) bottles with a standard threaded high densitypolyethylene (HDPE) cap with ethylene vinyl acetate (EVA) liner. Designed for easy access to contents and for easycleaning.BTL-UVN & BTL-UVW: Narrow and wide mouth amber plastic bottles protect light or UV-sensitive solutions.Constructed of low-density polyethylene (LDPE). Includes standard threaded polypropylene (PP) cap.BTL-SN & BTL-SW: Narrow and wide-mouth natural high density polyethylene (HDPE) square bottles withstandard threaded polypropylene (PP) cap.BTL-SW-C: Wide-mouth clear polyethylene terephthalate (PET) square bottles with standard threaded polypropylene(PP) cap. Clear material allows visual access to contents.BTL-EZ: Oversized natural high density polyethylene (HDPE) bottle with a standard threaded high densitypolyethylene (HDPE) cap with ethylene vinyl acetate (EVA) liner. Designed with hand grips for easy handling.PIT: High density polyethylene (HDPE) construction. Graduation markings in US quarts and liters. FDAapproved polyethylene construction. Screw-on lid and spout cap. Comfortable molded pouring handle. Wide basefor stability. Flexible spout for easy, controlled pouring.DRUM, CYLINDER, PAIL EQUIPMENTCDEFGHIPhone (800) 348-0868JNewMODELNUMBERUNIFORMCAPACITY (OZ)CAPCOLORQTY.PER PACKNET WT.(OUNCES)LIST PRICEEACH PKG.DESCRIPTIONPLASTIC BOTTLESA BTL-N-1 1 NARROW-MOUTH NATURAL 12 0.2 $11.98A BTL-N-2 2 NARROW-MOUTH NATURAL 12 0.6 14.82A BTL-N-4 4 NARROW-MOUTH NATURAL 12 0.7 20.00A BTL-N-6 6 NARROW-MOUTH NATURAL 12 0.8 25.06A BTL-N-8 8 NARROW-MOUTH NATURAL 12 0.9 29.02A BTL-N-16 16 NARROW-MOUTH NATURAL 12 1.6 37.17A BTL-N-32 32 NARROW-MOUTH NATURAL 1 2.2 5.30B BTL-W-4 4 WIDE-MOUTH NATURAL 12 0.8 $24.22B BTL-W-8 8 WIDE-MOUTH NATURAL 12 1.44 25.99B BTL-W-16 16 WIDE-MOUTH NATURAL 12 2.72 30.07B BTL-W-32 32 WIDE-MOUTH NATURAL 1 3.84 5.99C BTL-BW-64 64 OVERSIZED WIDE-MOUTH NATURAL 1 6.4 $5.20C BTL-BW-100 1 GAL. OVERSIZED WIDE-MOUTH NATURAL 1 8.8 6.12C BTL-BW-125 1¼ GAL. OVERSIZED WIDE-MOUTH NATURAL 1 11.2 8.27C BTL-BW-250 2½ GAL. OVERSIZED WIDE-MOUTH NATURAL 1 17.6 18.20AMBER UV PLASTIC BOTTLESD BTL-UVN-4 4 NARROW-MOUTH AMBER 1 0.7 $2.52D BTL-UVN-8 8 NARROW-MOUTH AMBER 1 0.9 3.41D BTL-UVN-16 16 NARROW-MOUTH AMBER 1 1.6 5.06D BTL-UVN-32 32 NARROW-MOUTH AMBER 1 2.2 8.14E BTL-UVW-4 4 WIDE-MOUTH AMBER 1 0.8 $2.73E BTL-UVW-8 8 WIDE-MOUTH AMBER 1 1.44 4.29E BTL-UVW-16 16 WIDE-MOUTH AMBER 1 2.72 5.40E BTL-UVW-32 32 WIDE-MOUTH AMBER 1 3.84 10.64SQUARE PLASTIC BOTTLESF BTL-SN-2 2 NARROW-MOUTH NATURAL 1 0.6 $1.71F BTL-SN-4 4 NARROW-MOUTH NATURAL 1 0.8 3.13F BTL-SN-8 8 NARROW-MOUTH NATURAL 1 1 4.51F BTL-SN-16 16 NARROW-MOUTH NATURAL 1 1.4 6.19F BTL-SN-32 32 NARROW-MOUTH NATURAL 1 2.4 9.51G BTL-SW-2 2 WIDE-MOUTH NATURAL 1 0.6 $1.88G BTL-SW-4 4 WIDE-MOUTH NATURAL 1 0.8 1.97G BTL-SW-8 8 WIDE-MOUTH NATURAL 1 1 4.09G BTL-SW-16 16 WIDE-MOUTH NATURAL 1 1.8 5.65G BTL-SW-32 32 WIDE-MOUTH NATURAL 1 2.4 7.93H BTL-SW-2C 2 WIDE-MOUTH CLEAR NATURAL 1 0.5 $2.57H BTL-SW-4C 4 WIDE-MOUTH CLEAR NATURAL 1 0.7 3.18H BTL-SW-8C 8 WIDE-MOUTH CLEAR NATURAL 1 0.9 5.57H BTL-SW-16C 16 WIDE-MOUTH CLEAR NATURAL 1 1.7 7.01H BTL-SW-32C 32 WIDE-MOUTH CLEAR NATURAL 1 2.2 9.21I BTL-EZ-1 1 GAL. EASY GRIP NATURAL 1 11.2 $24.83POURING PITCHERSJ PIT-1 1 LITER WIDE BASE BLACK 1 3.4 $7.63J PIT-5 5 LITER WIDE BASE BLACK 1 13.6 13.26DC-25/UPS/FC-70www.vestil.com
Ergo-Handle CartsThe Ergo-Handle Cart is constructed of heavy-duty steel to handle uniform loads up to 4,000pounds. The patented ergonomic handle decreases fatigue by allowing the operator to easilymaneuver the cart. Rolls on 2 rigid, 2 swivel 8" x 2" casters with roller bearings. Invertible bolt-onchrome ergonomic handle designed for individual height comfort and handling of long loads.MODELNUMBERPLATFORMSIZE (W x L)SHELFCLEARANCETOP SHELFHEIGHTUNIFORMCAPACITYNET WT.(LBS.)LIST PRICEEACH8" x 2" GLASS-FILLED-NYLON CASTERS2-SHELF UNITSDH-PH4-2436 24" x 36" 22" 36¼" 4,000 lbs. 225 $352.00DH-PH4-2448 24" x 48" 22" 36¼" 4,000 lbs. 253 385.00DH-PH4-2460 24" x 60" 22" 36¼" 4,000 lbs. 275 414.00DH-PH4-2472 24" x 72" 22" 36¼" 4,000 lbs. 280 443.00DH-PH4-3448 34" x 48" 22" 36¼" 4,000 lbs. 286 $450.00DH-PH4-3460 34" x 60" 22" 36¼" 4,000 lbs. 320 457.00DH-PH4-3472 34" x 72" 22" 36¼" 4,000 lbs. 330 513.003-SHELF UNITSDH-PH4-2436-3 24" x 36" 9¾" 36¼" 4,000 lbs. 270 $402.00DH-PH4-2448-3 24" x 48" 9¾" 36¼" 4,000 lbs. 288 436.00MODELNUMBERPLATFORMSIZE (W x L)SHELFCLEARANCETOP SHELFHEIGHTUNIFORMCAPACITYNET WT.(LBS.)LIST PRICEEACH8" x 2" POLYURETHANE CASTERS2-SHELF UNITSDH-PU2.4-2436 24" x 36" 22" 36¼" 3,600 lbs. 230 $379.00DH-PU2.4-2448 24" x 48" 22" 36¼" 3,600 lbs. 250 402.00DH-PU2.4-3060 30" x 60" 22" 36¼" 3,600 lbs. 304 441.00MODELNUMBERPLATFORMSIZE (W x L)SHELFCLEARANCETOP SHELFHEIGHTUNIFORMCAPACITYNET WT.(LBS.)LIST PRICEEACH8" x 2" MOLD-ON-RUBBER CASTERS2-SHELF UNITSDH-MR2-2436 24" x 36" 22" 36¼" 2,400 lbs. 199 $323.00DH-MR2-2448 24" x 48" 22" 36¼" 2,400 lbs. 229 351.00DH-MR2-3060 30" x 60" 22" 36¼" 2,400 lbs. 365 388.00MODELNUMBERMODELNUMBERBOTTOM SHELFSIZE (W x L)SHELFCLEARANCETOP SHELFHEIGHTSIZE(W x L)UNIFORMCAP./SHELFLIPHEIGHTTOTALUNIFORM CAP.NET WT.(LBS.)NET WT.(LBS)LIST PRICEEACHDESCRIPTIONDHPH-1236-UTS OPTIONAL UTILITY SHELF 12" x 36" 2" 42 $85.00DHPH-1248-UTS OPTIONAL UTILITY SHELF 12" x 48" 2" 52 110.00DHPH-1260-UTS OPTIONAL UTILITY SHELF 12" x 60" 2" 62 130.00DHPH-1272-UTS OPTIONAL UTILITY SHELF 12" x 72" 2" 75 149.00OPTIONAL FLOOR LOCK, model ERGO-FL, $51.00 LISTDC-25/FC-100Stockpicker TrucksCombine the mobility of a cart with the versatility of a step ladder with our Stockpicker Trucks.Convenient spring loaded step ladder holds the cart securely in place while a person is standing onthe ladder. Crutch tip ladder prevents the cart from moving while stocking. Springs then returnthe ladder to the raised position once personnel exit the step. All shelves have a 2" lip turned up toprevent items from falling off. Standard casters are 4" x 2" mold-on-rubber, two rigid and two swivelwith wheel brakes. Steel units are powder coated blue.LIST PRICEEACHALUMINUM CONSTRUCTION2-SHELF UNITSSPA2-2236 22" x 36" 28" 35 5 /8" 330 lbs. 660 lbs. 98 $467.00SPA2-2840 28" x 40" 28" 35 5 /8" 330 lbs. 660 lbs. 135 512.00SPA2-2848 28" x 48" 28" 35 5 /8" 330 lbs. 660 lbs. 147 545.003-SHELF UNITSSPA3-2236 22" x 36" 13½" 35 5 /8" 330 lbs. 1,000 lbs. 125 $530.00SPA3-2840 28" x 40" 13½" 35 5 /8" 330 lbs. 1,000 lbs. 150 598.00SPA3-2848 28" x 48" 13½" 35 5 /8" 330 lbs. 1,000 lbs. 180 652.00STEEL CONSTRUCTION2-SHELF UNITSSPS2-2236 22" x 36" 28" 35 5 /8" 550 lbs. 1,000 lbs. 200 $402.00SPS2-2840 28" x 40" 28" 35 5 /8" 550 lbs. 1,000 lbs. 210 430.00SPS2-2848 28" x 48" 28" 35 5 /8" 550 lbs. 1,000 lbs. 225 471.003-SHELF UNITSSPS3-2236 22" x 36" 13½" 35 5 /8" 550 lbs. 1,000 lbs. 260 $454.00SPS3-2840 28" x 40" 13½" 35 5 /8" 550 lbs. 1,000 lbs. 275 498.00SPS3-2848 28" x 48" 13½" 35 5 /8" 550 lbs. 1,000 lbs. 298 525.00LIPS DOWN ON TOP SHELF, MODEL SPS-LIPD $100.00 LISTDC-25/FC-100ALUMINUMTHREE SHELFseries SPA3STEELTHREE SHELFseries SPS3ALUMINUMTWO SHELFseries SPA2www.vestil.com Phone (800) 348-0868203OPTIONAL UTILITY SHELFseries DHPHSTEELTWO SHELFseries SPS2INDUSTRIAL CARTS & DOLLIES
INDUSTRIAL CARTS & DOLLIES204HI-DUTYSTOCKPICKERseries SPS-HDmodel SPS2-2041-Cseries SPA-HDHI-FRAMESTOCKPICKERseries SPS-HFSteel Cantilever Stockpicker TruckThis unique cantilever design allows for oversized packages to fit conveniently on the bottom shelfwithout restricting access to the packages. Eliminate the need to move around a clumsy ladder andpush a cart while trying to stock or unstock shelves. The step ladders are spring loaded to hold thecart securely in place while a person is standing on the ladder. Two rigid and two swivel 4" x 1½"mold-on-rubber casters standard. Total uniform capacity is 440 lbs. per cart, uniformly loaded.MODELNUMBERBOTTOM SHELFSIZE (W x L)SHELF TOP SHELFCLEARANCE HEIGHTUNIFORMTOP SHELFCAPACITYUNIFORMBOTTOM SHELFCAPACITYNET WT.(LBS.)LIST PRICEEACHSPS2-2041-C 20½" x 41 5 /8" 27 7 /8" 36½" 110 lbs. 440 lbs. 110 $274.00DC-25/FC-100Hi-Duty & Hi-Frame Stockpicker TrucksThese oversized units are perfect for large jobs. Ideal for oversized cartons, boxes, parts, and supplies. Aspring loaded ladder for sure, safe climbing, and loading. Steps have non-skid footing with self-cleaningsurface. Each unit features three shelves. Standard 4" x 2" mold-on-rubber casters, 2 rigid and 2 swivelwith brake. Built of durable steel or aluminum construction. Steel units are powder coated a blue finish.MODELNUMBERBOTTOM SHELFSIZE (W x L)SHELFCLEARANCETOP SHELFHEIGHTUNIFORMCAPACITYPER SHELFTOTALUNIFORMCAPACITYNET WT.(LBS.)LIST PRICEEACHHI-DUTY STOCKPICKER TRUCKSALUMINUMSPA-HD-2252 22" x 52" 13" 35½" 330 lbs. 500 lbs. 156 $705.00SPA-HD-2852 28" x 52" 13" 35½" 330 lbs. 500 lbs. 168 982.00STEEL*SPS-HD-2252 22" x 52" 13" 37¾" 500 lbs. 1,000 lbs. 230 $672.00SPS-HD-2852 28" x 52" 13" 37¾" 500 lbs. 1,000 lbs. 270 748.00HI-FRAME STOCKPICKER TRUCKSSTEEL*SPS-HF-2252 22" x 52" 27" 63½" 500 lbs. 1,000 lbs. 230 $823.00SPS-HF-2852 28" x 52" 27" 63½" 500 lbs. 1,000 lbs. 270 938.00DC-25/FC-100Service CartsAll welded Service Carts made of steel or aluminum are ideal for transporting parts and boxes. A2" lip is turned up on all shelves to prevent items from sliding off. Standard 4" x 2" mold-on-rubbercasters, 2 rigid and 2 swivel with brake. Steel units are powder coated blue.ALUMINUMseries SCA3MODELNUMBERBOTTOM SHELFSIZE (W x L)SHELFCLEARANCETOP SHELFHEIGHTUNIFORMCAPACITYPER SHELFTOTALUNIFORMCAPACITYNET WT.(LBS.)LIST PRICEEACHALUMINUM CONSTRUCTION2-SHELF UNITSSCA2-2236 22" x 36" 23½" 31 1 /8" 330 lbs. 660 lbs. 61 $321.00SCA2-2840 28" x 40" 23½" 31 1 /8" 330 lbs. 660 lbs. 70 352.00SCA2-2848 28" x 48" 23½" 31 1 /8" 330 lbs. 660 lbs. 76 403.00STEELseries SCS23-SHELF UNITSSCA3-2236 22" x 36" 15" 31 1 /8" 330 lbs. 660 lbs. 72 $388.00SCA3-2840 28" x 40" 15" 31 1 /8" 330 lbs. 660 lbs. 84 437.00SCA3-2848 28" x 48" 15" 31 1 /8" 330 lbs. 660 lbs. 94 488.00STEEL CONSTRUCTION2-SHELF UNITSSCS2-2236 22" x 36" 23½" 39 5 /8" 550 lbs. 1,000 lbs. 115 $260.00SCS2-2840 28" x 40" 23½" 39 5 /8" 550 lbs. 1,000 lbs. 136 284.00SCS2-2848 28" x 48" 23½" 39 5 /8" 550 lbs. 1,000 lbs. 151 300.00New3-SHELF UNITSSCS3-2236 22" x 36" 15" 39 5 /8" 550 lbs. 1,000 lbs. 144 $313.00SCS3-2840 28" x 40" 15" 39 5 /8" 550 lbs. 1,000 lbs. 174 341.00SCS3-2848 28" x 48" 15" 39 5 /8" 550 lbs. 1,000 lbs. 197 366.00LIP DOWN ON TOP SELF, MODEL SPS-LIPD $100.00 LISTDC-25/FC-100Two-Tier Steel Service CartHeavy-duty two-tier service cart has a capacity of 1,100 lbs. per shelf and a total weight capacityof 2,200 lbs. Units roll smoothly on two rigid and two swivel 5" x 2" non-marking polyurethanecasters. Steel construction with blue finish. Ships knock-down.CASTERS ARE NOT ATTACHEDFOR SHIPPING PURPOSES(pgs. 203-208)Phone (800) 348-0868MODELNUMBERDECK SIZE(W x L)TOP SHELFHEIGHTLOWER SHELFHEIGHTHANDLEHEIGHTUNIFORM STATICCAPACITY (LBS.)NET WT.(LBS.)LIST PRICEEACHSTC-1835 18" x 35" 32½" 8½" 38" 2,200 71 $199.00DC-25/UPS/FC-100www.vestil.com
Easy-Access Steel Stock TrucksUnique two shelf design features three support legs to allow for easier access to bottom shelf.Attractive chrome plated ergonomic push handles are ideal for users of various heights. Two rigid andtwo locking swivel ball bearing poly casters 5" x 1¼" are standard. Mount swivel casters to the frontof cart for lighter applications and to the rear for heavier applications. Optional bolt-on writing surfacewith hinged top for access to lockable storage box to hold supplies. The optional basket is ideal for extra carryingcapacity. Fold-out design simplifies assembly. Ships knockdown. Assembly required. Steel construction.MODELNUMBERMODELNUMBERDECK SIZE(W x L)DECK SIZE(W x L)CAPACITYPER SHELFUNIFORM STATICCAPACITY (LBS.)UNIFORM STATICCAPACITY (LBS.)DECKHEIGHTOVERALL SIZE(W x L x H)NUMBER OFSHELVESNET WT.(LBS.)NET WT.(LBS.)LIST PRICEEACHEASY-A-1836 18" x 36" 660 1,200 18" x 41½" x 36" 70 $234.00EASY-A-2436 24" x 36" 660 1,200 24" x 41½" x 36" 80 248.00EASY-A-2448 24" x 48" 660 1,200 24" x 53½" x 36" 90 283.00EASY-A-WT Optional Writing Table/Storage Box (Size 13"W x 11"D x 9½"H) 27 $38.00EASY-A-BSK Optional Wire Storage Basket 4 28.00DC-25/UPS/FC-100Double & Triple Decker Hardwood Platform CartsMinimize lifting and bending with this cart/portable work bench. Ideal for shipping areas, offices, andplant use, these economical carts are perfect for many of your applications. Constructed of ⅞" thickhardwood platform and removable steel push handle. 6" x 2" mold-on-rubber casters, two rigid andtwo swivel. Countersunk holes allow for a smooth deck surface. Ships knockdown.LIST PRICEEACHDOUBLE DECKERVHPT/D-2448 24" x 48" 1,600 9¼" / 22" 2 193 $308.00VHPT/D-2754 27" x 54" 1,600 9¼" / 22" 2 217 326.00VHPT/D-3060 30" x 60" 1,600 9¼" / 22" 2 233 353.00VHPT/D-3672 36" x 72" 1,600 9¼" / 22" 2 288 406.00TRIPLE DECKERVHPT/TD-2448 24" x 48" 1,600 9¼" / 22" / 42¼" 3 263 $426.00VHPT/TD-2754 27" x 54" 1,600 9¼" / 22" / 42¼" 3 297 446.00VHPT/TD-3060 30" x 60" 1,600 9¼" / 22" / 42¼" 3 313 502.00VHPT/TD-3672 36" x 72" 1,600 9¼" / 22" / 42¼" 3 365 574.00DC-25/FC-65Plastic Utility Service CartsConstructed from durable yet lightweight structural foam plastic. Choose either 2 or 3 shelf design toaccommodate your application. Deep 4" high lips prevent parts from rolling off. Ideal for mail rooms,shipping docks, grocery stores, warehouses, and inventory rooms. Includes two rigid and two swivelcasters. Ships knockdown - assembly required.EASY-A-WTDOUBLE DECKER • VHPT/DTRIPLE DECKER • VHPT/TD205INDUSTRIAL CARTS & DOLLIESMODELNUMBERMODELNUMBERDECK SIZE(W x L)DECK SIZE(W x L)TOP DECKHEIGHTSHELFCAPACITYMIDDLEDECK HEIGHTUNIFORM STATICCAPACITY (LBS.)LOWERDECK HEIGHTNUMBEROF SHELVESNUMBEROF SHELVESNET WT.(LBS.)NET WT.(LBS.)LIST PRICEEACHPLSC-2-1731 17½" x 31" 275 lbs. 550 lbs. 2 35 $148.00PLSC-3-1731 17½" x 31" 183 lbs. 550 lbs. 3 53 160.00PLSC-2-2436 24½" x 36" 275 lbs. 550 lbs. 2 47 $176.00PLSC-3-2436 24½" x 36" 183 lbs. 550 lbs. 3 65 224.00DC-25/UPS/FC-70Two & Three Shelf Plastic Platform CartsTransport loads from workstation to workstation with these heavy-duty polyurethane PlatformCarts. Available in either two or three shelf design. Ideal for shipping and receiving areas,maintenance departments, and general warehouse use. Handle height is 36¼". Uniform staticcapacity is 500 pounds. Rolls on (4) swivel 4" x 1¼" rubber casters. Ships knockdown.LIST PRICEEACHPSC-1828-2 18" x 28" 29" -- 5¾" 2 39 $147.00PSC-1828-3 18" x 28" 29" 17½" 5¾" 3 47 176.00DC-25/UPS/FC-92.5Double Tray/Double Basket Mail CartMODELNUMBEROVERALL SIZE(W x L x H)SHELF HEIGHTW/O BASKETSUNIFORM STATICCAPACITY (LBS.)NewQuickly transport office mail and small package delivery throughout your office and warehouse.Two removable, lift-out baskets make delivery, collection and filing of materials easy and convenient.Comes with two file folder hanger runners that can be adjusted for letter or legal size hanging files.Excellent mobility on (4) 4" x 1¼" swivel casters with rear brakes. Steel construction. Easy assembly.BASKET SIZE(W x L x H)NET WT.(LBS.)LIST PRICEEACHMAIL-55 18" x 31" x 39" 11" / 33" 200 17½" x 20" x 10" 55 $264.00DC-25/FC-100Two file folder hangerrunners includedwww.vestil.com Phone (800) 348-0868New
INDUSTRIAL CARTS & DOLLIES206Aluminum Treadplate Platform TrucksLightweight tread plate deck is constructed of all welded aluminum. Rounded-edge platformprotects walls from damage during transit. Includes one removable high-polished steel handle andtwo rigid and two swivel 5" x 2" poly-on-steel casters. Ideal for commercial and warehouse areas.MODELNUMBERDECK SIZE(W x L)DECKHEIGHTUNIFORM STATICCAPACITY (LBS.)CASTERTYPENET WT.(LBS.)LIST PRICEEACHATP-2448 24" x 48" 10" 3,600 POLY-ON-STEEL 77 $349.00ATP-2460 24" x 60" 10" 3,600 POLY-ON-STEEL 90 356.00ATP-3048 30" x 48" 10" 3,600 POLY-ON-STEEL 83 393.00ATP-3060 30" x 60" 10" 3,600 POLY-ON-STEEL 94 447.00ATP-3672 36" x 72" 10" 3,600 POLY-ON-STEEL 114 543.00HANDLE DESIGN MAY VARY FROM WHAT IS SHOWNDC-25/UPS/FC-100Heavy-Duty Extruded Aluminum Platform TrucksThese all welded aluminum trucks are built to handle your heaviest loads. Includes one removablehigh-polished steel handle, additional handle available. Rolls smoothly on two rigid and twoswivel 8" x 2" glass-filled nylon casters. Ideal for industrial and warehouse areas.MODELNUMBERDECK SIZE(W x L)DECKHEIGHTUNIFORM STATICCAPACITY (LBS.)CASTERTYPENET WT.(LBS.)LIST PRICEEACHEFHD-2448 24" x 48" 10¾" 4,800 GFN* 145 $404.00EFHD-3048 30" x 48" 10¾" 4,800 GFN* 152 447.00EFHD-3060 30" x 60" 10¾" 4,800 GFN* 176 491.00EFHD-3672 36" x 72" 10¾" 4,800 GFN* 190 577.00HANDLE DESIGN MAY VARY FROM WHAT IS SHOWNDC-25/UPS/FC-100*GLASS-FILLED NYLONAluminum Channel Platform TrucksRugged dependable service at an economical price. Extruded deck sections are engineered forhigh load capacity, durability, and shock resistance. All aluminum construction. Includes oneremovable high-polished steel handle and two rigid and two swivel 5" x 2" poly-on-steel casters.Ideal for commercial, industrial, and warehouse areas.MODELNUMBERDECK SIZE(W x L)DECKHEIGHTUNIFORM STATICCAPACITY (LBS.)CASTERTYPENET WT.(LBS.)LIST PRICEEACHSDD-2448 24" x 48" 10½" 3,600 POLY-ON-STEEL 84/UPS $340.00SDD-3048 30" x 48" 10½" 3,600 POLY-ON-STEEL 88/UPS 373.00SDD-3060 30" x 60" 10½" 3,600 POLY-ON-STEEL 94 407.00SDD-3672 36" x 72" 10½" 3,600 POLY-ON-STEEL 109 502.00HANDLE DESIGN MAY VARY FROM WHAT IS SHOWNDC-25/UPS/FC-100Aluminum Sheet Deck Platform TrucksTough but lightweight, this truck is made of smooth aluminum for durability. Includes oneremovable high-polished steel handle. Two rigid and two swivel 5" x 2" poly-on-steel casters arestandard. Ideal for commercial, industrial, and warehouse areas.MODELNUMBERDECK SIZE(W x L))DECKHEIGHTUNIFORM STATICCAPACITY (LBS.)CASTERTYPENET WT.(LBS.)LIST PRICEEACHASD-2448 24" x 48" 10" 3,600 POLY-ON-STEEL 77/UPS $347.00ASD-2460 24" x 60" 10" 3,600 POLY-ON-STEEL 86/UPS 356.00ASD-3048 30" x 48" 10" 3,600 POLY-ON-STEEL 83 391.00ASD-3060 30" x 60" 10" 3,600 POLY-ON-STEEL 94 522.00ASD-3672 36" x 72" 10" 3,600 POLY-ON-STEEL 114 539.00HANDLE DESIGN MAY VARY FROM WHAT IS SHOWNDC-25/UPS/FC-100Phone (800) 348-0868Fold-Up Aluminum Platform TruckTelescoping aluminum frame has dual length platform; 25" extended and 16½" retracted. Easysteering with 4" x 1" hard rubber casters, two rigid and two swivel. Folded dimensions are 16"Wx 20"L allowing the truck to fit into tight spaces for storage. Handle height is 33½" extended and26½" retracted. Ideal for delivery, repair personnel, frequent travelers and salespeople.MODELNUMBEROVERALLSIZE (W x L)DECKHEIGHTUNIFORM STATICCAPACITY (LBS.)CASTERTYPENET WT.(LBS.)LIST PRICEEACHFAPT-1628 16" x 28" 6½" 300 HARD RUBBER 21 $61.00DC-25/UPS/FC-100www.vestil.com
Aluminum Folding Handle Platform TrucksFor safe transportation of stacks of paper, small parts and other lightweight equipment. Ideal formaintenance rooms, offices, schools, hospitals, etc. Plastic corner protectors enhance durability andprotect surroundings. Rugged aluminum construction with single or dual folding handle design.MODELNUMBERHANDLETYPEDECK SIZE(W x L x H)UNIFORM STATICCAPACITY (LBS.)CASTERSIZENET WT.(LBS.)LIST PRICEEACHRUBBER CASTERSAFT-30 SINGLE 18½" x 30" x 6 3 /8" 400 4" 20 $85.00AFT-36 SINGLE 24" x 36" x 7 3 /8" 600 5" 35 147.00AFT-48 SINGLE 24" x 48" x 7 3 /8" 600 5" 40 173.00AFT-60 DUAL 30" x 60" x 7 3 /8" 800 5" 60 348.00NON-MARKING POLYURETHANE CASTERSAFT-30-NM SINGLE 18½" x 30" x 7 3 /8" 400 5" 20 $161.00AFT-36-NM SINGLE 24" x 36" x 8 3 /8" 600 6" 35 229.00AFT-48-NM SINGLE 24" x 48" x 8 3 /8" 600 6" 40 252.00AFT-60-NM DUAL 30" x 60" x 8 3 /8" 800 6" 60 450.00DC-25/FC-70Aluminum Platform Trucks with Folding HandleMove supplies, forms, files, office equipment, or almost anything around the office or shop.Compact size is ideal for use on delivery vehicles. Each model features a steel handle which foldsdown for storage. Equipped with easy rolling 4" x 1" rubber casters, two rigid and two swivel.model AFT-60model AFT-48207INDUSTRIAL CARTS & DOLLIESMODELNUMBERDESCRIPTIONDECK SIZE(W x L)DECKHEIGHTUNIFORM STATICCAPACITY (LBS.)NET WT.(LBS.)LIST PRICEEACHFAT-1829 ALUMINUM 18" x 29" 6½" 330 23 $79.00DC-25/UPS/FC-100Steel Platform TrucksSolid, smooth steel deck is all welded and features structural reinforcement underneath for extrastrength. Includes one removable high-polished steel handle and rolls smoothly on two rigid and twoswivel casters. Series SPT comes standard with a floor lock and a durable blue powder coat finish.NewmodelECSPT-2448MODELNUMBERDECK SIZE(W x L)DECKHEIGHTUNIFORM STATICCAPACITY (LBS.)CASTERSIZE / TYPENET WT.(LBS.)LIST PRICEEACHSTEEL PLATFORM TRUCKSSPT-2448 24" x 48" 12¼" 3,600 8" x 2" GFN* 195 $277.00SPT-3060 30" x 60" 12¼" 3,600 8" x 2" GFN* 216 310.00SPT-3672 36" x 72" 12¼" 3,600 8" x 2" GFN* 250 351.00ECSPT-2448 24" x 48" 11 7 /8" 2,000 8" x 2" RUBBER 120 $171.00STEEL PLATFORM TRUCKS WITH SCALESPT-2448-SCL 24" x 48" 15" 3,600 8" x 2" GFN* 263 $1,170.00SPT-3060-SCL 30" x 60" 15" 3,600 8" x 2" GFN* 327 1,298.00SPT-3672-SCL 36" x 72" 15" 3,600 8" x 2" GFN* 379 1,550.00WRITING TABLEWT-TBL WRITING TABLE measures 10½"W x 13"H with a 1" lip 4 $38.00*GLASS-FILLED NYLONDC-25/FC-70series SPT-SCLNewseries SPTPneumatic Tire Steel Platform TrucksTravel over rough terrain with these steel platform trucks. Ideal for nurseries, farms, and warehouses.Units have 12" x 4" (2) swivel and (2) rigid casters. Durable blue powder coat finish standard.MODELNUMBERDECK SIZE(W x L)DECKHEIGHTUNIFORM STATICCAPACITY (LBS.)CASTERTYPENET WT.(LBS.)LIST PRICEEACHPNU-2448 24" x 48" 18¼" 1,500 PNEUMATIC 228 $483.00PNU-3060 30" x 60" 18¼" 1,500 PNEUMATIC 242 515.00PNU-3672 36" x 72" 18¼" 1,500 PNEUMATIC 276 557.00DC-25/FC-70Flat Bed CartHeavy duty steel platform cart provides long term service. Removable handle. Rolls on (4)5" swivel and (2) 8" poly rigid casters. Center caster provides great maneuverability. Ideal forindustrial, commercial and warehouse use.Newmodel WT-TBLNewseries PNUMODELNUMBEROVERALL SIZE(W x L x H)UNIFORM STATICCAPACITY (LBS.)CASTERSIZECASTERTYPENET WT.(LBS.)LIST PRICEEACHFLAT-C 30" x 60" x 11¾" 2,000 (4) 5" & (2) 8" POLY 125 $351.00DC-20/FC-100www.vestil.com Phone (800) 348-0868
INDUSTRIAL CARTS & DOLLIES208series VHPTseries VHPT/SHardwood Platform TrucksHardwood Platform Trucks are the economical solution to your material handling needs.Constructed of ⅞" thick hardwood, these platform trucks have a maximum capacity of 1,600pounds. Units roll smoothly on 6" x 2" mold-on-rubber casters, two rigid and two swivel. <strong>Casters</strong>and removable steel push handle are bolted on. Countersunk holes allow for a smooth deck surface.MODELNUMBERDECK SIZE(W x L)DECKHEIGHTUNIFORM STATICCAPACITY (LBS.)CASTERTYPENET WT.(LBS.)LIST PRICEEACHHARDWOOD DECKVHPT-2448* 24" x 48" 9½" 1,600 MOLD-ON-RUBBER 73 $172.00VHPT-2754* 27" x 54" 9½" 1,600 MOLD-ON-RUBBER 90 178.00VHPT-3060* 30" x 60" 9½" 1,600 MOLD-ON-RUBBER 98 193.00VHPT-3672 36" x 72" 9½" 1,600 MOLD-ON-RUBBER 167 224.00HARDWOOD DECK WITH STEEL FRAMEVHPT/S-2448 24" x 48" 9¾" 1,600 MOLD-ON-RUBBER 131 $271.00VHPT/S-2754 27" x 54" 9¾" 1,600 MOLD-ON-RUBBER 138 277.00VHPT/S-3060 30" x 60" 9¾" 1,600 MOLD-ON-RUBBER 160 285.00VHPT/S-3672 36" x 72" 9¾" 1,600 MOLD-ON-RUBBER 173 300.00HANDLE DESIGN MAY VARY FROM WHAT IS SHOWNDC-25/UPS*/FC-65(4) 8" x 2" PNEUMATIC CASTERS (CAPACITY 1,200 LBS.), MODEL VHPT-PNU $124.00 LISTmodel FPT-1624Plastic Platform Trucks with Fold Down HandleTough, high impact-resistant plastic construction is virtually maintenance free. Industrial gradeplastic deck will not rust, dent, chip, or discolor. A ½" lip runs along the perimeter of the deck tohelp retain cargo. The steel 36" high steel handle folds down for storage. Units roll smoothly ontwo rigid and two swivel poly-on-poly casters.model FPT-2133MODELNUMBERDECK SIZE(W x L)DECKHEIGHTUNIFORM STATICCAPACITY (LBS.)CASTERSIZENET WT.(LBS.)LIST PRICEEACHFPT-1624 15¾" x 23¾" 5¼" 250 4" x 1" 14 $89.00FPT-1830 18" x 27¾" 6½" 250 4" x 1¼" 32 120.00FPT-2133 21" x 33" 6½" 500 4" x 1¼" 36 131.00FPT-2537 25" x 37" 8" 500 5" x 1½" 41 246.00DC-20/UPSFold-Flat Plastic CartUnique cart folds completely flat for storage - telescopic handle folds down and casters fold up.Handle is adjustable to three different heights and features a cushion grip for comfort. Deckincludes non-slip rubber grips and hand holes for easy carrying. Carts roll on two rigid and twoswivel poly casters. Cart is constructed from plastic, steel and aluminum components.model PPT-2-41MODELNUMBERDECK SIZE(W x L)DECKHEIGHTUNIFORM STATICCAPACITY (LBS.)CASTERSIZENET WT.(LBS.)LIST PRICEEACHFF-FPT-1627 16¼" x 26¾" 7¼" 300 4" x 1" 16 $149.00DC-20/UPSHeavy-Duty Plastic Platform TrucksHeavy-duty plastic truck will not rust, discolor, or warp. Maintenance free and easy to clean. Honeycombconstruction is reinforced for longer life. Extra square steel tube underneath platform to reinforce deckstrength. Units roll smoothly on 6" x 2" polyurethane casters. The four wheel cart has two rigid and twoswivel casters, while the 6 wheel cart has 4 swivel and two rigid casters. Handle height 38".model PPT-3-62MODELNUMBERDECK SIZE(W x L)DECKHEIGHTUNIFORM STATICCAPACITY (LBS.)NUMBEROF CASTERSNUMBEROF HANDLESNET WT.(LBS.)LIST PRICEEACHPPT-2-41 30" x 60" 7½" 2,000 4 1 137 $316.00PPT-2-42 30" x 60" 7½" 2,000 4 2 141 338.00PPT-3-61 30" x 60" 7½" 3,000 6 1 148 $365.00PPT-3-62 30" x 60" 7½" 3,000 6 2 152 386.00DC-20/UPS/FC-70Versatile Platform Truck with Fold Down HandleTransport products quickly and easily in commercial or industrial applications with our VersatilePlatform Truck. Adjustable handle for pushing or pulling applications, folds down for storage.Will not rust, chip, or dent. Unit rolls smoothly on polyurethane casters.MODELNUMBERDECK SIZE(W x L x H)HANDLE HEIGHTPULLING/PUSHINGUNIFORM STATICCAPACITY (LBS.)CASTERSIZENET WT.(LBS.)LIST PRICEEACHPC-25 20½" x 31½" x 3½" 29 5 /8" / 33½" 250 3" 22 $98.00PC-60 20½" x 31½" x 6" 35 5 /8" / 38" 600 5" 25 119.00DC-25/UPSPhone (800) 348-0868www.vestil.com
Nesting Platform CartThis steel platform truck is nestable to save valuable warehouse storage space.Ideal for warehouses, shipping and receiving areas, lumber retailers, mailrooms, and other places where multiple platform trucks are needed. The firstcart requires a 30"W x 48"L floor space - each additional truck only adds 12"to the length. Durable powder coat finish.MODELNUMBERDECK SIZE(W x L)UNIFORM STATICCAPACITY (LBS.)CASTERSIZEMODELNUMBER STYLE WIDTH LENGTH HEIGHT THICKNESSCASTERTYPEQTY. PERCARTONNET WT.(LBS.)NET WT.(LBS.)LIST PRICEEACHNPCT 24" x 48" 1,500 6" x 2" RUBBER 140 $376.00DC-20/FC-70Corner and Surface Guards / BumpersReduce damage to walls, furniture and machinery from carts and platform trucks impact.Thermoplastic rubber construction with steel insert provides impact absorption. Easilyattaches to any steel, aluminum, wood, or plastic surface. Mounting hardware not included.LIST PRICECARTONTYPEA CB-1 CORNER 3 1 /8" 3 1 /8" 5/8" 5/8" 28 6 $53.20B CB-2 CORNER 3 15 /16" 3 15 /16" 1 /16" 1 /16" 16 3 60.80C CB-3 CORNER 4 1 /4" 4 1 /4" 1 /16" 1 /16" 12 4 51.60D CB-4 CORNER 4" 4" 1" 7/8" 20 6 54.00E SB-12 EDGE -- 12" 1 3 /16" 1 3 /16" 12 6 $63.60F EB-1 EDGE 1 /16" 240" 5/16" 5/32" 1 1 $62.00G RB-1 ROUND 3 1 /4" DIAMETER, 5 /16" BORE 16 3 $52.80I RB-2 ROUND 5" DIAMETER, 7 /16" BORE 16 3 56.00DC-35/UPSNestable Multi-Use Cart with BrakeThis cart rolls easily on its 6" polyurethane wheels. Brakes automatically lock whencart handle is not squeezed. Ideal in airports, malls, shipping and receiving areas.NewACEBDFG & I209model NPCTNewINDUSTRIAL CARTS & DOLLIESMODEL UNIFORM OVERALL SIZE CASTER CASTER NET WT. LIST PRICENUMBER CAPACITY (W x D x H) SIZE TYPE (POUNDS) EACHLUG-B 550 LBS. 26½" x 39½" x 39" 6" POLY 45 $327.00Nestable Wire CartsPortable lightweight mesh carts are nestable to minimize storage space. Steelconstruction with zinc-plated finish to resist rust. Wheels are non-marking poly-onpoly.Each cart ships fully assembled and ready to use.MODELNUMBEROVERALL SIZE(W x L x H)UNIFORM STATICCAPACITY (LBS.)CASTERTYPENET WT.(LBS.)DC-25/FC-70LIST PRICEEACHWIRE-S 17½" x 36 7 /16" x 40¾" 90 ALL SWIVEL 60 $208.00WIRE-L 28¾" x 59¼" x 36¾" 275 RIGID & SWIVEL 92 311.00WIRE-M 28¾" x 52" x 43¼" 90 ALL SWIVEL 59 201.00DC-25/FC-70Landscape, Nursery & Agriculture CartsTransport plants, flowers, trees, shrubs, rocks, and similar materials or parts with our full lineof Landscape Carts. These carts are rugged and easy to maneuver with their large pneumatictires. All carts have mesh sides and bottoms to allow dirt, small rocks, and water to drainthrough. Steel construction. All carts ship knockdown. Assembly required.NewNewmodel WIRE-Smodel WIRE-Lmodel LUG-Bmodel WIRE-Smodel WIRE-MFOLD-DOWN SIDESmodel LSC-2448-4SDTow Coupler is standardon LSC-2448-4SDLOW PROFILE TILT CARTmodel LSC-2448-TCPLATFORM CARTmodel LSC-2448-PTTWO SHELF CARTmodel LSC-2448-SCPLASTIC CARTmodel LSC-3052-PCWMODELNUMBERDESCRIPTIONDECK SIZE(W x L)HEIGHTOF SIDESDECKHEIGHTUNIFORM STATICCAPACITY (LBS.)WHEELSSIZENET WT.(LBS.)LIST PRICEEACHLSC-2448-4SD FOLD-DOWN SIDES 24" x 48" 12" 28¼" 1,000 13" x 4¾" 95 $152.00LSC-2448-TC LOW PROFILE TILT CART 24" x 48" 1" 3" 500 16" x 4" 72 129.00LSC-2448-PT PLATFORM CART 24" x 48" ½" 12¾" 500 10" x 3½" 55 120.00LSC-2448-SC TWO SHELF CART 24" x 48" 1¾" 33" 300 10" x 3½" 98 181.00LSC-3052-PCW PLASTIC CRATE CART 30" x 52" 8" 42" 1,000 13" x 5" 64 $139.00DC-25/UPS/FC-100www.vestil.com Phone (800) 348-0868
INDUSTRIAL CARTS & DOLLIES210NewMOLD-ON-RUBBERPOLY-ON-STEELSTEELGLASS-FILLED NYLONPHENOLICHARD RUBBERURETHANE SOLID FOAMMODELNUMBERMOLD-ON-RUBBERCASTERSIZEOVERALLHEIGHTIndustrial <strong>Casters</strong>TOP PLATESIZESTYLEUNIFORMCAPACITYNET WT.(LBS.)LIST PRICEEACHMR-4/2-S 4" x 2" 5½" 4" x 4½" SWIVEL 350 7 $18.10MR-4/2-R 4" x 2" 5½" 4" x 4½" RIGID 350 6 15.58MR-4/2-SWB 4" x 2" 5½" 4" x 4½" SWIVEL (WITH BRAKE) 350 6 21.60MR-6/2-S 6" x 2" 7½" 4" x 4½" SWIVEL 450 10 $20.41MR-6/2-R 6" x 2" 7½" 4" x 4½" RIGID 450 8 17.91MR-8/2-S 8" x 2" 9½" 4" x 4½" SWIVEL 500 12 $24.74MR-8/2-R 8" x 2" 9½" 4" x 4½" RIGID 500 10 22.20POLY-ON-STEELPU-5/2-S 5" x 2" 6½" 4" x 4½" SWIVEL 1200 8 $25.26PU-5/2-R 5" x 2" 6½" 4" x 4½" RIGID 1200 6 22.41PU-5/2-SWB 5" x 2" 6½" 4" x 4½" SWIVEL (WITH BRAKE) 1200 8 27.96PU-6/2-S 6" x 2" 7½" 4" x 4½" SWIVEL 1200 10 $28.20PU-6/2-R 6" x 2" 7½" 4" x 4½" RIGID 1200 10 25.26PU-8/2-S 8" x 2" 9½" 4" x 4½" SWIVEL 1250 14 $35.76PU-8/2-R 8" x 2" 9½" 4" x 4½" RIGID 1250 13 33.03PU-8/2-SWB 8" x 2" 9½" 4" x 4½" SWIVEL (WITH BRAKE) 1250 19 38.76STEELSS-5/2-S 5" x 2" 6½" 4" x 4½" SWIVEL 1000 10 $22.53SS-5/2-R 5" x 2" 6½" 4" x 4½" RIGID 1000 8 21.88SS-6/2-S 6" x 2" 7½" 4" x 4½" SWIVEL 1200 11 $24.83SS-6/2-R 6" x 2" 7½" 4" x 4½" RIGID 1200 10 22.21SS-8/2-S 8" x 2" 9½" 4" x 4½" SWIVEL 1250 14 40.67SS-8/2-R 8" x 2" 9½" 4" x 4½" RIGID 1250 13 28.30GLASS-FILLED NYLONGFN-4/2-S 4" x 2" 5½" 4" x 4½" SWIVEL 800 6 $31.53GFN-4/2-R 4" x 2" 5½" 4" x 4½" RIGID 800 5 24.84GFN-4/2-S-SWB 4" x 2" 5½" 4" x 4½" SWIVEL (WITH BRAKE) 800 6 38.55GFN-6/2-S 6" x 2" 7½" 4" x 4½" SWIVEL 1200 10 $35.26GFN-6/2-R 6" x 2" 7½" 4" x 4½" RIGID 1200 7 29.60GFN-8/2-S 8" x 2" 9½" 4" x 4½" SWIVEL 1250 10 $43.63GFN-8/2-R 8" x 2" 9½" 4" x 4½" RIGID 1250 7 36.42GFN-8/2-S-SWB 8" x 2" 9½" 4" x 4½" SWIVEL (WITH BRAKE) 1250 11 50.65GFN-8/2-S-4PSL 8" x 2" 9½" 4" x 4½" SWIVEL (W/4 POSITION LOCK) 1250 11 51.55GFN-8/2-S-TTL 8" x 2" 9½" 4" x 4½" SWIVEL (WITH TOTAL LOCK) 1250 13 67.95PHENOLICPH-F-8/3-S 8" x 3" 10½" 4½" x 6¼" SWIVEL 2500 28 $97.06PH-F-8/3-S-4PSL 8" x 3" 10½" 4½" x 6¼" SWIVEL (W/4 POSITION LOCK) 2500 29 100.93HARD RUBBERHR-3/1.25-S 3" x 1¼" 3¾" 3 1 /8" x 4 1 /8" SWIVEL 275 4 $7.23HR-4/1.25-S 4" x 1¼" 4½" 3 1 /8" x 4 1 /8" SWIVEL 300 4 8.58POLY-ON-POLYPP-4-1.25-S 4" x 1¼" 5½" 2¾" x 3¾" SWIVEL 300 3 $15.96PP-4-1.25-R 4" x 1¼" 5½" 2¾" x 3¾" RIGID 300 3 14.10PP-4-1.25-TTL 4" x 1¼" 5½" 2¾" x 3¾" SWIVEL (WITH TOTAL LOCK) 300 3 19.14URETHANE SOLID FOAM WHEELSUFBK-10-WHL-58 10" HIGH WITH 5/8" BEARING BLACK 300 4 $19.00UFRD-10-WHL-58 10" HIGH WITH 5/8" BEARING RED 300 4 19.00UFYL-10-WHL-58 10" HIGH WITH 5/8" BEARING YELLOW 300 4 19.00UFBL-10-WHL-58 10" HIGH WITH 5/8" BEARING BLUE 300 4 19.00DC-40/UPS/FC-70NewShock-Absorbing WheelsThe special design for Shock Absorption properties prevents wheels from bouncing like standard pneumaticwheels. Solid black molded rubber tread will never go flat. Steel hubs for maximum strength. Precision bearingswith ⅝" inside diameter.MODELNUMBER DIAMETER HUB STYLEUNIFORM STATICCAPACITY (POUNDS)NET WT.(POUNDS)LIST PRICEEACHSAW-10 10" OFFSET 330 6 $14.80SAW-16 16" SYMMETRIC 330 14 22.90DC-25/UPS/FC-100Phone (800) 348-0868www.vestil.com
Luggage Cart & Deluxe Platform TruckThis is a durable and attractive trucks built for function and style. Great for hotels, stores,and other commercial applications. Carpeted platform to prevent scratching of delicate items.Overall height 72". Units roll smoothly with poly-on-poly casters.MODELNUMBERDECK SIZE(W x L x H)UNIFORM STATICCAPACITY (LBS.)OVERALLHEIGHTNET WT.(LBS.)LIST PRICEEACHLUG-C 25¾" x 49" x 11¼" 600 72" 105 $834.00DELUXE-C 25¾" x 49½" x 8½" 600 36 3 /8" 65 438.00DC-25/FC-100Foldaway Hand TruckDesigned for everyday all purpose use. The handle and wheels fold up quickly and easily allowingyou to store it in tight spaces such as trunks of cars, under tables, or in closets.MODEL FOLDED SIZE SIZE UNFOLDED UNIFORM NET WT. LIST PRICE PRICE FORNUMBER (W x L x H)(W x L x H) CAPACITY (POUNDS) EACH TWO OR MOREFHC-250 19" x 2¾" x 26" 19" x 17" x 40½" 250 16 $101.00 $96.004 Wheel Pneumatic/Hard Rubber Hand TruckDC-25/UPS/FC-100The most versatile and easy moving hand truck available. The 4 wheel design, 2 pneumatic and 2 hardrubber, allows the operator to easily move and position awkward loads. The weight and size of the loaddetermine how much the hand truck rubber wheels are utilized. Ideal on rough floors and with awkwardheavy loads.model LUG-Cmodel DELUXE-CmodelFHC-250211INDUSTRIAL CARTS & DOLLIESMODELNOSE PLATEOVERALL SIZEUNIFORM NET WT. LIST PRICENUMBER(W x D)(W x D x H) CAPACITY (LBS) (POUNDS) EACHSPHT-500S-DW 22" x 7" 22" x 19" x 52" 600 75 $87.00Fiber/Nylon Hand TruckDC-25/UPS/FC-100Transport lightweight loads with this Fiber/Nylon Hand Truck. The unique construction is stronger thansteel, yet lighter and more cost effective than aluminum. The 10" x 3½" pneumatic wheels provide asmooth ride and years of durability. Uniform static capacity is 500 pounds.DUAL WHEELSmodel SPHT-500S-DWMODEL NOSE PLATE UNIFORM CAPACITY OVERALL SIZE NET WT. LIST PRICENUMBER(W x D)(POUNDS)(W x D x H) (POUNDS) EACHFNHT-500 14" x 7" 500 20" x 48" 26 $89.00Site Cart/TruckDC-25/UPS/FC-100This large cart with big wheels works great to move items around in rough terrain. Landscaping is easierdue to the oversized nose plate (holds scrub balls for transport). The wheels are 16" x 4½". Welded steelconstruction with powder coat yellow finish. Uniform static capacity is 600 lbs.MODELNUMBERNOSE PLATE(W x D)OVERALL SIZE(W x D x H)WHEELSTYLENET WT.(POUNDS)LIST PRICEEACHPRICE FORTWO OR MORESITE-C 24" x 13" 34¼" x 23" x 58" PNEUMATIC 70 $226.00 $215.00SITE-C-FF 24" x 13" 34¼" x 23" x 58" FOAM-FILLED 70 $237.00 $225.00Convertible Hand TrucksThe Aluminum & Steel Convertible HandTrucks are versatile wonders. These handtrucks can work in both the vertical andhorizontal positions. The task of transportingsmaller crates or long narrow boxes is nowsimplified. These carts roll smoothly on 10" x3½" rigid pneumatic and 4" x 1" swivel solidrubber casters. Ships knockdown.DC-25/FC-100FIBER/NYLONmodel FNHT-500CAHT-500 DSHT-500-PN CSHT-500SITE CART/TRUCKmodel SITE-CMODELNUMBER DESCRIPTIONNOSE PLATE(W x D)UNIFORMCAPACITY (LBS)OVERALL SIZE(W x D x H)NET WT.(POUNDS)LIST PRICEEACHPRICE FORTWO OR MOREHAND TRUCK CAHT-500 ALUMINUM 17¾" x 7¾" 500 20" x 20" x 54" 41 (UPS) $194.00 $184.00PLATFORM TRUCK 650 20" x 49" x 41"HAND TRUCK DSHT-500-PN STEEL 13¾" x 7½" 500 22" x 19" x 49" 30 (UPS) $102.00 $97.00PLATFORM TRUCK 500 22" x 42" x 36"HAND TRUCK CSHT-500 STEEL 10¼" x 7½" 330 19½" x 20" x 57¾" 69 $125.00 $119.00PLATFORM TRUCK 650 19½" x 42" x 37"DC-25/UPS/FC-100www.vestil.com Phone (800) 348-0868
INDUSTRIAL CARTS & DOLLIES212STEELmodel DHHT-500SALUMINUM NOSE PLATEmodel DHHT-500A-ANPALUMINUMmodel DHHT-500ASPHT-500SGalvanized FinishDual Handle Hand TrucksMaximize control for different loads with our Dual Handle Hand Trucks. These hand trucks can transportboxes or crates wherever they are needed. Transport loads smoothly and evenly over rough or uneven floors.Ships knockdown. Choose steel or aluminum, available with pneumatic or solid rubber wheels.STEEL DUAL HANDLE HAND TRUCKSMODELNUMBERNOSE PLATE(W x D)UNIFORMCAPACITYOVERALL SIZE(W x D x H)NET WT.(POUNDS)LIST PRICEEACHPRICE FORTWO OR MORE10" x 2" HARD RUBBER WHEELSDHHT-500S-HR 13¾" x 6½" 500 21" x 17½" x 44½" 36 $54.00 $51.0010" x 3½" PNEUMATIC WHEELSDHHT-500S 13¾" x 6½" 500 22½" x 17½" x 44½" 36 $48.00 $42.00ALUMINUM DUAL HANDLE HAND TRUCKSMODELNUMBERNOSE PLATE(W x D)UNIFORMCAPACITYOVERALL SIZE(W x D x H)NET WT.(POUNDS)LIST PRICEEACHDC-25/UPS/FC-100PRICE FORTWO OR MORE10" x 2" HARD RUBBER WHEELSDHHT-500A-HR* 14" x 8½" 300 20" x 20" x 49" 36 $115.00 $109.00DHHT-500A-ANP-HR* 18" x 7½" 300 20½" x 19" x 50" 34 122.00 116.0010" x 3½" PNEUMATIC WHEELSDHHT-500A* 14" x 8½" 300 20" x 20" x 49" 32 $109.00 $104.00DHHT-500A-ANP* 14" x 8½" 300 20½" x 19" x 50" 30 115.00 109.00*SUFFIX ANP NOTES ALUMINUM NOSE PLATE"P" Handle Hand TrucksSTEEL "P" HANDLE HAND TRUCKSMODELNOSE PLATENUMBER(W x D)UNIFORMCAPACITYOVERALL SIZE(W x D x H)NET WT.(POUNDS)LIST PRICEEACHDC-25/UPS/FC-100The "P" style hand trucks are ideal for transporting heavy and awkward loads. These trucks work well for theuser that needs to free up one hand. The "P" shaped handle makes the truck easy to steer and maneuver.PRICE FORTWO OR MORE10" x 2" HARD RUBBER WHEELSSPHT-500S-HR 13¾" x 7½" 500 21" x 18" x 52" 51 $53.00 $50.00SPHT-500S-HD-HR* 22" x 7" 600 22" x 19" x 52" 64 59.00 56.0010" x 3½" PNEUMATIC WHEELSSPHT-500S 13¾" x 7½" 500 21" x 18" x 52" 37 $47.00 $45.00SPHT-500S-HD* 22" x 7" 600 22" x 19" x 52" 35 53.00 50.0013" x 4" PNEUMATIC WHEELSSPHT-600S-IND 14" x 7" 600 22" x 22" x 52" 37 $58.00 $55.00*SHIPS TRUCK ONLYDC-25/UPS/FC-100SPHT-500S-HDAPHT-500APhone (800) 348-0868SPHT-600S-INDSPHT-500-HD-SSStainless SteelALUMINUM "P" HANDLE HAND TRUCKSMODELNUMBERNOSE PLATE(W x D)UNIFORMCAPACITYOVERALL SIZE(W x D x H)NET WT.(POUNDS)LIST PRICEEACHPRICE FORTWO OR MORE10" x 2" HARD RUBBER WHEELSAPHT-500A-HR 14" x 7½" 300 20" x 19" x 50½" 46 $111.00 $105.0010" x 3½" PNEUMATIC WHEELSAPHT-500A 14" x 7½" 300 20" x 19" x 50½" 32 $106.00 $101.00DC-25/UPS/FC-100STAINLESS STEEL "P" HANDLE HAND TRUCKSMODELNUMBERNOSE PLATE(W x D)UNIFORMCAPACITYOVERALL SIZE(W x D x H)NET WT.(POUNDS)LIST PRICEEACHPRICE FORTWO OR MORE10" x 2" HARD RUBBER WHEELSSPHT-500-HD-SS-HR* 22" x 7" 600 22" x 19" x 52" 66 $202.00 $192.00SPHT-500-SS-HR 13¾" x 7½" 500 21" x 18" x 52" 51 264.00 252.0010" x 3½" PNEUMATIC WHEELSSPHT-500-HD-SS 22" x 7" 600 22" x 19" x 52" 51 $193.00 $183.00SPHT-500-SS 13¾" x 7½" 500 21" x 18" x 52" 37 247.00 235.00*SHIPS TRUCK ONLYDC-25/UPS/FC-100AXLE AND WHEEL HUB NOT STAINLESS STEELMoving Pad with Velcro Straps for Hand TrucksMinimize scratches and damage to your belongings. Durable yet attractive pads fit most hand truckswith nose plate up to 14" wide. Two velcro wraps and one velcro nose wrap. Easy to install.MODELOVERALL SIZE NET WT. LIST PRICENUMBERDESCRIPTION(W x H) (POUNDS) EACHQPC-HT MOVING PAD FOR HAND TRUCK 16" x 55" 3 $21.90DC-25/UPSwww.vestil.com
Deluxe Aluminum Hand TrucksMaximize control for different types of loads. These hand trucks can transport boxes wherever they are needed. Transport loads smoothly andevenly over rough or uneven floors. 10" x 3½" pneumatic tires are standard on all hand trucks. 10" x 2½" industrial solid rubber tires alsoavailable. The convertible hand truck has 10" x 3½" pneumatic tires and 5" x 1¼" poly-on-steel swivel casters. Optional stair guides available.model ALUM-P model ALUM-H model ALUM-LOOP model ALUM-LOOP-H model ALUM-CONV model ALUM-CONV-BMODELNUMBERDESCRIPTIONNOSE PLATE(W x D)UNIFORMCAPACITY (LBS)OVERALL SIZE(W x D x H)NET WT.(POUNDS)LIST PRICEEACHPRICE FORTWO OR MOREALUM-P "P" HANDLE 14" x 7¼" 500 21" x 19" x 52½" 25 $132.00 $125.00ALUM-H DUAL HANDLE 14" x 7¼" 500 21" x 19" x 52" 25 133.00 126.00ALUM-LOOP LOOP HANDLE 18" x 9" 500 21" x 19" x 49" 27 137.00 130.00ALUM-LOOP-H LOOP HANDLE 18" x 9" 500 21" x 22" x 49" 28 146.00 139.00HAND TRUCK ALUM-CONV CONVERTIBLE 18" x 7¼" 500 20½" x 19" x 52" 40 $192.00 182.00PLATFORM TRUCK 750 47" x 20½" x 52"HAND TRUCK ALUM-CONV-B CONVERTIBLE 18" x 7¼" 500 20½" x 19" x 61½" 40 $211.00 $200.00PLATFORM TRUCK 750 57" x 20½" x 45½"10" x 2½" SOLID RUBBER WHEELS, model ALUM-HR, $5.00 LIST DC-25/UPS/FC-100OPTIONAL STAIR GUIDES, model ALUM-SG, $12.00 LISTFold-Down Aluminum Hand TruckLightweight aluminum hand truck folds-down for storage. Telescopic upright is adjusted withspring-loaded locking mechanism. Noseplate measures 11¾"W x 8¼"L. Dual handle design withplastic grips and knuckle guards. Rolls smoothly with two 10" diameter wheels. Wheel guards areincluded for use with oversize objects. Overall extended size 19¼"W x 18"L x 48½"H. Overallsize folded 19¼"W x 12"L x 33"H. Units ships fully assembled and ready to use.New213INDUSTRIAL CARTS & DOLLIESMODELNUMBERWHEELTYPEUNIFORM CAPACITY(POUNDS)NET WT.(POUNDS)LIST PRICEEACHDHHT-250A-FD-PN Pneumatic 250 14 $149.00DHHT-250A-FD-UR Red Flat-Free Urethane 250 14 179.00DHHT-250A-FD-UB Blue Flat-Free Urethane 250 14 179.00DHHT-250A-FD-UY Yellow Flat-Free Urethane 250 14 179.00DHHT-250A-FD-UBK Black Flat-Free Urethane 250 14 179.00High Back Aluminum Hand Truck with Push OutDC-25/UPS/FC-100The High Back Aluminum Hand Truck with Push Out will transport tall heavy loads weighing up to300 pounds from workstation to workstation. When the load has reached its final destination, the usersimply pushes down on the back plate with their foot and the plate on the front of the unit will slidethe load off. This feature reduces stress on the user's back. 8" x 1¾" semi-pneumatic wheels. Shipsknockdown.MODEL NOSE PLATE UNIFORM OVERALL SIZE NET WT. LIST PRICE PRICE FORNUMBER (W x D) CAPACITY (LBS) (W x D x H) (POUNDS) EACH TWO OR MOREHBST-500 13½" x 7¼" 300 18" x 17" x 55" 42 $136.00 $129.00Optional Urethane Wheels for Aluminum Hand TrucksDC-25/UPS/FC-100Solid urethane foam wheels will never run flat. Offset steel hub which is great for use on hand trucks.Precision bearings with ⅝" I.D. Diameter is 10". Sawtooth tread pattern.NewMODELNUMBERUNIFORM CAPACITY(POUNDS)NET WT.(POUNDS)LIST PRICEEACHCOLORUFBK-10-WHL-58 BLACK 300 4 $19.00UFRD-10-WHL-58 RED 300 4 19.00UFYL-10-WHL-58 YELLOW 300 4 19.00UFBL-10-WHL-58 BLUE 300 4 19.00DC-25/UPS/FC-100www.vestil.com Phone (800) 348-0868
INDUSTRIAL CARTS & DOLLIES214Aluminum Ergonomic Hand TruckHeavy-duty construction, yet lightweight aluminum design, provides superior control.This unit has knuckle guard handles, fold up nose plate, and curved back plate fortransporting cylindrical objects. Transporting down stairs or steep hills is no problemwith this unit. 10" x 3½" pneumatic wheels are standard. Ships knockdown.MODEL NOSE PLATE UNIFORM OVERALL SIZE NET WT. LIST PRICE PRICE FORNUMBER (W x D) CAPACITY (LBS) (W x D x H) (POUNDS) EACH TWO OR MOREAMPC-500 11" x 11" 350 21" x 25" x 57½" 26 $229.00 $218.00MODEL NOSE PLATE UNIFORM OVERALL SIZE NET WT. LIST PRICE PRICE FORNUMBER (W x D) CAPACITY (LBS) (W x D x H) (POUNDS) EACH TWO OR MORETWC-400 16¼" x 10¾" 400 23¾" x 22" x 50" 47 $105.00 $99.00Steel Stair Hand TruckDC-25/UPS/FC-100Four Wheel Multi-Position Steel Hand TruckGreat for uneven surfaces and outdoor work. 4" x 1¼" mold-on-rubberswivel casters are located at the back of the cart to stabilize loads andprevent tipping. The back casters will also transform the unit into ahorizontal platform truck. The unit will lie back horizontally, the handlewill release to a standard position, and now the cart is a platform truck.10" x 3½" pneumatic casters. Ships knockdown.DC-25/FC-100Unique design features tandem triple-wheel assemblies that work great when going up and down stairs.Wheel assembly smoothly rotates as you go up or down each step - eliminates the thud and bumpassociated with conventional two wheel hand trucks on stairs. Rear wheel assembly also allows handtruck to roll easily on 4 wheels while on flat surfaces. Single loop handle. Steel construction.MODELNOSE PLATE UNIFORM OVERALL SIZE NET WT. LIST PRICENUMBER(W x D) CAPACITY (LBS) (W x D x H) (POUNDS) EACHST-TRUCK-300 14½" x 14" 300 24" x 32" x 45¾" 38 $102.00DC-20/FC-100Stair Hand Truck (Four Handles)Quick and easy way for two people to transport a loaded hand truck up and down stairways or hills.Easy grip handles provide comfort to persons using hand truck. Removable handles conveniently storeon back of hand truck when not in use. Steel construction. 10" x 3½" pneumatic wheels.MODELNOSE PLATEUNIFORMOVERALL SIZE NET WT. LIST PRICENUMBER(W x D) CAPACITY (LBS)(W x D x H)(POUNDS) EACHHAND-TPE 13¾" x 6½" 500 21" x 17½" x 44½" 44 $123.00DC-25/UPS/FC-100Appliance CartsThis cart is ideal for moving large, bulky, heavyappliances, and awkward loads. A strap and tensionbar are included with this unit to hold the product inplace while transporting up or down stairways, hills,or uneven surfaces.The lightweight aluminum Appliance Cart is ideal formoving companies and delivery trucks.model APPL-500 series APPL-1200 model APPL-500-Y model APPL-500-AMODELNUMBER DESCRIPTION OPERATIONNOSE PLATE(W x D)UNIFORMCAPACITY (LBS.)OVERALL SIZE(W x D x H)CASTERSIZESTRAPLENGTHNET WT.(POUNDS)LIST PRICEEACHAPPL-500 STEEL TURN HANDLE 24" x 3¾" 500 24" x 12" x 59½" 8" x 2½" 9.91' 47 $109.00APPL-1200-60 STEEL RATCHET 24" x 5¼" 1,200 24" x 15" x 60" 8" x 2"* 10' 66 266.00APPL-1200-66 STEEL RATCHET 24" x 5¼" 1,200 24" x 15" x 66" 8" x 2"* 10' 70 273.00APPL-1200-72 STEEL RATCHET 24" x 5¼" 1,200 24" x 15" x 72" 8" x 2"* 10' 74 280.00APPL-500-Y STEEL RATCHET 24" x 4¾" 500 24" x 12" x 60" 6" x 2" 9.83' 47 109.00APPL-500-A ALUMINUM TURN HANDLE 24" x 3¾" 350 24½" x 13 x 60" 8" x 2½" 10' / 1' 34 187.00*ALSO INCLUDES (2) 3½" x 1½" MOLD-ON-RUBBER SWIVEL REAR CASTERSDC-25/FC-100Phone (800) 348-0868www.vestil.com
Dual Directional Hand TruckThe Dual Directional Hand Truck works great as a standard two-wheel hand truck or as apanel cart. This unit allows the user to transport loads forward/backward or left/right. You cantransport loads of crates or boxes, or, by turning the 8" x 2" mold-on-rubber wheels, you canturn the hand truck into a panel cart. Moving down narrow aisles or doorways is no longer aproblem with the adjustable wheels and easy steering. Steel construction. Painted finish.MODEL NOSE PLATE OVERALL SIZE UNIFORM NET WT. LIST PRICE PRICE FORNUMBER (W x D) (W x D x H) CAPACITY (LBS) (POUNDS) EACH TWO OR MOREDDT-500 14" x 8" 20" x 18" x 51" 600 55 $90.00 $85.00File Cabinet Hand TruckDC-25/UPS/FC-100Transport file cabinets safely and easily with the File Cabinet Hand Truck. This unique designallows a single person to move file cabinets from one destination to another. The spring-loadedstabilizing arm extends 33" and the back adjusts with tension screws up to 56". This allows theoperator to transport a variety cabinet sizes. Rolls on rubber wheels.MODEL RETRACTED SIZEEXTENDED SIZE UNIFORM NET WT. LIST PRICENUMBER (W x D x H)(W x D x H) CAPACITY (LBS.) (LBS.) EACHFCHT-34 19 9 /16" x 13¼" x 36¾" 19 9 /16" x 13¼" x 61¾" 600 34 $139.00DC-25/UPS/FC-100LEFT/RIGHTNew215FORWARDBACKWARDINDUSTRIAL CARTS & DOLLIESMulti-Function Luggage Cart/ChairThe Multi-Function Luggage Cart/Chair is constructed of both steel and plastic. Cart will handlelightweight uniform loads up to 65 pounds. The chair position holds up to 225 uniform pounds.This Cart/Chair is perfect for use at trade shows for transporting products, literature and smallparts. (2) 3" x ¾" hard rubber wheels are standard.MODEL FOLDED SIZE SEAT SIZE LUGGAGE CHAIR/LUGGAGE NET WT. LIST PRICENUMBER (W x L x H) (W x L x H) LIP (W x L) UNIFORM CAP. (LBS) (LBS.) EACHLC-803 13" x 26½" x 3½" 12" x 13" x 17" 9" x 12" 225 / 65 8 $31.00DC-25/UPSHigh End Platform TruckThis 1,300 pound capacity truck turns conveniently on (2) 8" poly-on-steel center wheels andis stabilized by (4) 4" poly swivel casters. The combined (6) caster design and narrow platformallows the operator to maneuver through doorways and aisles. Ideal for transporting and stockingsmall packages in warehouses, shopping malls, grocery stores, post offices, and schools. Steelplatform construction with steel uprights. Ships knockdown. Powder coat finish.MODELNUMBERDECK SIZE(W x L)OVERALLHEIGHTUNIFORMCAPACITYCASTERTYPENET WT.(LBS.)LIST PRICEEACHHIGH-T 16¼" x 60" 63" 1,300 POLY-ON-STEEL 149 $232.00DC-20/FC-100Panel CartThe Panel Cart is perfect for handling items such as sheets of paneling, plywood, doors, andlumber. A convenient, removable plastic basket is included for carrying smaller items and tools.Rollers are provided on one end for easy loading and unloading. Two rigid and two swivel 4" x 2"glass-filled nylon casters are included. Ships knockdown, assembly required. Steel construction.Powder coat blue finish. Overall height is 40½".MODELNUMBERDECK SIZE(W x L)UNIFORM STATICCAPACITY (LBS.)CASTERSIZECASTERTYPENET WT.(LBS.)LIST PRICEEACHPRCT 26" x 32" 2,000 4" x 2" GFN* 174 $333.00*GLASS-FILLED NYLONDC-20/FC-100Heavy-Duty Panel CartYou get double your money's worth with this Heavy-Duty Panel Cart. Not only is it the perfectpanel cart for transporting plywood, drywall, paneling, doors, etc.; it transforms into a platformtruck when you remove the 27" high support rails. This cart is powder coated blue and featuresa side retainer lip that keeps cargo on the deck. Two rigid and two swivel 5" x 2" poly-on-steelcasters included. Ships knockdown, assembly required. Overall height is 34".MODELNUMBERDECK SIZE(W x L)UNIFORM STATICCAPACITY (LBS.)CASTERSIZECASTERTYPENET WT.(LBS.)LIST PRICEEACHPRCT-HD 29½" x 36" 4,000 5" x 2" POLY-ON-STEEL 247 $553.00DC-20/FC-100www.vestil.com Phone (800) 348-0868
INDUSTRIAL CARTS & DOLLIES216NewNewVertical Panel CartHeavy duty steel platform cart supports multiple sizes of sheet material such as paneling,plywood, drywall or anything that is long, bulky and hard to handle. Ideal for lumberyards andhardware stores. Rolls on (4) 6" x 2" swivel poly-on-poly and (2) 8" x 2" rigid poly-on-polycasters. Center caster provides great maneuverability.MODELNUMBEROVERALL SIZE(W x L x H)UNIFORM STATICCAPACITY (LBS.)CASTERSIZECASTERTYPENET WT.(LBS.)LIST PRICEEACHPANEL-V 30" x 48" x 47" 2,000 (4) 6" & (2) 8" POLY 150 $361.00DC-20/FC-100Drywall & Panel CartVersatile cart for moving drywall, wood and other types of panel products. Maximum usablepanel height is 60". Portable on two rigid and two swivel casters. Welded steel construction withpainted finish. Knock-down design for lower shipping costs.MODELNUMBEROVERALL SIZE(W x L x H)UNIFORM STATICCAPACITY (LBS.)CASTERSIZECASTERTYPENET WT.(LBS.)LIST PRICEEACHPRCT-S-MR 23" x 48" x 48" 3,000 2" x 8" RUBBER 89 $375.00PRCT-S-GN 23" x 48" x 48" 3,000 2" x 8" GFN* 90 405.00*GLASS FILLED NYLONDC-20/FC-100Nestable Panel CartUnique design saves valuable space when stored. Overall size of eachcart is 72½"W x 32½"D x 39½"H. Each additional cart only requiresan additional 10½" of space. Features front storage area for handlingpaneling and sheet goods. Rear shelf is ideal for storing smallerproducts. Each unit includes (4) 5" x 1¼" poly-on-poly swivel casters;one with a total locking brake. Welded steel construction. Powder coatblue finish.NewMODELNUMBEROVERALL SIZE(W x D)UNIFORM STATICCAPACITY (LBS.)CASTERSIZECASTERTYPENET WT.(LBS.)LIST PRICEEACHPRCT-N 72½" x 32½" 2,000 5" x 1¼" POLY-ON-POLY 175 $380.00DC-20/FC-100Low Platform Panel CartsAll purpose large flat panel cart is constructed of steel. Features removable uprights and aneasy-roll entry roller on one end. Carts roll smoothly on (2) rigid and (2) swivel 8" x 2"phenolic casters with side brakes. Durable powder coat finish.NewLOW PROFILEDESIGNMODELNUMBERDECK SIZE(W x L)UNIFORM STATICCAPACITY (LBS.)PLATFORMHEIGHTNET WT.(LBS.)LIST PRICEEACHDWC-EL-36 12" x 39½" 2,000 5" 202 $474.00DWC-EL-48 12" x 51½" 2,000 5" 233 482.00DWC-EL-60 12" x 64" 2,000 5" 250 506.00DWC-EL-72 12" x 75½" 2,000 5" 270 518.00DC-20/FC-100Horizontal Panel CartThis two tier cart is great for handling panels and small items. The top deck is 30" high while thebottom dock is 8" off the ground. Four sliding posts can be locked in the up position to preventproducts from sliding. Rolls on (4) 2" x 6" swivel and (2) 2" x 8" rigid polyolfin casters. Centercaster provides great maneuverability.NewMODELNUMBEROVERALL BASE(W x L x H)OVERALL TOP(W x L x H)UNIFORM STATICCAPACITY (LBS.)NET WT.(LBS.)LIST PRICEEACHPANEL-H 29" x 42" x 10¾" 29" x 64" x 30½" 2,000 125 $411.00DC-20/FC-100Panel Truck with Storage TrayHeavy-duty panel truck with built-in storage tray for use with steel and panel goods. Great foruse in home centers, warehouses and similar locations. Deck opening will hold panels up to 11"thick. Steel deck includes a 2" high lip for holding steel goods. Overall height is 46" while thedeck height is 11". Steel construction with powder coat blue finish.MODELNUMBERPLATFORMSIZE (L x W)UNIFORM STATICCAPACITY (LBS.)CASTERTYPENET WT.(LBS.)LIST PRICEEACHPRCT-T-2448-MR 24" x 48" 1,000 MOLD-ON-RUBBER 155 $396.00PRCT-T-2448-PU 24" x 48" 1,500 POLY-ON-STEEL 165 375.00PRCT-T-3060-MR 30" x 60" 1,000 MOLD-ON-RUBBER 220 $473.00PRCT-T-3060-PU 30" x 60" 1,500 POLY-ON-STEEL 230 453.00DC-25/FC-100Phone (800) 348-0868www.vestil.com
Easy Move Panel CartThe High Handle Panel Cart is ergonomically designed for quickly and easily movingsheets of plywood or drywall down small aisles or through doorways. To prevent tipping,rollers have been added to the front and back of the unit for support. Includes (2) 10" x2½" and (2) 4" x 1½" solid rubber wheels standard. Sloped platform is 21" x 8½".MODELNUMBERUNIFORM STATICCAPACITY (LBS.)CASTERSIZECASTERTYPENET WT.(LBS.)LIST PRICEEACHHT-PANEL 750 10" x 2½" SOLID RUBBER 72 $176.00DC-20/FC-100Lightweight Door & Panel DollyLightweight door and panel dolly with auto-clamp feature. Unique design grips plate/slabwhen weight is added. Opening for use with maximum 2¼" thick plate/slab. Several differenttypes of wheels to choose from. Steel construction with painted blue finish.MODELNUMBERUNIFORM STATICCAPACITY (LBS.)CASTERSIZECASTERTYPENET WT.(LBS.)LIST PRICEEACHPLDL-LD-2-4PP 350 POLY-ON-POLY 9 $59.00DC-25/FC-100Heavy-Duty Plate/Slab DollyHeavy-duty plate/slab dolly with auto-clamp feature. Unique design grips plate/slab whenweight is added. Opening for use with maximum 4" thick plate/slab. Hand holds are greatfor carrying. Strap (not included) can also be hooked to hand holds. Several different types tochoose from. Steel construction with padded inside.New217INDUSTRIAL CARTS & DOLLIESMODELNUMBERUNIFORM STATICCAPACITY (LBS.)WHEELSIZECASTERTYPENET WT.(LBS.)LIST PRICEEACHPLDL-HD-4-8MR 1,200 8" RUBBER-ON-STEEL 32 $111.00PLDL-HD-4-8PS 1,500 8" POLY-ON-STEEL 32 122.00PLDL-HD-4-8GFN 1,500 8" GLASS-FILLED NYLON 30 113.00PLDL-HD-4-10PN 750 10" PNEUMATIC 26 $114.00PLDL-HD-4-10FF 500 10" FOAM-FILLED 26 121.00DC-25/FC-100A-Frame CartsIf you need to move bulky sheets of material such as drywall, plywood, paneling, or sheetsof metal, you need the heavy-duty A-Frame Cart. A convenient parts tray is includedbetween the A-frame uprights. Unit is easily secured for loading and unloading byusing the foot operated caster lock. Includes two rigid and two swivel casters. All steelconstruction with a durable powder coat finish. Ships knockdown, assembly required.NewMODELNUMBERDECK SIZE(W x L)UNIFORM STATICCAPACITY (LBS.)CASTERSIZECASTERTYPENET WT.(LBS.)LIST PRICEEACHAF-2436 24" x 36" 2,000 5" x 2" POLY-ON-STEEL 195 $340.00AF-2448 24" x 48" 2,000 5" x 2" POLY-ON-STEEL 215 352.00AF-3048 30" x 48" 2,000 5" x 2" POLY-ON-STEEL 230 367.00AF-3060 30" x 60" 2,000 5" x 2" POLY-ON-STEEL 258 384.00AF-3672 36" x 72" 2,000 5" x 2" POLY-ON-STEEL 287 426.00DC-20/FC-100A-Frame Storage CartThe portable A-Frame Cart with storage rack is ideal for storage and transporting pipe, conduitand other types of bar material. Storage arms extend 12" beyond frame with a clearance of 7¼"between arms. Unit rolls on (2) rigid and (2) swivel 5" poly-on-steel casters. Base is powder coatblue while the storage rack is zinc plated.NewMODELNUMBEROVERALL SIZE(W x L x H)UNIFORM STATICCAPACITY (LBS.)NET WT.(POUNDS)LIST PRICEEACHCASTERSAFSR-3672 36" X 72" X 66" 2,000 POLY-ON-STEEL 360 $505.00DC-20/FC-85Platform Cart with Versatile DividersThese innovative units are perfect for transporting a large array of products throughout your warehouse.The removable handles can be configured in a way to optimize space and convenience. Each unitincludes (5) sets of removable handles. Units roll smoothly on (4) 5" x 2" swivel phenolic and (2) 5" x2" rigid phenolic casters. <strong>Casters</strong> are mounted in "tilt" configuration for easy in-place turning.MODELNUMBEROVERALL SIZE(W x L x H)UNIFORM STATICCAPACITY (LBS.)NET WT.(LBS.)LIST PRICEEACHWHEELSVERSA-3060 30" x 60¼" x 9" 3,000 5" x 2" 250 $483.00VERSA-3672 36" x 72¼" x 9" 3,000 5" x 2" 360 583.00DC-20/FC-70www.vestil.com Phone (800) 348-0868
INDUSTRIAL CARTS & DOLLIES218TSCT-2ROL-1834-3ROL-3143-22nd shelf does not foldTSCT-3BROL-3143-1Multi-Tier Stock CartsThis unique cart makes it easy to organize and reach parts. Tilting shelves allow easy accessto baskets. Ideal for stocking parts in work stations. <strong>Casters</strong> allow the parts to be moved towherever they are needed. Shelves will tilt between 0° and 45°. Shelf angle is locked with ahand operated friction lock screw. Bottom shelf includes a 2" high lip on all four sides. Middleand top shelves include a 1½"H lip on all four sides. Bottom shelf height is 5½". Middle shelfheight is 33". Top shelf height is 56¼". Overall cart size (not including baskets) is 18¼"W x27½"L x 60"H (35"H for two-shelf models). Rolls smoothly on two rigid and two swivel 4" x2" casters. Steel construction. Powder coat finish.MODELNUMBERSHELF SIZE(W x L)UNIFORM STATICCAPACITY (LBS.)BASKET SIZES(W x L x H)NET WEIGHT(POUNDS)LIST PRICEEACHTSCT-2 16" x 24" 200 NONE 98 $195.00TSCT-3 16" x 24" 200 NONE 132 245.00TSCT-2B 16" x 24" 200 (1) 15½" x 23½" x 16½" 114 289.00(1) 15½" x 23½" x 12½"TSCT-3B 16" x 24" 300 (1) 15½" x 23½" x 16½" 150 415.00(1) 15½" x 23½" x 12½"(2) 11½" x 15½" x 8½"ADDITIONAL PLASTIC BINSTSCT-LGB 15½"W x 23½"L x 16½"H 9 $48.00TSCT-MDB 15½"W x 23½"L x 12½"H 7 42.00TSCT-SMB 11½"W x 15½"L x 8½"H 3 36.00DC-20/FC-100Folding Security TrucksThis portable cart is designed to safely hold your valuable equipment. All welded componentsand wire mesh walls combine to make this truck extremely tough and strong. Center shelf foldsdown to create (2) 32½"H areas or remains in the up position to provide full 66½"H area ofstorage. Special door locking latch and padlock clasp (padlock not included) for securing storedcontents. Rolls on 6" x 2" molded-on rubber casters, 2 rigid and 2 swivel swivel. The overall sizeis 27"W x 44"L x 76½"H. The usable size with shelf down is 24½"D x 42½"W x 32½"H andwith the shelf up 24"D x 41½"W x 66½"H. Unit will fold down to 51"D x 76"W x 12"H forstorage or transport.MODELNUMBEROVERALL SIZE(W x D x H)UNIFORM STATICCAPACITY (LBS.)NET WT.(POUNDS)LIST PRICEEACHFINISHFST-2744-2 44" X 27" X 76½" 2,000 PAINTED GREY 240 $687.00DC-20/FC-85ROL-55Foldable/Nestable Roller ContainersProvides convenient portability between work cells orfor delivery or distribution of goods. All welded steelconstruction. Units roll smoothly on casters. To figureindividual uniform shelf capacity divide the number ofshelves by total capacity.NewROL-80 ROL-85 ROL-95ROL-185 ROL-120MODELNUMBERNUMBER OFSHELVESOVERALL SIZE(W x D x H)MESHOPENINGSTOTAL UNIFORMCAPACITYNET WT.(LBS.)LIST PRICEEACHCASTERSBLUE PAINTED FINISHROL-1834-3 3 34" X 18" X 59" 3¼" x 11" 990 lbs. 1½" x 5" (4) swivel w/brakes 70 $164.00ROL-3143-2 2 40" X 28" X 68" 13 3 /8" x 6¼" 1,100 lbs. 1¼" x 5" (2) swivel w/brakes & (2) rigid 160 415.00ROL-3143-1 1 43¼" X 31¾" X 66¾" 13 3 /8" x 6¼" 880 lbs. 1¼" x 5" (2) swivel w/brakes & (2) rigid 125 348.00GALVANIZED FINISHROL-55 1 26¼" X 23 3 /8" X 35 5 /8" 2" x 1 7 /8" 660 lbs. 1¼" x 5" (2) swivel w/brakes & (2) rigid 55 $152.00ROL-80 1 28¼" X 31½" X 66" 12½" x 4" 660 lbs. 1½" x 5" (2) swivel w/brakes & (2) rigid 80 205.00ROL-85 2 27½" X 32" X 68¼" 18½" x 4 1 /8" 660 lbs. 1¼" x 5" (2) swivel w/brakes & (2) rigid 84 225.00ROL-95 1 26 3 /8" X 32" X 59" 15¾" x 3¾" 660 lbs. 1½" x 5" (2) swivel w/brakes & (2) rigid 94 257.00ROL-185 1 43½" X 30" X 69" 2½" x 1½" 660 lbs. 1½" x 6" (2) swivel w/brakes & (2) rigid 185 445.00ROL-120 1 24" X 32¼" X 66" 1¾" x 1¾" 880 lbs. 1¾" x 5" (2) swivel w/brakes & (2) rigid 117 377.00Phone (800) 348-0868DC-25/FC-85www.vestil.com
Portable Carpet Dolly & DispenserPortable Carpet Dollies allows for easy movement of long and heavy rolls of carpeting.V-groove platform holds carpet rolls securely in place.Carpet Dispenser minimize lifting and pulling. Slide carpet onto rollers. Carpet unrollsas needed. Retractable legs stabilize cart.Each unit includes two 16" diameter by 4" wide wheels. Uniform capacity 500 lbs. Weldedsteel construction with powder coat blue finish.MODELNUMBERMODELNUMBEROVERALL SIZE(W x L x H)OVERALL(W x L x H)PLATFORMSIZE (W x L)UNIFORMTONGUE-WEIGHT LOADFROM LIFT (LBS.)WHEELSTYLEUNIFORMMAXIMUM PULLWEIGHT (LBS.)NET WT.(LBS.)NET WT.(LBS.)LIST PRICEEACHCARPET-45 26" x 60" x 20" 16" x 60" FULLY PNEUMATIC 45 $193.00CARPET-45-FF 26" x 60" x 20" 16" x 60" FOAM-FILLED 45 203.00CARPET-D 26" x 60" x 20" 16" x 60" FULLY PNEUMATIC 95 $388.00CARPET-D-FF 26" x 60" x 20" 16" x 60" FOAM-FILLED 95 398.00DC-25/FC-70Gas Powered Trailer MoverGas Power Trailer Mover is compact in size and easy to use. They are highly maneuverable,making them ideal for turning in tight spaces (not recommended for use on an incline or slope).Six horsepower gasoline engine combined with a hydrostatic transmission provides variablespeed control and generous low speed torque for precise positioning. Rugged front foam filledtires with aggressive tread pattern provide service on unpaved surfaces. Engine powered lifteliminates hand jacking. Three size ball hitch quickly converts to common sizes. Ball sizes;1⅞", 2" and 2 5 /16". Overall size with handle up is 51"W x 66"L x 40"H.MODELNUMBERBALLSERVICEUNIFORM PULLCAPACITYUNIFORM TONGUELIFT CAPACITYNET WT.(LBS.)LIST PRICEEACHPTM-GPT 17" to 27" 12,000 lbs. 1,000 lbs. 600 $5,541.00DC-25/FC-100Power Move MastersPower Move Masters are compact in size and easy to use. They are highly maneuverable,making them ideal for turning in tight spaces (not recommended for use on an incline orslope). DC powered for smooth, quiet operation with variable speed control for generouslow speed torque and precise positioning. Built in battery charger for quick recovery. Mostmodels feature robust hydraulics to ensure superb push or pull traction. In addition, theirergonomic design provides stability and simple control. A variety of hitch attachments alongwith other options are available, contact factory. The tire size is 9½" x 18". The hydraulic liftis standard on models PMM-3000 and PMM-3000-15, 9" to 29". Optional hydraulic liftoption available on model PMM-700 and PMM-1000. Three point mounting configurationsallow for adjustable service range.LIST PRICEEACHPMM-700 33" x 49" x 40" 700 5,000 385 $5,719.00PMM-1000 38" x 53" x 38" 1,000 12,000 595 6,472.00PMM-3000 36" x 78" x 43" 3,000 40,000 1550 11,952.00PMM-3000-15 36" x 96" x 43" 3,000/1,500* 40,000 2150 14,564.00PMM-HYD-LIFT HYDRAULIC LIFT OPTION, 9" TO 26" ADJUSTABLE 150 $1,122.00*3,000 lbs. CENTER / 1,500 lbs. FRONT LIFT DC-20/FC-100Traction-Drive Carts24V DC POWERED STANDARDDC POWERED STANDARDUnique carts feature built-in traction-drive system for easy transportability. Ideal forapplications including mail rooms, hospitals, supermarkets, hotels and warehouses. Features450W electric drive motor with two 70Ah batteries for power. 110V AC internal batterycharger is included. Variable throttle speed control for precise maneuvering and positioningis located in the handle. Units roll smoothly on (2) 8" rubber front wheels and (2) 10"pneumatic rear wheels. Walking speed is 0-3.7 mph when unloaded and 0-2.5 mph whenloaded. Speed control is conveniently located in handle. Handle pivots back towardsoperator and includes horn and emergency stop. Maximum incline is 7 degrees. Each shelfincludes a non-slip rubber top surface. Includes on-board charger.model CARPET-45Newmodel CARPET-DNewDVD or VIDEOAVAILABLEmodel PMM-700model PMM-3000DVD or VIDEOAVAILABLE219model PMM-1000shown withHydraulic Lift Optionmodel PMM-3000-15DVD or VIDEOAVAILABLEINDUSTRIAL CARTS & DOLLIESMODELNUMBERDECK SIZE(W x L x H)SHELFHEIGHTUNIFORM BOTTOMSHELF CAPACITYUNIFORM TOPSHELF CAPACITYNET WT.(LBS.)LIST PRICEEACHE-CART 26" x 46" x 14½" 13¾" 500 lbs. -- 338 $1,609.00E-CART-2 26" x 46" x 41" 13¾" / 41" 500 lbs. 220 lbs. 364 1,734.00DC-25/FC-100www.vestil.com Phone (800) 348-0868
INDUSTRIAL CARTS & DOLLIES220NewNewPowered Platform TruckMODELNUMBERDECK SIZE(W x L)DECKHEIGHTOVERALL SIZE(W x L x H)UNIFORM STATICCAPACITY (LBS.)NET WT.(LBS.)LIST PRICEEACHVPPT 36" x 43" 12 3 /8" 36¼" x 50" x 42½ 1,000 245 $1,780.00DC-25/FC-100Electric <strong>Material</strong> <strong>Handling</strong> CartDC POWERED STANDARDHigh quality battery-powered truck ideal for transporting all sorts of loads in warehouses, hospitalsand factories. Red throttle controls infinite speed in forward or reverse, and unit stops whenthrottle is released. Emergency reverse belly switch; when actuated, instantly reverses directionand moves the unit forward away from the operator until the switch is released. Stable 4 wheelplatform. Two 10" pneumatic tires and two 5" poly on steel swivel wheels provide a high degreeof maneuverability. Features an anti-slip rugged deck surface. Maximum speed is 1.8 mph loadedand 2.3 mph unloaded. This truck comes with 2, 12V, 40Ah maintenance free batteries, 70ACurtis controller, 370W drive motor, integral battery charger, and battery level gauge. 3-4 houroperation at full charge - 6 hours when used intermittently. Battery recharge time is 8-8.5 hours.DC POWERED STANDARDTransport a large array of products throughout your warehouse efficiently with this motorizedcart. Features a heavy duty 650 watt motor, (2) 50 amp batteries, 5 amp-hour on-board batterycharger, LED battery level gauge, horn/power kill button, intelligent electronic braking, variablespeed dial, and a Penny & Giles motor controller. Unit operates smoothly with fingertipforward and reverse levers and 10" foam filled drive tires. Pinpoint turning is accurate with themid axle drive feature. Maximum speed is 4.8 mph.NewMODELNUMBERDECK SIZE(W x L)DECKHEIGHTUNIFORM STATICCAPACITY (LBS.)NET WT.(LBS.)LIST PRICEEACHEMHC-2460 24" x 60" 11 2 /3" 1,100 320 $2,010.00DC-25/FC-100Off-Road Traction Drive Powered Cart24V DC POWERED STANDARDIdeal on the farm or in the factory. Features a robust 24V DC 600 watt drive motor, (2) 12 voltbatteries with charger and level gauge, low/high speed, LED headlights, wire storage, basket, andforward/reverse. Low speed is 1½ m.p.h. High speed is 1⅞ m.p.h. (reverse is 1½ m.p.h.). Unitruns for approximately 4 hours before it needs charged. Climb a 13° incline easily with 400 lbs.capacity or less. Side guards are removable. Overall size 33½"W x 72"L x 37¾"H.MODELNUMBERDECK SIZE(W x L x H)UNIFORM STATICCAPACITY (LBS.)OROAD-400 31½" x 52½" x 15¾" 500 rough600 smoothIndustrial BicyclesWHEEL SIZE3½" x 11" rear6" x 14" frontNET WT. LIST PRICE(LBS.) EACH323 $2,190.00DC-25/FC-100A quick, easy and safe way to move around large facilities. Built with rider friendly features and theability to handle various loads while moving through a facility with ease and efficiency. A three wheeldesign includes hand brakes for sure stopping. Adjustable height seat for different sized people.Large payload / cargo area included. Additional options available, contact factory.MADE IN THE USAMODELNUMBEROVERALL SIZE(W x L x H)UNIFORM STATICCAPACITY (LBS.)NET WT.(LBS.)LIST PRICEEACHCOLORSIBIKE-3-DC-R 29" x 70" x 43" 250 RED 65 $506.00IBIKE-3-DC-B 29" x 70" x 43" 250 BLUE 65 506.00IBIKE-3-DC-G 29" x 70" x 43" 250 GREEN 65 506.00IBIKE-3-DC-P 29" x 70" x 43" 250 PURPLE 65 506.00IBIKE-3-DCHH-Y 29" x 70" x 43" 350 YELLOW 81 $620.00IBIKE-3-HH-Y 33½" x 79" x 45" 500 YELLOW 106 $1,135.00IBIKE-3-HH-BL 33½" x 79" x 45" 500 BLACK 106 1,135.00DC-20/UPS/FC-125Manual Scooter with BrakeGet where you need to be quickly and safely with our manually powered Scooter. Sturdy foot restincludes a manually operated rear brake that safely stops the Scooter at your destination. Fixedheight handle bars control front wheel maneuvering through narrow aisles and doorways. A 14"long x 18" wide front platform holds up to 55 uniform lbs., ideal for crates, boxes, and othersmall loads. Rolls on high performance 3" polyurethane wheels. Ships knockdown. Optionalbolt-on basket available separately. Capacity of the basket is 15 lbs.Phone (800) 348-0868MODELNUMBEROVERALLSIZE (W x L)PLATFORMSIZE (W x L)UNIFORM STATICCAPACITY (LBS.)NET WT.(LBS.)LIST PRICEEACHSCOOT-500 18" x 36" 18" x 14" 250 30 $115.00SCOOT-BSK OPTIONAL BOLT-ON WIRE BASKET 4 30.00DC-20/UPS/FC-85www.vestil.com
Aluminum Pallet DolliesDesigned to transport pallets with ease. All welded aluminum construction is durable yet lightweight.Features heavy-duty 3" wide x 3½" diameter phenolic rollers for easy portability. Choose from eithertilt or non-tilt styles. Tilt style allows for easier turning than non-tilt style. Optional loops/handle anda center support crossbar are available. Dolly height is 4¼".MODELNUMBEROVERALL SIZE(W x L)UNIFORM STATICCAPACITY (LBS.)NUMBER OFROLLERSDECKHEIGHTNET WT.(LBS.)LIST PRICEEACHDOL-3636-6NT 36" x 36" 4,000 6 NON-TILT 38 UPS $242.00DOL-3642-6NT 36" x 42" 4,000 6 NON-TILT 41 UPS 250.00DOL-3648-6NT 36" x 48" 4,000 6 NON-TILT 42 UPS 255.00DOL-4048-6NT 40" x 48" 4,000 6 NON-TILT 43 257.00DOL-4242-6NT 42" x 42" 4,000 6 NON-TILT 44 267.00DOL-4248-6NT 42" x 48" 4,000 6 NON-TILT 44 270.00DOL-4848-6NT 48" x 48" 4,000 6 NON-TILT 46 272.00DOL-4848-8NT 48" x 48" 6,000 8 NON-TILT 50 326.00DOL-4848-10NT 48" x 48" 8,000 10 NON-TILT 50 363.00DOL-3636-6T 36" x 36" 4,000 6 TILT 38 UPS $242.00DOL-3642-6T 36" x 42" 4,000 6 TILT 41 UPS 250.00DOL-3648-6T 36" x 48" 4,000 6 TILT 42 UPS 255.00DOL-4048-6T 40" x 48" 4,000 6 TILT 43 257.00DOL-4242-6T 42" x 42" 4,000 6 TILT 44 267.00DOL-4248-6T 42" x 48" 4,000 6 TILT 44 270.00DOL-4848-6T 48" x 48" 4,000 6 TILT 45 272.00DOL-3636-8T 36" x 36" 6,000 8 TILT 44 UPS $297.00DOL-3642-8T 36" x 42" 6,000 8 TILT 48 UPS 302.00DOL-3648-8T 36" x 48" 6,000 8 TILT 49 UPS 312.00DOL-4048-8T 40" x 48" 6,000 8 TILT 50 316.00DOL-4242-8T 42" x 42" 6,000 8 TILT 52 320.00DOL-4848-8T 48" x 48" 6,000 8 TILT 53 326.00DOL-3636-10T 36" x 36" 8,000 10 TILT 48 UPS $331.00DOL-3642-10T 36" x 42" 8,000 10 TILT 52 UPS 337.00DOL-3648-10T 36" x 48" 8,000 10 TILT 53 UPS 342.00DOL-4048-10T 40" x 48" 8,000 10 TILT 54 347.00DOL-4242-10T 42" x 42" 8,000 10 TILT 55 350.00DOL-4848-10T 48" x 48" 8,000 10 TILT 56 363.00OPTIONSDOL-FL-LK FLOOR LOCK (FACTORY INSTALLED) 8 $145.00DOL-HDL LOOPS AND HANDLE 3 58.00DOL-CB CENTER SUPPORT CROSS BAR (FACTORY INSTALLED) 10 17.00DC-20/UPS/FC-100Aluminum Channel DolliesThese versatile dollies are manufactured from aluminum for a strong yet lightweight design.Aluminum construction will not rust and never needs painting. Each dolly includes four swivelcasters for maximum maneuverability. Order with optional Pull Strap or Hook for added operatorconvenience - see page 221.Shown with pallet(pallet sold separately)900 LBS.CAPACITY UNITS221Floor LockFactory installed.Model DOL-FL-LK,Loops and Handle workgreat for pulling. Includesone loop at each end ofdolly and one handle.Factory installed.Model DOL-HDLA center support crossbaris available as an extrasupport on smaller loads.Factory installed.Model DOL-CB,INDUSTRIAL CARTS & DOLLIESMODELNUMBEROVERALLSIZE (W x L)UNIFORMCAPACITYDECKHEIGHTCASTERSIZECASTERTYPENET WT.(LBS.)LIST PRICEEACHACP-1824-9 18" x 24" 900 6" 3" x 1¼" HARD RUBBER 14 $119.00ACP-2130-9 21" x 30" 900 6" 3" x 1¼" HARD RUBBER 16 123.00ACP-2136-20 21" x 36" 2,000 10 5 /8" 5" x 2" POLY-ON-STEEL 43 $249.00ACP-2436-20 24" x 36" 2,000 10 5 /8" 5" x 2" POLY-ON-STEEL 45 252.00ACP-2442-20 24" x 42" 2,000 10 5 /8" 5" x 2" POLY-ON-STEEL 47 262.00ACP-4042-20 40" x 42" 2,000 10 5 /8" 5" x 2" POLY-ON-STEEL 53 293.00DC-20/UPS/FC-100Cast Aluminum DolliesThese Aluminum Dollies are easy to use and provide efficient moving time. Box-like frames haveintegral sides and deeply fluted tops. Dollies include 3½" diameter x 3" wide phenolic rollers. Theyare excellent for moving heavy crates and machinery. Note: Except when used individually, cornersshould be turned by lifting the load and rotating each dolly individually. Overall height 4¼".2,000 LBS.CAPACITY UNITSMODELNUMBERDECK SIZE(W x L)UNIFORM STATICCAPACITY (LBS.)NUMBEROF ROLLERSNET WT.POUNDSLIST PRICEEACHVPRDO-1 4½" x 4½" 1,500 1 5 $46.00VPRDO-2 4¾" x 8½" 3,000 2 8 65.00VPRDO-4 8½" x 8½" 6,000 4 13 77.00VPRDO-6 8½" x 12½" 9,000 6 20 149.00VPRDO-6T 8½" x 12½" 3,000 6 20 149.00SUFFIX "6T" IS A TILTING DESIGNDC-25/UPS/FC-100www.vestil.com Phone (800) 348-0868
INDUSTRIAL CARTS & DOLLIES222*Shown withoptional brakes.series VPLDO/Aseries VPLDO/SAluminum and Steel Plate DolliesPlate Dollies are manufactured with a 3/8" thick raised diamond pattern aluminum or steeltread plate. A smooth deck is available upon request. Dollies are approximately 6" high andinclude 4" x 2" mold-on-rubber casters, 2 rigid and 2 swivel with brake. <strong>Casters</strong> are bolted ontothe aluminum dollies and welded onto the steel dollies. Optional pull strap (for aluminumdollies) or hook is available separately.MODELNUMBERDECK SIZE(W x L)UNIFORM STATICCAPACITY (LBS.)CASTERSIZEDECKHEIGHTNET WT.(LBS.)LIST PRICEEACHALUMINUM PLATE DOLLIESVPLDO/A-1418 14" x 18" 1,200 4" x 2" 6" 31 $148.00VPLDO/A-1824 18" x 24" 1,200 4" x 2" 6" 40 180.00VPLDO/A-2430 24" x 30" 1,200 4" x 2" 6" 52 224.00STEEL PLATE DOLLIESVPLDO/S-1418 14" x 18" 1,200 4" x 2" 6" 58 $121.00VPLDO/S-1824 18" x 24" 1,200 4" x 2" 6" 80 148.00VPLDO/S-2430 24" x 30" 1,200 4" x 2" 6" 130 192.00OPTIONAL (4) SWIVEL CASTER WITH LOCKS, MODEL VPLDO/S-AS, LIST $9.00DC-25/UPS/FC-100/70Adjustable Tote DolliesUnique design is adjustable in both width and length for use with different size totes. Easy to adjustby loosening the screws and sliding each side in or out. Each unit includes four swivel casters (onewith brake) that are attached with caster pads. Overall size is 3" greater than the usable size. Weldedsteel construction for maximum strength with powder coat blue finish. Totes sold separately.MODELNUMBERMINIMUMUSABLE SIZEMAXIMUMUSABLE SIZEUNIFORM STATICCAPACITY (LBS.)CASTERSIZE / STYLENET WT.(LBS.)LIST PRICEEACHATD-1622-4 16"W x 22"L 24"W x 34"L 2,000 4" GFN* 38 $185.00ATD-1622-6 16"W x 22"L 24"W x 34"L 3,000 6" GFN* 42 202.00*GLASS-FILLED NYLONDC-25/UPS/FC-70Steel Pro-MoversMove pallets without a fork truck or pallet jack. Designed for holding standard wooden pallets.Transport pallets and skids with these open frame all welded steel dollies. 2,000 lb. capacity unitsroll smoothly on four swivel mold-on-rubber casters. 4,000 lb. capacity units feature glass-fillednylonswivel casters. <strong>Casters</strong> are bolted to each dolly. Blue powder coat finish.MODELNUMBERDECK SIZE(W x L)DECKHEIGHTUNIFORM STATICCAPACITY (LBS.)CASTERSIZENET WT.(LBS.)LIST PRICEEACHPRM-4048 40" x 48" 8 7 /8" 2,000 6" x 2" 71 $276.00PRM-4248 42" x 48" 8 7 /8" 2,000 6" x 2" 85 292.00PRM-4848 48" x 48" 8 7 /8" 2,000 6" x 2" 95 307.00PRM-4048-8 40" x 48" 11" 4,000 8" x 2" 71 $296.00PRM-4248-8 42" x 48" 11" 4,000 8" x 2" 85 312.00PRM-4848-8 48" x 48" 11" 4,000 8" x 2" 95 327.00DC-20/FC-50Lo-Profile Floor Hugger DollyThis lo-profile steel dolly allows for loading and unloading of materials at floor level. The (4)3" x 1¼" hard rubber swivel casters allow for easy portability. The handles allow for convenientpositioning and transporting. The overall height is 4⅜".MODELNUMBEROVERALL SIZE(W x L x H)USABLE SIZE(W x L x H)UNIFORM STATICCAPACITY (LBS.)NET WT.(LBS.)LIST PRICEEACHLFH-55 31" x 22" x 4 3 /8" 21" x 21½" x 2" 840 66 $204.00DC-25/UPS/FC-70Nose Plate DolliesThese lever action dollies are excellent for moving file cabinets, appliances, drums, crates andcartons. Heavy-duty steel dolly is designed to be counterbalanced so you do not need to lift theentire weight of the load. Simply tilt the load and slide dolly under. Complete product is vinylcovered to help eliminate scrapes and scratches. Equipped with hard rubber wheels (2) 3" x 1½"axle mounted and (2) 2½" x 1¼" swivel casters.MODELNUMBERDECK SIZE(W x L)DECKHEIGHTUNIFORM STATICCAPACITY (LBS.)NET WT.(LBS.)LIST PRICEEACHNPL-21 15" x 32" 4" 600 25 $139.00NPL-24 18" x 32" 4" 600 29 146.00DC-20/UPS/FC-70Phone (800) 348-0868www.vestil.com
Hardwood DolliesOpen Deck, Solid Deck, Vinyl Covered, Carpet End, Rubber EndTransport boxes, crates, or supplies with these rugged dollies. Units maneuver on four swivelhard rubber casters. Assembly required. Optional Pull Strap or Hook available.HARDWOOD DOLLY ACCESSORIESMODELNUMBERDESCRIPTIONNET WT.(LBS.)LIST PRICEEACHSTRAP-8 4 FOOT LONG NYLON LOOP PULL STRAP 1 $9.60HOOK-8 4 FOOT LONG METAL HOOK 3 32.00HARDWOOD DOLLIES SOLD SEPARATELYDC-25/UPS/FC-70OPEN DECK HARDWOOD DOLLIESMODEL DECK SIZENUMBER (W x L)DECKHEIGHTUNIFORM STATICCAPACITY (LBS.)CASTERSIZENET WT.(LBS.)LIST PRICEEACHHDOF-1624-9 16" x 24" 5½" 900 3" x 1¼" 19 $49.00HDOF-2436-9 24" x 36" 5½" 900 3" x 1¼" 24 53.00HDOF-1624-12 16" x 24" 6¾" 1,200 4" x 1¼" 20 $55.00HDOF-2436-12 24" x 36" 6¾" 1,200 4" x 1¼" 26 57.00DC-25/UPS/FC-65/70SOLID DECK HARDWOOD DOLLIESMODEL DECK SIZENUMBER (W x L)DECKHEIGHTUNIFORM STATICCAPACITY (LBS.)CASTERSIZENET WT.(LBS.)LIST PRICEEACHHDOS-1624-9 16" x 24" 5½" 900 3" x 1¼" 24 $50.00HDOS-2436-9 24" x 36" 5½" 900 3" x 1¼" 35 57.00HDOS-1624-12 16" x 24" 6¾" 1,200 4" x 1¼" 31 $56.10HDOS-2436-12 24" x 36" 6¾" 1,200 4" x 1¼" 42 60.00DC-25/UPS/FC-65/70model STRAP-8series HDOFseries HDOS223model HOOK-8INDUSTRIAL CARTS & DOLLIESVINYL COVERED HARDWOOD DOLLIESMODELNUMBERDECK SIZE(W x L)DECKHEIGHTUNIFORM STATICCAPACITY (LBS.)CASTERSIZENET WT.(LBS.)LIST PRICEEACHFDOL-1624-9 16" x 24" 5¾" 900 3" x 1¼" 20 $72.00FDOL-2436-9 24" x 36" 5¾" 900 3" x 1¼" 30 79.00FDOL-1624-12 16" x 24" 7" 1,200 4" x 1¼" 23 $81.00FDOL-2436-12 24" x 36" 7" 1,200 4" x 1¼" 34 84.00FDOL-2448-12 24" x 48" 7" 1,200 4" x 1¼" 41 87.00DC-25/UPS/FC-65/70series FDOLRUBBER END HARDWOOD DOLLYMODEL DECK SIZENUMBER (W x L)CARPET HARDWOOD DOLLIESMODEL DECK SIZENUMBER (W x L)DECKHEIGHTDECKHEIGHTUNIFORM STATICCAPACITY (LBS.)UNIFORM STATICCAPACITY (LBS.)CASTERSIZECASTERSIZENET WT.(LBS.)NET WT.(LBS.)LIST PRICEEACHHDOR-1830-12 18" x 30" 7" 1,200 4" x 1¼" 20 $31.00DC-25/UPS/FC-65/70LIST PRICEEACHHDOC-1624-9 16" x 24" 5¾" 900 3" x 1¼" 22 $27.00HDOC-1830-9 18" x 30" 5¾" 900 3" x 1¼" 29 37.00HDOSC-1624-12 16" x 24" 6¾" 1,200 4" x 1¼" 34 $78.00HDOSC-2436-12 24" x 36" 6¾" 1,200 4" x 1¼" 48 84.00DC-25/UPS/FC-65/70Dolly ConverterTransform your dolly into a panel cart by attaching these steel converter arms to your existinghardwood dolly. Ideal lightweight moving solution for industrial and commercial use. Handlesloads up to 250 pounds. Sold in pairs.series HDORseries HDOSCNewseries HDOCMODELNUMBER WIDTH HEIGHTMODELNUMBERDECK SIZE(W x L)DECKHEIGHTUNIFORM STATICCAPACITY (LBS.)UNIFORM STATICCAPACITY (LBS.)CASTERSIZE / TYPENET WT.(LBS.)NET WT.(LBS.)LIST PRICEPER PAIRD-CNVR-250 12" 37" 250 26 $83.00DC-25/UPSFiberwood DolliesFiberwood construction dollies feature a rubber padded surface and two hand holes to carrythe unit. The PVC edge strip protects walls from scrapes. Units roll on four swivel wheelswhich are non-marring and oil-resistant.LIST PRICEEACHFWD-1824-3R 18" x 24" 5" 800 3" RUBBER 16 $25.50FWD-1836-3R 18" x 36" 5" 700 3" RUBBER 18 31.50FWD-2436-3R 24" x 36" 5" 600 3" RUBBER 21 39.70FWD-2436-4PP 24" x 36" 5½" 600 4" PP* 22 44.30*POLYPROPYLENE CASTERSDC-25/UPS/FC-70model D-CNVR-250series FWDwww.vestil.com Phone (800) 348-0868New
INDUSTRIAL CARTS & DOLLIES224GENERAL DUTYQPC-7280-DPmodel VPJ-9ALL WEATHERQPC-7280-UPHEAVY DUTYQPC-7280-VPNewNewQuilted Moving PadsCushion and protect furniture, machinery, and electronic equipment. Each pad measures 72" wideby 80" long. Units are sold a dozen at a time. Model QPC-7280-UP is water and mildew resistant.MODELNUMBERMODELNUMBERDECK SIZE(W x L)UNIFORM STATIC CAPACITY(LBS.) PER SETWHEELSIZENET WEIGHT(POUNDS)NET WT. PERSET (LBS.)LIST PRICE(DOZEN)DESCRIPTIONQPC-7280-DP GENERAL DUTY (both sides cotton) 64 $149.00QPC-7280-UP ALL WEATHER (both sides polyester) 82 147.00QPC-7280-VP HEAVY-DUTY (one side polyester/other side cotton) 79 172.00Auto DolliesDC-20/UPS/FC-150Move cars in any direction with our Auto Dollies. Each dolly rolls on four swivel rubber casters.The height is 2⅝" to bottom of v-channel. Steel construction with painted finish.LIST PRICEPER SETADOL-1216-6K 12" x 16" 6,000 3" x 1 7 /8" 78 $186.00DC-25/FC-70Hydraulic Vehicle Positioning JacksGreat product used for effortless lifting and moving of vehicles. Simply slide product aroundbottom half of tire then pump foot pedal. Product will squeeze and then lift wheel off floor.Portable with four phenolic swivel casters. Steel construction. Priced and sold as each.model VPJ-DOLMODELNUMBERDESCRIPTIONMAXIMUMTIRE WIDTHUNIFORM STATICCAPACITY (LBS.)NET WT.(LBS.)LIST PRICEEACHVPJ-9 VEHICLE JACK 9" 1,500 40 $129.00VPJ-12 VEHICLE JACK 12" 1,500 44 139.00VPJ-DOL STORAGE DOLLY FOR HOLDING UP TO (4) JACKS 22 $79.00DC-25/FC-70Specialty DolliesPolyethylene Dollies, series DOL, features a steel reinforced structure which gives the dollies acapacity of 1,000 pounds. Available in a flush top or a padded top.PADDEDmodel DOL-1830-PRolling Knee Dolly, model KNEE-D, is great for people working on their knees. Constructedof red molded plastic with foam cushioned knee cups. Ideal for maintenance departments,automotive garages, and furniture warehouses. Handy tool tray keeps tools in easy reach.Leg Dolly, model LEG-D, Ideal for moving furniture with legs. Includes swivel hard poly casters.Three foam pads on top of dolly help prevent scratching. Inner cup is 1⅜" in diameter while theouter cup is 2¼" in diameter. Sold each.model KNEE-Dmodel LEG-DMODELNUMBERDECK SIZE(W x L)DECKHEIGHTUNIFORM STATICCAPACITY (LBS.)CASTERSIZENET WT.(LBS.)LIST PRICEEACHDOL-1830-F 18" x 30" 10" 1,000 (4) 5" 22 $58.00DOL-1830-P 18" x 30" 10" 1,000 (4) 5" 25 63.00KNEE-D 20¼" x 10" 3¾" 350 (6) 2" 5 $24.90LEG-D 6 3 /8" x 5¾" 2¼" 150 (3)1¼" 2 $5.30DC-25/UPS/FC-70Plastic Dolly with Handlemodel PDH-1624Plastic Dolly with Handle is made to move boxes, crates and office equipment easily. Strongpolyethylene construction will not warp or splinter. Rolls smoothly on (4) polyolefin swivel casters.MODELNUMBERDECK SIZE(W x L)HANDLEHEIGHTUNIFORM STATICCAPACITY (LBS.)WHEELSIZENET WT.(LBS.)LIST PRICEEACHPDH-1624 16" x 24" 37¼" 500 4" x 1½" 25 $121.00DC-20/FC-70Plastic Dolly Rubber EndsSteel reinforced high impact polypropylene construction. Nonporous surface doesn't split, break,rust or become weak. Rubber pads on dolly prevent slipping.Phone (800) 348-0868model PDOC-1830MODELNUMBERDECK SIZE(W x L)DECKHEIGHTUNIFORM STATICCAPACITY (LBS.)WHEELSIZENET WT.(LBS.)LIST PRICEEACHPDOC-1830 18" x 30" 5½" 1,000 3" x 1¼" 15 $61.00DC-20/FC-70www.vestil.com
Plastic DolliesOne piece molded polyethylene dollies are lightweight and easy to clean. Will not rot, warp,dent, or splinter like wood dollies. Ideal for the food service industry. Dollies with pull ropeincludes 1/4" poly rope handle for easy pulling.Model POS-1624 features a molded handle. This allows dolly to be easily carried up and downstairs. Unit comes standard with poly-on-poly casters.Models POS-1830 and POS-2133 roll smoothly on poly-on-poly casters.MODELNUMBERMODELNUMBERDECK SIZE(W x L)OVERALL SIZE(W x L x H)DECKHEIGHTUNIFORM STATICCAPACITY (LBS.)CENTER OPENING(W x L)WHEELSIZEUNIFORM STATICCAPACITY (LBS.)NET WT.(LBS.)NET WT.(LBS.)LIST PRICEEACHPOS-1624 16" x 24" 4½" 220 3" x 1" 7 $38.00POS-1624-ROPE 16" x 24" 4½" 220 3" x 1" 10 39.90POS-1830 18" x 30" 6" 500 4" x 1¼" 14 $72.00POS-1830-ROPE 18" x 30" 6" 500 4" x 1¼" 17 73.90POS-2133 21" x 33" 6" 500 4" x 1¼" 22 90.00POS-2133-ROPE 21" x 33" 6" 500 4" x 1¼" 25 91.90DC-25/UPS/FC-70Open Deck Machinery DollyDollies have six high-capacity, abrasion-resistant, cast iron steel wheels on fixed axles to move heavymachinery, containers, and other equipment. The center wheels project lower than end wheels foreasier pivoting. Welded steel construction. Model ODMD-2436-6 has a 3" channel steel frame; 5"cast iron wheels have roller bearings. Model ODMD-3660-10 has a 6" channel (1¾" flange width)steel frame; 8" x 3" cast iron wheels have roller bearings. Durable powder coat yellow finish.LIST PRICEEACHODMD-2436-6 24" x 36" x 6 3 /8" 12½" x 33 3 /16" 6,000 147 $501.00ODMD-3660-10 36" x 60" x 8¼" 24" x 56½" 10,000 370 548.00DC-25/FC-70Low Profile Machinery DollyTypically used in pairs or sets of four to move heavy machinery, containers, and other equipment.Deck height is only 1¾" high. Made of all welded steel construction with a ¼" thick deck and ⅝"high lip on two sides to retain loads. Four rigid 2" x ½" steel wheels allow for portability.New225model POS-1624-ROPEmodel POS-1830& POS-2133INDUSTRIAL CARTS & DOLLIESMODELNUMBERDECK SIZE(W x L)DECKHEIGHTUNIFORM STATICCAPACITY (LBS.)WHEELSIZENET WT.(LBS.)LIST PRICEEACHMCD-10 8½" x 12" 1¾" 10,000 2" x ½" 17 $113.00DC-20/FC-70Steel Machine Rollers & AccessoriesMade of high-strength annealed ductile iron, these Steel Machine Rollers have swivel tops thatrotate 360° on chrome steel ball bearings to allow for easier turning. The rollers form a "tank track"to revolve around a center load bearing plate in the frame to provide maximum maneuverability.The weight of the load is transferred directly from the load bearing plate to the rollers, eliminatingaxle friction and requiring less power to start and move. A spring loaded locking mechanism on theswivel tops, except on model VHMS-2, can be engaged in detents at 45° intervals. These units arevirtually maintenance free. Steering bars split in two and connect with sleeve for easy storage.MACHINE ROLLERSMODEL BODY SIZENUMBER (W x L)OVERALLHEIGHTUNIFORM STATICCAPACITY (LBS.)TYPEOF TOPNET WT.(LBS.)LIST PRICEEACHVHMS-2 3¼" x 8" 3½" 2,000 SWIVEL 12 $102.00VHMS-8 5½" x 10" 5" 8,000 SWIVEL 37 175.00VHMS-15 5¾" x 10½" 5" 15,000 SWIVEL 40 211.00VHMS-30 6½" x 12¾" 5" 30,000 SWIVEL 62 261.00DC-25/UPS/FC-70MACHINE ROLLER KITMODELNUMBERNET WT.(LBS.)LIST PRICEPER KITDESCRIPTIONVHMS-2-KIT (4) VHMS-2 & (2)VHMH-36-1 STEERING BARS 112 $493.00DC-25/UPS/FC-70MACHINE ROLLER HANDLESMODELNUMBER DESCRIPTION USE WITHHANDLELENGTHNET WT.(LBS.)LIST PRICEEACHVHMH-36-1 STEERING BAR VHMS-2 36" 7 $39.00VHMH-48-1 STEERING BAR VHMS-2 48" 8 43.00VHMH-36-2 STEERING BAR VHMS-8/15/30 36" 7 40.00VHMH-48-2 STEERING BAR VHMS-8/15/30 48" 8 47.00VHMH-TB-2 TURNING BAR VHMS-8/15/30 36" 18 61.00DC-25/UPS/FC-70series VHMSmodel VHMS-2-KITSTEERING BARmodel VHMHTURNING BARmodel VHMH-TB-2www.vestil.com Phone (800) 348-0868
INDUSTRIAL CARTS & DOLLIES226model FMS-3model SSKT-3Phone (800) 348-0868model SSKT-6ADJUSTABLE HEIGHTTRANSPORTER WITH TILTmodel C-ATH-4048ECONOMY FIXED HEIGHTTRANSPORTER WITHOPTIONAL CORNER GUARDSmodel C-FH-4048model ASKT-12model SSKT-12model SDOL-2model DCC-80model DCC-17ADJUSTABLE HEIGHTTRANSPORTER WITHOPTIONAL CORNERGUARDSmodel C-AH-4048FIXED HEIGHTTRANSPORTERWITH CAROUSELmodel C-FC-40Machinery SkatesThese skates are designed to move heavy equipment and machinery. Nylon wheels are strongand will not mark floors. The top of each skate includes a rubber surface for extra grip. Steelconstruction with handle to carry and position. Three styles to choose from.Fixed: Dolly size is nonadjustable and wheels are rigid. Designed primarily for moving instraight lines.Adjustable: Includes two dollies connected with a slider bar to form one larger dolly. Slider barallows for adjustable overall dolly width. Designed primarily for moving in straight lines.Steerable: Each dolly includes a swivel top plate and a pulling bar to allow for easymaneuvering around turns and corners.MODELNUMBERMODELNUMBERROLLERMATERIALNUMBEROF ROLLERSOVERALL SIZE(W x L x H)OVERALL SIZE(L x W x H)UNIFORM STATICCAPACITY (LBS.)UNIFORM STATICCAPACITY (TONS)CASTERSIZENET WT.(LBS.)NET WT.(LBS.)LIST PRICEEACHFIXED MACHINERY SKATESFMS-2.5 NYLON 2 8¼" x 4" x 4" 2.5 12 $52.00FMS-3 NYLON 4 13" x 11¾" x 4¾" 3 23 82.00FMS-6 NYLON 6 10¼" x 9" x 4" 6 31 131.00ADJUSTABLE MACHINERY SKATESASKT-6 NYLON 8 11¾" x 9¾" x 4½" 6 71 $205.00ASKT-12 NYLON 12 14" x 8¾" x 4½" 12 88 289.00ASKT-24 STEEL 16 14" x 8¾" x 4½" 24 151 365.00STEERABLE MACHINERY SKATESSSKT-3 NYLON 4 12¼" x 10" x 4" 3 38 $106.00SSKT-6 NYLON 8 24¾" x 15¾" x 4½" 6 120 271.00SSKT-12 STEEL 8 24¾" x 15¾" x 4½" 12 168 310.00DC-25/UPS/FC-70Steel Dolly SetsThese lightweight steel dollies are ideal for use in hundreds of applications. Each dolly features bolt-onhard rubber swivel casters and a painted finish. V-groove formed deck for strength and slip resistance.MODELNUMBERLIST PRICEEACHDCC-80* 29" x 29" x 24" 4,000 8" x 2" 96 $327.00DCC-2860-4* 28" x 60" x 29" 4,000 8" x 2" 203 460.00DCC-2896-4* 28" x 96" x 29" 4,000 8" x 2" 320 478.00DCC-2860-10* 28" x 60" x 29" 10,000 8" x 3" 259 519.00DCC-2896-10* 28" x 96" x 29" 10,000 8" x 3" 550 609.00DCC-28120-10* 28" x 120" x 29" 10,000 8" x 3" 570 665.00DCC-17** 20" x 20" x 5½" 600 3" x 1½" 20 $230.00*STEEL CONSTRUCTION / **ALUMINUM CONSTRUCTIONDC-20/FC-100MODELNUMBERDECK SIZE(W x L)SERVICERANGEDECKHEIGHTUNIFORM STATICCAPACITY (LBS.)UNIFORM STATICCAPACITY (LBS.)CASTERSIZECASTERSIZE / STYLEQUANTITYPER BOXNET WT.(LBS.)NET WEIGHT(POUNDS)LIST PRICEPER BOXSDOL-2 8" x 8" 3-5/8" 500 2" x ¾" 2 17 $26.50SDOL-4 8" x 8" 3-5/8" 500 2" x ¾" 4 33 53.10DC-25/UPS/FC-70Heavy-Duty Cradle CartsMove and store pipe, channel, bar stock, barrels, or drums with these Heavy-Duty CradleCarts. A large open design that makes loading and unloading by fork trucks and slings easy.All welded construction. Wheels are mounted in a diamond pattern to allow the truck to tiltwhen going over thresholds and turn about on its own center. Lightweight Aluminum CradleCart fits all small to medium loads and rolls on (4) swivel 3" x 1½" poly casters. The 4,000 &10,000 pound Steel Cradle Carts rolls on (2) rigid and (2) swivel phenolic casters, except forthe DCC-80 which rolls on (4) swivel casters. Powder coat finish standard on steel cart.Economical Pallet & Container TransportersReduce fork truck dependency by transporting pallets and crates to workstations with ourEconomical Pallet & Container Transporters. Units feature 8" glass-filled nylon casters foreasier mobility. Choose from four different styles. Adjustable height models can only beadjusted when unloaded. Order optional corner guides for extra stability (2 come standardwith model C-ATH-4048). Steel construction. Powder coat finish.LIST PRICEEACHC-ATH-4048 24" TO 32" 4,000 8" GFN* 205 $506.00C-AH-4048 24" TO 32" 4,000 8" GFN* 190 434.00C-FH-4048 12" 4,000 8" GFN* 145 252.00C-FC-40 15" 4,000 8" GFN* 190 635.00CG-12 OPTIONAL CORNER GUIDE (EACH) 12 $22.00*GLASS-FILLED NYLONDC-25/UPS/FC-70/100www.vestil.com
V-Groove Pipe MoverPipe and tubing measuring up to 20 feet long may now be easily moved by one person. The V-Groovedesign keeps loads at the horizontal center of gravity for maximum stability and safety. Large 16"diameter tires will support loads that weigh up to 1,000 pounds. Includes a 37" long handle for addedmaneuverability. Steel construction. Unit is powder coated blue.MODELNUMBERSIZE(W x L)HANDLELENGTHUNIFORM STATICCAPACITY (LBS.)WHEELSTYLESNET WT.(LBS.)LIST PRICEEACHVGP-100 17" x 30" 37" 1,000 PNEUMATIC 108 $438.00VGP-100-FF 17" x 30" 37" 1,000 FOAM FILLED 110 460.00DC-20/FC-100Portable Parts BinCut parts picking time in half with these space saving, rotating Parts Bins. Compact enough to fit insmall spaces such as corners and ends of aisles. Great for organization of small parts. Ideal for use incommercial and industrial applications. Rugged molded plastic construction with four swivel casters forportability. Each shelf is 2⅛" deep. The space between the shelves is 8".MODELUNIFORM STATIC CASTER NET WT. LIST PRICENUMBER DIAMETER HEIGHT CAPACITY (LBS.) SIZE (POUNDS) EACHPBIN-19 19½" 38½" 220 3" x ¾" 33 $51.00Furniture and Crate MoversTransport furniture, crates, and machinery easily. Simply slide nose plate under item tobe moved, strap both dollies together, and lift. Available in either a manual mechanicalhand crank lift option or a manual hand pump hydraulic lift option. Standard with(4) 6" x 2" swivel poly-on-steel casters and 190" long straps. Steel construction withdurable paint finish. Priced and sold in pairs.DC-25/UPS/FC-100/250modelMFM-4000227INDUSTRIAL CARTS & DOLLIESMODELNUMBERLIFTSTYLEPLATE SIZE(W x D)UNIFORMCAPACITYLIFTHEIGHTOVERALL SIZE(W x D x H)NET WT.(LBS.)LISTPER PAIRMFM-1300 MECHANICAL 8¾" x 4¾" 1,300 15" 15½" x 22½" x 30¾" 60 $457.00MFM-4000 HYDRAULIC 23½" x 2¼" 4,000 10" 16½" x 26¾" x 42¼" 190 619.00Machinery LiftsThese machinery lifts are the ideal method to move bulky and hard to handle loads. Move large,awkward objects or heavy equipment that is difficult to maneuver or position like refrigerators,safes, furniture, or machines. Yet they are versatile enough to safely handle fragile, sensitiveequipment like glass, and computers. Optional side straps secure loads for stable moving. Largewheels allow smooth movement over bumps and cracks of factory floors. Forks are adjustablewith mounting pegs to allow for positioning of forks to accommodate different width loads.MODELNUMBERFORKSADJUSTABLEFORKLENGTHUNIFORMCAPACITYLIFTHEIGHTOVERALL SIZE(W x D x H)NET WT.(POUNDS)DC-25/FC-100LISTPER PAIRMFM-2-RAL 7¼" to 17½" 5" 2,000 5 1 /8" 22" x 12½" x 47½" 160 $1,175.00MFM-4-RAL 5" to 19½" 6" 4,000 6" 23" x 16½" x 44" 325 1,550.00MFM-6-RAL 6" to 19½" 6" 6,000 6" 23" x 16¾" x 42½" 335 1,700.00MFM-8-RAL 7¼" to 19½" 6" 8,000 6" 23" x 17¼" x 45½" 400 1,825.00MFM-10-RAL 9¼" to 19½" 6" 10,000 6" 24" x 18" x 45½" 438 2,100.00MFM-12-RAL 9¼" to 19½" 6" 12,000 6" 24" x 18" x 45½" 470 2,600.00MFM-BELT-12 BELT WITH TRIANGLE HOOK ENDS, 12 FOOT LONG 5 $125.00MFM-BELT-16 BELT WITH TRIANGLE HOOK ENDS, 16 FOOT LONG 5 140.00MFM-BELT-20 BELT WITH TRIANGLE HOOK ENDS, 20 FOOT LONG 10 155.00Adjustable Height Floor LocksDC-25/FC-100This one of a kind floor lock includes an adjustable height foot pad that will work on carts with differentcaster heights. The adjustable height feature provides uniform locking and safety unlocking force for betterergonomic operation. This feature also keeps the floor lock working properly as spring and pads wear overtime. Height is adjustable by turning the bottom pad. The bottom pad includes suction-cups for extra grip.modelMFM-1300NewMODELNUMBEREXTENDEDHEIGHTRETRACTEDHEIGHTUSED WITHCASTER SIZENET WT.(LBS.)LIST PRICEEACHLIST PRICE5 OR MOREZINC PLATED FINISH WITH HEAVY-DUTY CAST STEEL CONSTRUCTIONFL-ADJ-46 5¾" to 8" 4¾" to 7" 4" - 6" 9 $50.80 $40.00FL-ADJ-810 7 5 /8" to 10 7 /8" 6¼" to 9½" 8" - 10" 11 53.30 43.30STAINLESS STEEL CONSTRUCTIONFL-ADJ-46-SS 5¾" to 8" 4¾" to 7" 4" - 6" 9 $192.00 $182.00FL-ADJ-810-SS 7 5 /8" to 10 7 /8" 6¼" to 9½" 8" - 10" 11 204.00 194.00DC-35/UPS/FC-70Suction cup bottom padwww.vestil.com Phone (800) 348-0868
INDUSTRIAL CARTS & DOLLIES228NewSIDE MOUNTEDFLOOR LOCKmodel FL-LK-SMRmodel FJB-36 shownPhone (800) 348-0868Economical Floor LockOur economical floor locks help to stabilize mobile equipment during loading and unloading. They areperfect for keeping carts, trucks, work benches and other portable equipment stationary. All of thesefloor locks are spring loaded and offer a non-skid rubber foot pad to keep equipment stationary. Theheavy-duty steel construction has a bright zinc plated finish.MODELNUMBERMODELNUMBERMODELNUMBERMODELNUMBERMINIMUMEXTENDED HEIGHTMAXIMUMEXTENDED HEIGHTOVERALLHEIGHTSCREWTRAVELNET WT.(LBS.)LIST PRICEEACHLIST PRICE 5OR MORESTEEL CONSTRUCTION WITH POLISHED CHROME FINISHLJ-9 4½" 13½" 18" 9" 11 $101.00 $90.00LJ-17 4½" 21½" 26" 17" 14 115.00 103.00LJ-21 4½" 25½" 30" 21" 16 128.00 114.00STAINLESS STEEL CONSTRUCTIONLJ-9-SS 4½" 13½" 18" 9" 11 $325.00 $309.00LJ-17-SS 4½" 21½" 26" 17" 14 403.00 383.00LJ-21-SS 4½" 25½" 30" 21" 16 427.00 406.00REPLACEMENT RUBBER BOTTOM PAD (FOR LJ-SERIES ONLY), MODEL LJ-PAD, LIST $21.73DC-35/FC-65REPLACEMENT RUBBER BOTTOM PAD (FOR LJ-SS SERIES ONLY), MODEL LJ-PAD-SS, LIST $35.40MODELNUMBERUSE WITHCASTER HEIGHTMINIMUMHEIGHTEXTENDEDHEIGHTMOUNTINGHEIGHTEXTENDEDHEIGHTMAXIMUMHEIGHTRETRACTEDHEIGHTRETRACTEDHEIGHTMINIMUM HEIGHTCAPACITY (LBS.)RETRACTEDHEIGHTUSED WITHCASTER SIZETOP PLATEDIMENSIONSNET WT.(LBS.)MAXIMUM HEIGHTCAPACITY (LBS.)NET WT.(LBS.)NET WT.(LBS.)LIST PRICEEACHNET WT.(LBS.)LIST PRICEEACHFL-4 4" 5 7 /8" 5" 4½" x 4" 3 $19.20FL-5 5" 6 5 /8" 5 5 /8" 4½" x 4" 3 19.60FL-6 6" 7¾" 6¾" 4½" x 4" 4 19.90FL-8 8" 9 13 /16" 8 5 /8" 4½" x 4" 4 20.30DC-35/UPS/FC-70Low Profile Floor LockThe lowest-profile floor lock available on the market today. Features adjustable-height pad for precisionand wear ability, simply bolt to bottom of cart. Foot operated. Zinc plated finish with heavy-duty caststeel construction.LIST PRICEEACHFL-LK-LP 4 3 /8" 3 7 /8" 8 $62.00DC-35/UPS/FC-70General Purpose Floor LocksFloor Locks may be used on platform trucks, fixture dollies, or equipment with casters. Simple foot pressureimmobilizes equipment. Locks when large friction face is pressed against the floor. To release simply kickrelease rod. Brake is independent of casters and can be installed to any convenient location on the cart.Vertical mounting plate designed to mount to sides of carts and other portable products. The springloaded pad accommodates uneven floors. Units mount with pad 1½" off the floor when retracted.LIST PRICE5 OR MOREFL-LK-5E 6 5 /8" 5 3 /8" 5" 4 $32.60 $28.10FL-LK-7X 7¼" 6¼" 6" 12 52.00 42.00FL-LK-7G 7¾" 6¼" 6" 12 54.00 45.00FL-LK-10 9 15 /16" 8 7 /8" 8" 19 85.00 74.00FL-LK-S 7 3 /8" 4 1 /8" 6" 12 53.00 43.00FL-LK-SMR 18 7 /16" 15 15 /16" (2" of Travel) 9 49.00 46.00STAINLESS STEEL CONSTRUCTIONFL-LK-SMR-SS 10-15½" 16" (2" of Travel) 9 $263.00 $250.00DC-35/UPS/FC-70Leveling JacksDesigned for permanent installation, these screw-style jacks hold platforms and other equipment in placeand stabilize them at the required height. Drill a 1¼" diameter hole through the platform to be leveledand bolt the platform between the upper and lower flanges of the jack's divided housing. Uniformcapacity is 5,000 pounds. Jacks have an 8½" long handle that folds down when not in use. 3⅞" diameterswivel base has a slip-resistant rubber pad on the bottom (replacement pads available). Screw diameter is1¼". Lift rate is ¼" per crank revolution.Basement Floor JacksProvide extra support for leveling and stabilizing floor beams and joists during construction and repairs.Telescopic style with removable pins lets you properly position the brace for better leveling. End pad includesa screw and turning bar for easy height adjustment. Rugged all welded steel construction. Red oxide finish.LIST PRICEEACHFJB-16 12" 16" 19,475 19,475 7 $29.00FJB-36 19" 36" 19,475 13,725 12 48.00FJB-100 54" 100" 16,875 11,200 26 53.00FJB-150 54" 150" 22,400 5,175 37 81.00DC-25/FC-65www.vestil.com
Pallet Racking• Scratch and rust resistance• Surface features powder coat finish• Structural uniformity and integrityPallet racking solves the storage and retrieval needs faced by most industries today.Adaptability to specific layout installations is just one added feature.FRAMEMODELNUMBERFRAMEHEIGHTFRAMEDEPTHUNIFORMCAPACITY (LBS)NET WT.(POUNDS/SET)LIST PRICE(PER FRAME)PRTD-10-42-19 120" 42" 19,380 53 $130.00PRTD-10-42-24 120" 42" 24,000 89 140.00PRTD-12-42-19 144" 42" 19,380 66 $148.00PRTD-12-42-24 144" 42" 24,000 104 159.00PRTD-14-42-19 168" 42" 19,380 76 $176.00PRTD-14-42-24 168" 42" 24,000 90 189.00PRTD-16-42-19 192" 42" 19,380 83 $191.00PRTD-16-42-24 192" 42" 24,000 136 205.00Newmodel BEAM-S229STEP BEAMMODELNUMBERBEAMHEIGHTBEAMLENGTHUNIFORMCAPACITY / PAIRNET WT.(POUNDS/SET)LIST PRICE(PER FRAME)BEAM-S-850 6" 96" 5,000 33 $56.00BEAM-S-870 6" 96" 7,000 35 64.00BEAM-S-960 6" 108" 6,000 41 $73.00BEAM-S-970 6" 108" 7,000 51 83.00BEAM-S-1050 6" 120" 5,000 43 $80.00BEAM-S-1070 6" 120" 7,000 65 106.00FRAME SPACER - SEPARATES BACK TO BACK FRAMES (HDWR. INCLUDED)MODELNUMBERFRAME SPACERNET WT.(POUNDS/SET)LIST PRICE(PER FRAME)FSR-6 6" 1 $10.00FSR-12 12" 2 13.00Pallet Support BarMODELNUMBER WIDTH LENGTH HEIGHTNET WT.(POUNDS)DC-20/FC-70Cross bars provide economical support for pallets between rack cross beams. The modelSSB-42, is 1½" high. It is designed to sit flush with the top of the rack step beam. Themodel PSB-42 is 1" high and is designed to be used with ½" plywood or particle boardso the board will be flush with the top of the beam. The boxed steel bars fit our standard42" rack. 14 gauge material.LIST PRICE(EACH)PSB-42 3" 38½" 1½" 9 $13.00SSB-42 3" 38½" 1" 7 12.00Pallet Rack Wire DeckingMODELNUMBERMODELNUMBERDECKINGDEPTHDECKINGDEPTHDECKINGLENGTHDECKINGLENGTH(2) PIECES REQUIREDFOR BEAM WIDTH(2) PIECES REQUIREDFOR BEAM WIDTHNET WT.(POUNDS)NET WT.(POUNDS)DC-20/FC-70Provide maximum support at minimum cost. The three 13 gauge “U” channels keeppallet and products from falling thru rack beams. Fits 1½" step beam. Powder-coatfinish. Requires two sections for use in bay. Uniform load capacity is 2,500 lbs.LIST PRICE(EACH)WMD-4246 42" 46" 96" 26 $39.00WMD-4252 42" 52" 108" 27 47.00WMD-4258 42" 58" 120" 28 54.00Crown Pallet Rack DeckingDC-20/FC-70Add convenience, visibility and efficiency to your rack. By sloping the decking youhelp the user do their job. The 6 gauge wire mesh. Uniform load capacity is 2,500 lbs.Slope is 4½" in 21". Designed for our 42" deep x 1½" step type pallet rack beam.Powder-coat finish.LIST PRICE(EACH)SWMD-4246 42" 46" 96" 24 $78.00SWMD-4252 42" 52" 108" 25 88.00SWMD-4258 42" 58" 120" 26 93.00DC-20/FC-70model SSB-42model PSB-42www.vestil.com Phone (800) 348-0868NewNewNewmodel PRTDSTORAGE SOLUTIONS
230NewOpen Area Rack DeckingThis product is ideal for storing furniture, carpet, record files or products that require auniform support. Fire protection friendly with 50% open design. Designed for palletrack beam with 42" deep racking. 16 square foot. The bright galvanized finish makes the22 gauge steel rack appear more industrial. Fits 1½" beam offset. Custom sizes available,contact factory.MODELNUMBERBEAMLENGTHFRAMEDEPTHUNIFORMCAPACITYNET WT.(POUNDS)LIST PRICE(EACH)SPANPCH-96 96" 42" 38½" 3,150 29 $90.00PCH-108 108" 42" 38½" 3,543 33 101.00PCH-120 120" 42" 38½" 3,937 36 112.00DC-20/FC-70STORAGE SOLUTIONSNewIncludes (4)multi positionspacer bracketswith boltsNewNewPallet Rack Back GuardMinimize the potential hazard of product falling out the back of pallet rack. Attach thissteel protective shield with the included steel brackets. Spacer bracket installs to space outguard 4 or 6 inches. Wire mesh is attached to 1¼" x 1½" x ⅛" angle frame.MODELNUMBER LENGTH HEIGHTMODELNUMBER LENGTH HEIGHTNET WT.(POUNDS)NET WT.(POUNDS)LIST PRICE(EACH)PRSN-96-4 96" 48" 44 $278.00PRSN-108-4 108" 48" 49 299.00PRSN-120-4 120" 48" 53 327.00Nylon Pallet Rack NettingDC-20/FC-70Minimize the potential of racked products falling off the back of pallet racks. The nylonmesh is edged with polypropylene rope. Attach to rack uprights using cable ties whichare included.LIST PRICE(EACH)PRN-99-4 99" 48" 5 $107.00PRN-99-8 99" 96" 10 194.00PRN-111-4 111" 48" 5 $118.00PRN-111-8 111" 96" 10 214.00PRN-123-4 123" 48" 6 $129.00PRN-123-8 123" 96" 12 234.00Pallet Rack Lifting DollyDC-20/UPSDesigned for moving empty fully-assembled pallet racking. Lifting dolly jack includeshydraulic pump to raise pallet rack frame. Frame must have low cross-bar for properusage. Safety strap is used to secure lifting dolly to pallet rack frames. Steel constructionwith painted finish. Optional dollies are used to hold frame feet.Phone (800) 348-0868NewMODELNUMBERNET WT.(POUNDS)LIST PRICE(EACH)DESCRIPTIONPRRJ-10-D LIFTING DOLLY JACK 120 $368.00PRRJ-DOL ONE PAIR OF DOLLIES 50 89.00Pallet Rack SumpMODELNUMBERDESCRIPTIONSIZE(W x L x H)UNIFORMCONTAINMENTCAPACITYNET WT.(LBS)DC-25/FC-70Polyethylene Pallet Rack containment sump keeps dangerous and costly spills off floors,equipment and inventory. Allows direct forklift access to wooden pallet - sump unitstays positioned in the rack when removing pallet and drums. Low profile design fitsinto warehouse racking with minimal obstruction to adjacent storage areas. Unit holdsup to (4) 55-gallon drums on a standard shipping pallet. Inside dimensions for a palletare 49" x 49". Model PRS-51-D comes with drain/ball valve assembly for drainingliquids.LIST PRICE(EACH)PRS-51-D WITH DRAIN 51½" x 51½" x 12" 66 GAL. 50 $380.00PRS-51-ND NO DRAIN 51½" x 51½" x 12" 66 GAL. 50 350.00DC-20/FC-200www.vestil.com
Structural Cantilever RackingCantilever Rack Systems offer flexibility to custom-fit individual applications. Theunique bolt together construction with welded steel components offers a greatcombination of strength and durability. Individual components are sold separately toaccommodate your requirements. Arms attach to upright with a "C" clamps that areinfinitely adjustable.SINGLE-SIDED CANTILEVER UPRIGHTSMODELNUMBERCOLUMNHEIGHTARMLENGTHSUNIFORMCAPACITY/SIDENET WT.(POUNDS/SET)LIST PRICE(PER FRAME)SAC-812 96" 12" 18,000 220 $371.00SAC-824 96" 24" 12,000 229 387.00SAC-836 96" 36" 9,200 243 410.00SAC-848 96" 48" 7,600 265 446.00SAC-1012 120" 12" 26,500 285 $480.00SAC-1024 120" 24" 16,600 294 496.00SAC-1036 120" 36" 12,250 317 535.00SAC-1048 120" 48" 9,500 329 556.00SAC-1212 144" 12" 26,600 325 $547.00SAC-1224 144" 24" 16,500 335 564.00SAC-1236 144" 36" 12,250 358 604.00SAC-1248 144" 48" 9,500 369 623.00DC-20/FC-70231DOUBLE-SIDED CANTILEVER UPRIGHTSMODELNUMBERCOLUMNHEIGHTARMLENGTHSUNIFORMCAPACITY/SIDENET WT.(POUNDS/SET)LIST PRICE(PER FRAME)DAC-812 96" 12" 18,000 242 $405.00DAC-824 96" 24" 12,000 271 453.00DAC-836 96" 36" 9,200 290 485.00DAC-848 96" 48" 7,600 336 562.00DAC-1012 120" 12" 26,500 316 $529.00DAC-1024 120" 24" 16,600 350 587.00DAC-1036 120" 36" 12,250 365 611.00DAC-1048 120" 48" 9,500 411 688.00DAC-1212 144" 12" 26,600 357 $597.00DAC-1224 144" 24" 16,500 386 646.00DAC-1236 144" 36" 12,250 405 678.00DAC-1248 144" 48" 9,500 451 756.00DC-20/FC-70SINGLE-SIDEDCANTILEVER UPRIGHTSseries SACSTORAGE SOLUTIONSMODELNUMBERARMLENGTHUNIFORM CAPACITY(POUNDS)NET WT.(POUNDS)LIST PRICEEACHSTRAIGHT ARMS WITH LIPSSSAL-12 12" 3,000 11 $36.00SSAL-24 24" 2,000 15 45.00SSAL-36 36" 1,200 20 50.50SSAL-48 48" 1,000 24 57.90STRAIGHT ARMS WITH NO LIPSSSAL-12-NL 12" 3,000 11 $35.00SSAL-24-NL 24" 2,000 15 44.00SSAL-36-NL 36" 1,200 20 49.00SSAL-48-NL 48" 1,000 24 56.00DC-20/FC-70STRAIGHT ARMSWITH 2" LIPSseries SSALHORIZONTAL BRACE SETSMODEL COLUMNNUMBER HEIGHTCOLUMNSPACINGBRACESPER SETNET WT.(LBS./PAIR)LIST PRICE(PER PAIR)HBS-83 96" 36" 3 24 $69.00HBS-84 96" 48" 3 30 75.00HBS-85 96" 60" 3 36 84.00HBS-86 96" 72" 3 41 135.00HBS-10123 120" & 144" 36" 5 36 $105.00HBS-10124 120" & 144" 48" 5 46 120.00HBS-10125 120" & 144" 60" 5 55 146.00HBS-10126 120" & 144" 72" 5 65 219.00USED TO CONNECT TWO UPRIGHTS TOGETHERDC-20/FC-70HORIZONTALBRACE SETSseries HBSwww.vestil.com Phone (800) 348-0868
232Medium Duty Cantilever RackingMedium-Duty Cantilever Racks are ideal for manual loading; open design allows easy forkliftaccessibility. Store bar stock, pipe, tubing, lumber, and other light hard-to-stock items thatmust be kept off the floor. Arms are adjustable up and down the full length of the upright.There is 3½" between arm slots. To adjust, align arms with pre-drilled slots and secure withkey lock (included). All arms feature lips to prevent product from falling off. Uprights aresold each, not in pairs. Custom rack systems can be designed for your special application.STORAGE SOLUTIONSSINGLE-SIDEDseries MU-C(shown with armsand brace set)DOUBLE-SIDEDseries MDU-C(shown with armsand brace set)SINGLE-SIDED UPRIGHTSMODELNUMBER HEIGHT BASEARMSTO USEUNIFORMCAPACITY (LBS)NET WT.(POUNDS)LIST PRICE(EACH)MU-C-6-12 72" 25 3 /8" 12" 8,100 130 $207.00MU-C-6-18 72" 31" 18" 6,600 135 202.00MU-C-6-24 72" 37" 24" 5,500 140 217.00MU-C-6-36 72" 49 3 /8" 30" / 36" 4,700 / 4,100 150 238.00MU-C-8-12 96" 25 3 /8" 12" 7,600 150 $254.00MU-C-8-18 96" 31" 18" 6,300 155 276.00MU-C-8-24 96" 37" 24" 5,300 160 301.00MU-C-8-36 96" 49 3 /8" 30" / 36" 4,500 / 4,000 170 317.00MU-C-10-12 120" 25 3 /8" 12" 7,100 170 $328.00MU-C-10-18 120" 31" 18" 5,900 175 348.00MU-C-10-24 120" 37" 24" 5,000 180 343.00MU-C-10-36 120" 49 3 /8" 30" / 36" 4,400 / 3,800 190 407.00DOUBLE-SIDED UPRIGHTSMODELNUMBER HEIGHT BASEARMSTO USEUNIFORMCAPACITY (LBS)NET WT.(POUNDS)DC-20/FC-70LIST PRICE(EACH)MDU-C-6-12 72" 34" 12" 16,200 145 $220.00MDU-C-6-18 72" 46" 18" 13,200 155 266.00MDU-C-6-24 72" 58" 24" 11,000 165 306.00MDU-C-6-36 72" 82" 30" / 36" 9,400 / 8,200 190 370.00MDU-C-8-12 96" 34" 12" 15,200 165 $291.00MDU-C-8-18 96" 46" 18" 12,600 175 352.00MDU-C-8-24 96" 58" 24" 10,600 185 403.00MDU-C-8-36 96" 82" 30" / 36" 9,000 / 8,000 210 423.00MDU-C-10-12 120" 34" 12" 14,200 185 $377.00MDU-C-10-18 120" 46" 18" 11,800 195 431.00MDU-C-10-24 120" 58" 24" 10,000 205 492.00MDU-C-10-36 120" 82" 30" / 36" 8,800 / 7,600 230 510.00DC-20/FC-70INCLINED ARMSseries MIA-CBRACE SETseries MB-CSTRAIGHT ARMSseries MSA-CSTRAIGHT ARMSMODELNUMBERUNIFORMCAPACITY (LBS)NET WT.(POUNDS)LIST PRICE(EACH)LENGTHMSA-C-12 1,000 12" 11 $24.00MSA-C-18 750 18" 13 26.00MSA-C-24 600 24" 15 28.00MSA-C-30 500 30" 17 35.00MSA-C-36 400 36" 19 36.0010° INCLINED ARMSMODELUNIFORMNUMBER CAPACITY (LBS)NET WT.(POUNDS)DC-20/FC-70LIST PRICE(EACH)LENGTHMIA-C-12 1,000 12" 11 $28.00MIA-C-18 750 18" 13 29.00MIA-C-24 600 24" 15 32.00MIA-C-30 500 30" 17 38.00MIA-C-36 400 36" 19 40.00DC-20/FC-70BRACE SETS FOR 6 FOOT UPRIGHTS (includes two)MODELNUMBER LENGTHNET WT.(LBS.)LIST PRICE(EACH)MB-C-6-36 35" 26 $55.00MB-C-6-48 47" 38 65.00MB-C-6-60 59" 44 76.00MB-C-6-72 71" 50 98.00MB-C-6-96 95" 64 117.00Phone (800) 348-0868DC-20/FC-70BRACE SETS FOR 8 FOOT UPRIGHTS (includes two)MODELNUMBER LENGTHNET WT.(LBS.)LIST PRICE(EACH)MB-C-8-36 35" 28 $59.00MB-C-8-48 47" 42 70.00MB-C-8-60 59" 48 81.00MB-C-8-72 71" 52 102.00MB-C-8-96 95" 66 121.00DC-20/FC-70BRACE SETS FOR 10 FOOT UPRIGHTS (includes two)MODELNUMBER LENGTHNET WT.(LBS.)LIST PRICE(EACH)MB-C-10-36 35" 30 $64.00MB-C-10-48 47" 44 74.00MB-C-10-60 59" 50 86.00MB-C-10-72 71" 54 107.00MB-C-10-96 95" 68 126.00DC-20/FC-70www.vestil.com
233Heavy-Duty Cantilever RackingHeavy-Duty Cantilever Racks are completely adjustable for application specific designflexibility. Long, unwelded stock is handled quickly and efficiently by forklift; instantaccessibility to one piece or a full load. Arms are adjustable up and down the length of theupright. Pre-drilled holes are spaced every 10¼". To adjust, align arms with pre-drilled holesand bolt in (hardware included). All arms feature lips to prevent product from falling off.Uprights and arms are sold each, not in pairs. Custom rack systems can be designed for yourspecial application.SINGLE-SIDED UPRIGHTSMODELNUMBER HEIGHT BASEARMSTO USEUNIFORM CAPACITY(POUNDS)NET WT.(POUNDS)LIST PRICE(EACH)HU-C-8-18 96" 28¼" 18" 24,700 260 $493.00HU-C-8-24 96" 36½" 24" 21,500 270 503.00HU-C-8-36 96" 48½" 30" / 36" 18,300 / 16,000 290 533.00HU-C-8-48 96" 60½" 42" / 48" 14,200 / 12,800 312 563.00HU-C-10-18 120" 28¼" 18" 24,700 288 $606.00HU-C-10-24 120" 36½" 24" 21,500 307 639.00HU-C-10-36 120" 48½" 30" / 36" 18,300 / 16,000 328 662.00HU-C-10-48 120" 60½" 42" / 48" 14,200 / 12,800 350 682.00HU-C-12-18 144" 28¼" 18" 24,400 340 $667.00HU-C-12-24 144" 36½" 24" 20,900 348 699.00HU-C-12-36 144" 48½" 30" / 36" 17,800 / 15,600 370 711.00HU-C-12-48 144" 60½" 42" / 48" 13,900 / 12,500 390 724.00HU-C-14-18 168" 28¼" 18" 23,400 380 $732.00HU-C-14-24 168" 36½" 24" 20,200 390 752.00HU-C-14-36 168" 48½" 30" / 36" 17,600 / 15,400 410 774.00HU-C-14-48 168" 60½" 42" / 48" 13,700 / 12,400 430 790.00DOUBLE-SIDED UPRIGHTSMODELNUMBER HEIGHT BASEARMSTO USEUNIFORM CAPACITY(POUNDS)NET WT.(POUNDS)DC-20/FC-70LIST PRICE(EACH)HDU-C-8-18 96" 46" 18" 49,400 275 $473.00HDU-C-8-24 96" 58" 24" 43,000 307 504.00HDU-C-8-36 96" 82" 30" / 36" 36,600 / 32,000 350 568.00HDU-C-8-48 96" 106" 42" / 48" 28,400 / 25,600 390 632.00HDU-C-10-18 120" 46" 18" 49,200 300 541.00HDU-C-10-24 120" 58" 24" 42,600 335 567.00HDU-C-10-36 120" 82" 30" / 36" 36,400 / 31,600 386 640.00HDU-C-10-48 120" 106" 42" / 48" 28,200 / 25,200 418 715.00HDU-C-12-18 144" 46" 18" 48,800 350 629.00HDU-C-12-24 144" 58" 24" 41,800 385 657.00HDU-C-12-36 144" 82" 30" / 36" 35,600 / 31,200 430 730.00HDU-C-12-48 144" 106" 42" / 48" 27,800 / 25,000 470 782.00HDU-C-14-18 168" 46" 18" 46,800 390 806.00HDU-C-14-24 168" 58" 24" 40,400 426 844.00HDU-C-14-36 168" 82" 30" / 36" 35,200 / 30,800 468 922.00HDU-C-14-48 168" 106" 42" / 48" 27,400 / 24,800 510 992.00DC-20/FC-70DOUBLE-SIDEDseries HDU-C(shown with arms and brace set)BRACE SETSBRACE SETS CAN BEFOUND ON PAGE 234STORAGE SOLUTIONSSTRAIGHT ARMSseries HSA-C10° INCLINED ARMSseries HIA-CHEAVY-DUTY STRAIGHT ARMSseries HDSA-CSTRAIGHT & INCLINE ARMSCAPACITY(POUNDS) LENGTHNET WT.(LBS.)STRAIGHT ARMSMODEL NUMBERLIST PRICE(EACH)INCLINE ARMSMODEL NUMBERLIST PRICE(EACH)2,500 18" 16 HSA-C-18 $33.00 HIA-C-18 $38.002,000 24" 19 HSA-C-24 37.00 HIA-C-24 39.001,500 30" 21 HSA-C-30 41.00 HIA-C-30 45.001,200 36" 24 HSA-C-36 45.00 HIA-C-36 48.001,100 42" 27 HSA-C-42 48.00 HIA-C-42 56.001,000 48" 30 HSA-C-48 52.00 HIA-C-48 66.00DC-20/FC-70HEAVY-DUTY AND EXTRA HEAVY-DUTY ARMSMODELNUMBERCAPACITY(POUNDS) LENGTHNET WT.(LBS.)LIST PRICE(EACH)HDSA-C-36 2,175 36" 26 $56.00XHDSA-C-36 3,400 36" 30 70.00HDSA-C-42 1,865 42" 29 65.00XHDSA-C-42 2,900 42" 33 80.00HDSA-C-48 1,630 48" 31 71.00HDSA-C-48M 2,000 48" 33 77.00XHDSA-C-48 2,500 48" 36 86.00DC-20/FC-70www.vestil.com Phone (800) 348-0868
234Heavy-Duty Cantilever Racking (continued)Picture of brace set can be found on page 233.STORAGE SOLUTIONSBRACE SETS FOR 8 & 10 FOOT UPRIGHTS (includes two)MODELNUMBERUPRIGHTHEIGHT LENGTHNET WT.(LBS.)LIST PRICE(EACH)HB-C-8-3 96"-120" 36" 29 $58.00HB-C-8-4 96"-120" 48" 35 64.00HB-C-8-5 96"-120" 60" 42 72.00HB-C-8-6 96"-120" 72" 54 116.00HB-C-8-7 96"-120" 84" 61 128.00HB-C-8-8 96"-120" 96" 69 141.00NewNewCantilever CartsMODELNUMBERMODELNUMBEROVERALL SIZE(W x D x H)WIDTHOF LEVELSBRACE SETS FOR 12 & 14 FOOT UPRIGHTS (includes three)MODELNUMBERUPRIGHTHEIGHT LENGTHNET WT.(LBS.)LIST PRICE(EACH)HB-C-14-3 144" - 168" 36" 44 $88.00HB-C-14-4 144" - 168" 48" 54 102.00HB-C-14-5 144" - 168" 60" 64 123.00HB-C-14-6 144" - 168" 72" 84 186.00HB-C-14-7 144" - 168" 84" 95 218.00HB-C-14-8 144" - 168" 96" 107 232.00OVERALLHEIGHTUNIFORM LOADCAPACITY (LBS.)OVERALLDEPTHUNIFORM CAPACITYPER LEVEL (LBS.)QUANTITY OFFLOW LEVELSNET WT.(POUNDS)NET WT.(POUNDS)DC-20/FC-70Portable Cantilever Cart for storage of bar stock type items. Each cart includes three pairs of arms(maximum of eight pair may be used). Arm height adjustable in 6" increments. Arms are securedto cart with a bolt and nut. Lowest arm position is 17½" high; the highest position is 59¼". The8⅛" high base includes built in fork pockets that are 5½"W x 2"H usable. Units roll on (2) rigidand (2) locking swivel 4" x 2" casters. All steel construction with blue powder-coat finish.LIST PRICEEACHCANT-3048 30" x 48" x 63" 2,000 400 175 $496.00CANT-3648 36" x 48" x 63" 2,000 400 200 538.00CANT-3060 30" x 60" x 63" 2,000 400 215 548.00CANT-A30 EXTRA PAIR OF 24" USABLE ARMS 5 $36.00CANT-A36 EXTRA PAIR OF 30" USABLE ARMS 6 45.00CANT-AS30 EXTRA PAIR OF INCLINED 24" USABLE ARMS 5 $36.00CANT-AS36 EXTRA PAIR OF INCLINED 30" USABLE ARMS 6 45.00DC-25/FC-85Heavy Duty Roll-Out ShelvingRoll-out shelving rack stores heavy dies, fixtures and machinery. Capacity per shelf is 1,500 lbs.with a total uniform capacity of 6,000 lbs. Shelves roll out to a full extension for convenientloading and retrieving. Can be easily loaded and unloaded with a crane, overhead hoist, forklift orstacker. Individual shelf height are adjustable on 2⅜" centers. Features 10 gauge steel shelves thatcan be fully extended one at a time and locked in the extended position for maximum safety. Addon units are available. All steel construction with powder coat finish. Ships unassembled.MODELNUMBEROVERALL SIZE(W x D x H)SHELF SIZE(W x D)NUMBEROF SHELVESNET WT.(LBS.)LIST PRICEEACHDESCRIPTIONVRSOR-114 STARTER 114" x 32" x 80" 52" x 32" 4 900 $3,208.00VRSOR-A-114 ADD-ON 54" x 32" x 80" 52" x 32" 4 430 2,085.00VRSOR-SLF ADDITIONAL SHELVES 90 $456.00DC-25/FC-85Carton Flow RacksCartons are gravity fed on rollers for convenient first in / first out stock rotating. Choose thequantity of levels that best fits your application. Each level has a 1,000 pound uniform capacity andincludes four pairs of rollers with 50 pounds per foot capacity. The width of each level is 96". Allmodels are 84" high. Assembly required. Units can be bolted together for additional depth.LIST PRICEEACHFLOW-3-3 96" 84" 36" 3 230 $603.00FLOW-3-4 96" 84" 36" 4 290 764.00FLOW-3-5 96" 84" 36" 5 310 924.00FLOW-4-3 96" 84" 48" 3 245 $683.00FLOW-4-4 96" 84" 48" 4 305 860.00FLOW-4-5 96" 84" 48" 5 370 1,036.00DC-25/FC-85Single/Dual Sided Bar Stock TreesStarter unit includes two uprights and one set of cross braces. Storage room is increased when theadd-on unit is ordered. Add-on unit consists of one upright and one set of cross braces for joiningto the starter set. Uniform capacity is 2,000 pounds per level and 500 pounds per arm. Distancebetween levels is 10". There are 6 arm levels. Choose either single sided or double sided steel rack.Phone (800) 348-0868model BAR-R-84-DMODELNUMBER STYLE DESCRIPTIONOVERALL SIZE(W x D x H)NET WT.(POUNDS)LIST PRICEEACHBAR-R-84-S SINGLE SIDED STARTER UNIT 84" x 38½" x 80½" 253 $442.00BAR-R-84-D DOUBLE SIDED STARTER UNIT 84" x 38½" x 80½" 322 553.00BAR-A-84-S SINGLE SIDED ADD-ON UNIT 84" x 38½" x 80½" 120 $244.00BAR-A-84-D DOUBLE SIDED ADD-ON UNIT 84" x 38½" x 80½" 155 294.00DC-20/FC-85www.vestil.com
Double Sided Horizontal Bar RackIdeal for use in maintenance departments, tool rooms, machine shops, and storage areas. Armsextend and act as dividers creating bays of storage. Nine arm levels of varying lengths can storematerial up to 10 feet long. Aligning two units next to each other will allow for the storageof longer material. Arm edges are sloped upward to prevent roll off's. Arms are welded at 6"increments with 6" between levels. Total uniform rack capacity is an 2,600 pounds evenlydistributed load. Unit is supplied with lag down points and ship knockdown. Steel construction.235MODELNUMBERMODELNUMBERMODELNUMBEROVERALL SIZE(W x D x H)OVERALL SIZE(W x D x H)NUMBEROF BAYSNUMBEROF BAYSDISTANCEBETWEEN BAYSDISTANCEBETWEEN BAYSNET WT.(POUNDS)NET WT.(POUNDS)LIST PRICEEACHSSRT-47 48½" x 24" x 61" 4 9¾" 234 $445.00SSRT-47-HP 48½" x 36" x 92" 4 9¾" 289 615.00DC-20/FC-125LIST PRICEEACHVBR-9 39¼" x 24" x 84½" 3 21" 144 $248.00DC-20/FC-125MODELNUMBEROVERALLWIDTHOVERALLDEPTHTYPEOVERALLHEIGHTARMLEVELSOVERALL SIZE(W x D x H)DISTANCEBETWEEN LEVELSDISTANCEBETWEEN BAYSNET WT.(POUNDS)NET WT.(LBS.)LIST PRICEEACHDSHZ-4 30" 30" 83¾" 9 6" 110 $314.00DC-20/FC-85Vertical Storage RackDesigned for vertical storage of tubing, pipe, and other types of similar materials. Organize pipes,and extrusions with odd lengths instead of discarding them. Each rack has (4) bays that measure9¾" wide each and handle a uniform capacity of 1,500 pounds per bay. A restraint chain securelyholds items in storage bays. Fully welded steel construction with powder coat blue finish. Unit isshipped with lag down points.Vertical Bar RackDesigned for storage of long parts close to the work site. Long pieces stack vertically while shorterparts are kept horizontal on the three pan shelves. Designed to be placed up against a wall. Unit issupplied with lag down points. Includes a restraint chain to hold items in each bay. The uniformcapacity is 3,000 pounds when evenly distributed. Welded steel construction. Painted finish.Expandable Vertical Bar RackDesigned for storage of long parts. Designed to be placed up against a wall. Order starter rack thenextension rack for added width. Each rack includes three (3) adjustable dividers. Multiple units may bejoined in-line or back-to-back. Total uniform capacity is 4,000 pounds when evenly distributed. Weldedsteel construction with blue painted finish. Ships knock-down, assembly required.LIST PRICEEACHEVR-59-S STARTER RACK 53" x 22" x 59" 4½" 128 $355.00EVR-59-EXT EXTENSION RACK 51" x 22" x 59" 4½" 97 295.00EVR-106-S STARTER RACK 53" x 23" x 106" 4½" 197 $495.00EVR-106-EXT EXTENSION RACK 51" x 23" x 106" 4½" 144 400.00DC-20/FC-125Horizontal Sheet RackDesigned for storage of sheet goods and similar materials. Flat storage reduces warping of thinmaterials. Five shelf design allows for generous storage of multiple thickness materials. Distancebetween shelves is 9½". All welded steel frame allows for 2,000 pound uniform capacity per shelf.Four sided access when using 4' x 8' sheet or smaller. Supplied with lag down points.MODELOVERALL SIZE NUMBER OF DISTANCE BETWEEN NET WT. LIST PRICENUMBER(W x H x L) SHELVES SHELVES (POUNDS) EACHSHEET-R-57 54½" x 48" x 102¾" 5 9½" 564 $1,139.00Standard Sheet RackDC-20/FC-92.5/125Designed for vertical storage of sheet goods. Standard unit comes with four bays. Intermediatefloor bracing gives added steel support while keeping material off the floor. Uniform capacityper bay is 1,500 pounds. Unit is supplied with lag down points. Powder coat finish.NewNewSTORAGE SOLUTIONSMODELNUMBEROVERALL SIZE(W x L x H)NUMBEROF BAYSDISTANCEBETWEEN BAYSNET WT.(POUNDS)LIST PRICEEACHVSSR-15 50" x 84" x 44" 4 10" 400 $1,035.00DC-20/FC-125www.vestil.com Phone (800) 348-0868
236NewVariable Height Sheet RacksStore various sizes of sheet goods in the vertical position for easy viewing of stock. These sheetracks are perfect for use with multiple sizes of material. Four different bays with heights from14" to 40" increase visibility of stored materials. Available in all welded steel construction,model VHSR-4 and VHSR-8, or bolt together construction, model VHSR-4B. Bolt-togetherunits feature adjustable-width uprights. Uniform capacity per bay is 1,500 pounds. Unit issupplied with lag down points. Powder coat blue finish.NewMODELNUMBEROVERALL SIZE(W x D x H)NUMBER OFBAYSDISTANCEBETWEEN BAYSNET WT.(POUNDS)LIST PRICEEACHVHSR-4 47" x 36" x 40" 4 6¾" 200 $551.00VHSR-8 90" x 36" x 60" 4 6¾" 380 890.00VHSR-4B 47" x 36" x 40" 4 6¾" 190 $571.00DC-20/FC-70/125Internestable Portable Stackable Rack Systemswith Adjustable & Fixed PostsSTORAGE SOLUTIONSmodelNEST-F-4848Fixed HeightRemovable Posts(set of 4)series POSTmodelBASE-4848Newmodel V-1Unique transport and storage racks will stack and nest for maximum versatility. Remove orchange post height depending on application. All heights noted are for load heights. Each unitfeatures a uniform capacity of 4,000 pounds. Design allows for stacking up to two (2) unitshigh. Solid steel deck construction. Rugged welded steel construction with painted blue finish.Large target and pintle for speedy alignment. Units are available with fork lift pockets, soliddecking and caster kits upon request. Powder coat blue finish.MODELNUMBER WIDTH LENGTHNET WT.(POUNDS)LIST PRICEEACHNON-REMOVABLE ADJUSTABLE POSTS 30" - 36"H IN 1" INCREMENTSNEST-F-4848 48" 48" 150 $390.00NEST-F-6048 60" 48" 170 408.00MODELNUMBERQUANTITYPER BOXNET WT.(POUNDS)LIST PRICEEACHLENGTHFIXED HEIGHT REMOVABLE POSTS (SET OF FOUR)POST-24 24" 4 40 $68.00POST-36 36" 4 50 78.00POST-48 48" 4 60 89.00MODELNUMBER WIDTH LENGTHNET WT.(POUNDS)LIST PRICEEACHBASE ONLYBASE-4848 48" 48" 90 $220.00BASE-6048 60" 48" 110 238.00DC-20/FC-100Versa RacksThese racks provide versatility, efficiency, and durability. Great for transportation and storage.Remove or change post height depending on application. Double post pins provide supportup to 4,000 uniform pounds stacked up to five (5) units high; three (3) high on 24" and 36"models. Large target and pintle for speedy alignment. Rugged welded steel constructionwith powder coat yellow finish. Four-way fork entry on all models. Custom sizes andconfigurations are available upon request.Model V-1, has four adjustable-height non-removable posts, fixed base targets, 4-way fork entry,and solid steel deck. The usable height is adjustable in 1" increments from 11¼" to 17¼".Model V-3, is a stand/cart which has 8" phenolic wheels and a floor lock. Features 12" highnon-removable fixed-height corner posts. Overall height is 30". These carts may be stacked nomore than 2 units high.Model V-4, is a versa rack pallet with no posts or sockets. Solid deck steel pallet is great fordurability. 4-way entry for convenience.Model V-2, is a versa rack base only with no posts. Sockets included.SecurelyStackablemodel V-3model V-4MODELNUMBERSIZE(W x L)NET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONV-1 BASE W/NON-REMOVABLE POSTS 48" x 42" 125 $379.00V-3 STAND/CART 48" x 42" 210 630.00V-4 BASE, NO POSTS OR SOCKETS 48" x 42" 100 291.00V-2 BASE ONLY, NO POSTS 48" x 42" 110 324.00VP-4 REMOVABLE POST KIT 4" H 15 $45.00VP-12 REMOVABLE POST KIT 12" H 25 57.00VP-24 REMOVABLE POST KIT 24" H 40 68.00VP-36 REMOVABLE POST KIT 36" H 50 78.00DC-20/FC-100Phone (800) 348-0868www.vestil.com
Internestable Stackable RacksSpace saving storage is what this rack is all about. The 4" underclearance allows for easy forktruck accessibility. Units can stack up to 20 feet high. Sturdy, welded construction gives theseunits an abundance of strength and stability. (A) Special redundant stacking systems allow unitsto be internested for space saving storage when not in use. (B) Flared posts, pintle and target,make it easy to line up units for stacking. (C) Optional fold down post available upon request.MODELNUMBERMODELNUMBERMODELNUMBERUSABLE(W x D x H)OVERALL SIZE(W x D x H)OUTSIDE SIZE(W x D x H)OVERALL(W x D x H)MODELNUMBER DESCRIPTION HEIGHTINSIDE SIZE(W x D x H)INSIDE DIMENSION(W (bottom) x W (top) x H)UNIFORMCAPACITY (LBS.)UNIFORMCAPACITY (LBS.)UNIFORMCAPACITY (LBS.)UNIFORMCAPACITY/PAIRNET WT.(POUNDS)NET WT.(POUNDS)NET WT.(POUNDS)NET WT.(POUNDS)LIST PRICEEACHNEST-106 48" x 42" x 48" 57" x 46" x 58" 4,000 288 $385.00NEST-215 60" x 42" x 48" 69" x 46" x 58" 4,000 320 411.00NEST-210 48" x 48" x 48" 57" x 54" x 58" 4,000 306 431.00NEST-230 60" x 48" x 48" 69" x 54" x 58" 4,000 340 458.00Long Bar Pigeon Hole RackDC-20/FC-100Ideal for mixed storage of long items. Five-hole high and three-hole wide frame allowsfor easy identification and retrieval of materials. Frames are held in place by separator andbracing bars. 7,700 pound uniform capacity per frame. Extension bay kit, model LBPH-EXT, consists of one frame and one set of cross braces for joining to the starter set. Uniformcapacity is 2,000 pounds per level or 7,700 per frame. Steel construction.MODELNUMBERDESCRIPTIONOVERALL SIZE(W x D x H)NUMBEROF BAYSNET WT.(POUNDS)LIST PRICEEACHLBPH-77 STARTER UNIT 48½" x 48" x 60" 15 260 $792.00LBPH-EXT EXTENSION BAY KIT 48½" x 48" x 60" 15 167 514.00DC-20/FC-50Economical <strong>Material</strong> RacksModel SR-WM is a wall mounted unit with dual 60" high supports. They come with (3) 15"arms and (4) 12" arms. The 15" arms have 9" height clearance and the 12" arms have 7¼"clearance. Uniform load capacity is 1,000 pounds. The bright zinc plating provides a long term,attractive appearance. Shipped knockdown with convenient and quick assembly.Model SR-SS is a self-supporting 66" high A-frame with 7 storage levels. Arms extend up to 12"beyond A-frame. Base dimensions are 60" by 36". Shipped knocked down with convenient andquick assembly. Bright zinc plated.Model SR-V is a floor-mounted vertical material rack. Features four storage bays.Ships knockdown with convenient and quick assembly. Bright zinc plated finish.LIST PRICEEACHSR-WM WALL MOUNT 60" 1,000 25 $58.00SR-SS SELF SUPPORTING 66" 2,000 70 102.00SR-V FLOOR MOUNTED 72" 2,000 68 125.00DC-20/FC-50/70Stackable Bar CradlesThese sturdy, welded steel racks are strong enough to handle heavy loads yet light enough to be set upby one person. Stackable up to five units high. Allows for custom design by choosing length, depth, andheight of individual storage systems. Welded steel construction with blue painted surface.LIST PRICEEACHCRAD-25 12" x 16" x 13½" 8" x 12" x 12" 2,500 21 $64.00CRAD-25-30 12" x 30" x 13½" 8" x 12" x 12" 2,500 32 117.00CRAD-25-44 12" x 44" x 13½" 8" x 12" x 12" 2,500 44 156.00CRAD-25-58 12" x 58" x 13½" 8" x 12" x 12" 2,500 55 193.00CRAD-25-72 12" x 72" x 13½" 8" x 12" x 12" 2,500 66 230.00CRAD-37 14" x 19" x 17" 10" x 15" x 15" 3,700 37 $84.00CRAD-56 15" x 22" x 20½" 11" x 18" x 18" 5,600 46 95.00CRAD-75 16" x 26" x 23½" 12" x 22" x 20" 7,500 72 128.00DC-20/UPS/FC-85Portable Storage U-RackThese Storage Racks can be stacked up to four units high. Built-in safety stops prevent uprightspread. Easy to set up and tear down and great for temporary locations. All welded steelconstruction for years of dependable service. Maximum 4 units high.LIST PRICEEACHU-RACK-6 25" x 4" x 19" 16" x 21½" x 15½" 6,000 LBS. 31 $48.00U-RACK-10 25" x 4½" x 19" 15½" x 21½ x 17" 10,000 LBS. 33 77.00DC-25/FC-100Shown with (1) LBPH-77and (1) LBPH-EXTmodelSR-WMNewmodelSR-V(A)(B)(C)237modelSR-SSSTORAGE SOLUTIONSwww.vestil.com Phone (800) 348-0868
238Reel RacksStore and dispense poly or wire rope, hose, electrical cable, or chain. 96" units have 3 pairs of axlebrackets; 120" units have 4 pairs of axle brackets (add'l brackets available, contact factory). Theaxle brackets are adjustable on 2" centers and accept axles up to 2¼" in diameter. Adjustablebrackets allow you to stagger arms along the frame for different size reels. 2⅜" diameter axles areincluded with reel rack. Uniform capacity per level is 2,000 pounds. Assembly required. Unitsmust be secured to floor unless ordering Double Sided Portable Reel Racks.NewWIRE-D-Emodel RERC-MODELNUMBERSTARTER KITSOVERALLWIDTHOVERALLDEPTHOVERALLHEIGHTINCLINETOTAL UNIFORMCAPACITY (LBS.)NET WT.(LBS.)LIST PRICEEACHRERC-338 39" 36" 96" 71° 6,000 169 $579.00RERC-438 51" 36" 96" 71° 6,000 178 597.00RERC-3310 39" 36" 120" 77° 6,000 212 632.00RERC-4310 51" 36" 120" 77° 6,000 223 654.00ADD-ON SECTIONSRERC-A-338 39" 36" 96" 71° 6,000 110 $384.00RERC-A-438 51" 36" 96" 71° 6,000 119 461.00RERC-A-3310 39" 36" 120" 77° 6,000 137 494.00RERC-A-4310 51" 36" 120" 77° 6,000 148 486.00DOUBLE SIDED PORTABLE REEL RACKS* - (4) SWIVEL & (2) RIGID 8" x 2" GLASS-FILLED NYLON CASTERSRERC-CT-368 39" 72" 96" 71° 6,000 370 $1,268.00RERC-CT-468 51" 72" 96" 71° 6,000 400 1,304.00RERC-CT-3610 39" 72" 120" 77° 6,000 470 1,374.00RERC-CT-4610 51" 72" 120" 77° 6,000 495 1,418.00*COMPLETE UNIT NO ADD-ON SECTIONS AVAILABLEDC-20/FC-85STORAGE SOLUTIONSWIRE-D shown withWIRE-D-SHD-HRWire reelsare not included.WIRE-D-WHKWIRE-DmodelSHOP-DOEconomy Wire Reel CaddyDesigned to easily move wire reels where you need them the most. May dispense wire in verticaland horizontal position. Caddy includes eleven (11) spool bars for handling various size reels.Three (3) large 1-1/6" diameter axles handle 14" maximum reel diameter while the eight (8)smaller ¾" diameter axles handle 7" maximum reel diameter. Includes a storage tray on top foradded versatility. Portable with 6" diameter semi-pneumatic wheels and 43½" high handle.Total uniform capacity is 110 lbs. (90 lbs. on large spindles and 60 lbs. on small spindles). Steelconstruction with painted finish. Ships knockdown.MODELNUMBERDESCRIPTIONOVERALL SIZE(W x D x H)NET WT.(LBS.)LIST PRICEEACHWIRE-D-E ECONOMY WHEEL REEL CADDY 17¾" x 19½" x 43¼" 35 $239.00Wire Reel CaddyMODELNUMBERDESCRIPTIONOVERALL SIZE(W x L x H)NET WT.(LBS.)DC-25/FC-85Portable Wire Reel Caddy is designed to easily move wire reels where you need them the most.Dispense wire in vertical or horizontal position. Includes four spool bars for handling varioussize reels. Bottom of caddy includes wire guide holes for quick access. Built-in hand hole forportability. Steel construction with painted finish. Unit can be mounted onto a wall or you cantransport with an optional hand truck. Uniform capacity is 300 lbs.LIST PRICEEACHWIRE-D STAND-ALONE UNIT 22¼" x 16" x 44¼" 45 $189.00WIRE-D-WHK PORTABLE UNIT (CASTERS & HANDLE) 24" x 16" x 51¼" 58 280.00WIRE-D-SHD-PN HAND TRUCK (PNEUMATIC WHEELS) 22" x 19" x 52" 51 $55.00WIRE-D-SHD-HR HAND TRUCK (HARD RUBBER WHEELS) 22" x 19" x 52" 64 62.00HAND TRUCK CAPACITY IS 600 LBS.DC-25/FC-85Shop DesksIdeal for supervisors, shipping and receiving, or anyone who works on their feet. Sloped top forergonomic comfort while standing and working. Features roomy writing surface and storage area.Legs are adjustable in 1½" increments. Cabinet unit comes with built-in lock doors and all unitscome with a lockable drawer. Drawer size is 24"W x 28"D x 3½"H. Units ship knockdown forfreight savings.Phone (800) 348-0868modelSHOP-DWmodelSHOP-DCMODELNUMBERDESCRIPTIONOVERALL SIZE(W x D x H)NET WT.(POUNDS)LIST PRICEEACHSHOP-DO OPEN SHOP DESK 36" x 31" x 49" 84 $203.00SHOP-DC CABINET SHOP DESK 35½" x 33¾" x 49" 132 311.00SHOP-DW WALL MOUNTED DESK 25" x 24" x 9" 28 110.00DC-25/UPS/FC-70www.vestil.com
239Work Center SystemOur Work Center system offers a multitude of possible layouts. The desks have a heavy-dutysteel frame with open legs. Cabinets are 18"W x 21"D x 32"H. Factory-welded storagepedestals include 100 pound uniform capacity drawers mounted on a ball bearing mechanism.Standard frame color is light grey. A large variety of accessories and colors can customize yourtable, contact factory. Assembly required.MODELNUMBEROVERALL SIZE(W x D x H)NET WT.(POUNDS)LIST PRICEEACHDESCRIPTION / NUMBER OF DRAWERSVWSA-5031 WOOD COMPOSITE TOP, DESK 60" x 30" x 34" 147 $410.00VWSA-2031 LAMINATE TOP, DESK 60" x 30" x 34" 121 571.00VCAB-A CABINET / (4) 6" 18" x 21" x 32" 80 465.00VCAB-B CABINET / (2) 3", (1) 6", (1) 12" 18" x 21" x 32" 77 467.00VCAB-C CABINET / (2) 3", (3) 6" 18" x 21" x 32" 84 518.00DC-20/FC-70modelVWSA-5031Modular CabinetsThe Modular Cabinet has been completely re-engineered in order to better respond to ourcustomer needs. These cabinets have a 400 pound uniform capacity per drawer. Drawers are100% accessible and have a new ergonomic handle designed down to the smallest details tomake it work easier. Life time warranty on the rolling mechanism. Fork lift base and lockingmechanism are included on the modular cabinets.modelVCAB-CmodelVCAB-BmodelVCAB-AMODELNUMBEROVERALL SIZE(W x D x H)NUMBEROF DRAWERSUNIFORM CAPACITYPER DRAWER (LBS.)NET WT.(POUNDS)LIST PRICEEACHDC-5803 36" x 24" x 60" 11 400 658 $2,432.00DC-5831 36" x 24" x 60" 8 400 578 1,936.00DC-4407 36" x 24" x 46" 11 400 589 2,420.00DC-4409 36" x 24" x 46" 7 400 458 1,731.00DC-6024 60" x 24" x 60" 19 400 1145 5,164.00DC-6030 60" x 24" x 60" 20 400 1180 5,349.00DC-20/FC-70Mobile CabinetThe Mobile Cabinet is one of the safest on the market. The Lock-In mechanism is activatedwith one hand, leaving the other hand free. 6" x 2" polyurethane casters with high quality rollingsystems make moving the cabinet easy. Non-marking casters, (2) rigid and (2) swivel with brakestandard. The drawers have a uniform capacity of 400 pounds evenly distributed and roll easily.A locking mechanism is included.modelDC-5803modelMDC-4824-SCmodelDC-4407STORAGE SOLUTIONSMODELNUMBEROVERALL SIZE(W x D x H)NUMBEROF DRAWERSUNIFORM CAPACITYPER DRAWER (LBS.)NET WT.(POUNDS)LIST PRICEEACHMDC-3624 36" x 24" x 39¼" 6 400 373 $2,009.00MDC-4824 48" x 24" x 45½" 14 400 565 3,878.00MDC-4824-SC 48" x 24" x 47¼" 7 400 750 2,763.00DC-20/FC-70modelMDC-4824Visibility Storage LockersVisibility lockers provide secure and visible storage for equipment, tools, and other valuableitems. Locker sides and front door are made of 8 gauge galvanized welded wire mesh, with 1½"x 3" openings. Door has a padlock hasp (padlock not included). Frame is made of 14 gauge1¼" x ⅝" c-channel, and roof, back and bottom panels are made of 22 gauge sheet material.Ships fully assembled.NewMODELNUMBEROVERALL SIZE(W x D x H) SHELVESNET WT.(POUNDS)LIST PRICEEACHVSL-1818 18" x 18" x 72" 5 80 $460.00VSL-1836 36" x 18" x 80" 5 107 575.00VSL-2436 36" x 24" x 80" 3 114 675.00VSL-3030 30" x 30" x 80" 3 120 625.00VSL-3636 36" x 36" x 80" 3 135 850.00DC-20/FC-125www.vestil.com Phone (800) 348-0868
240Safety Flammable CabinetsAll welded double wall 18 gauge inside construction, 14 gauge outside construction with 1½" insulatingair space. Each unit contains 2" leakproof sill to contain leaks. Lockable flush mounted handle (gripperpad) with 2 keys included. Adjustable leveling feet for various floor surfaces. Galvanized steel shelvesadjust on 2½" centers. Manual close doors open to a full 180°. Self close doors shut, index, and latchautomatically as fusible link melts under fire conditions at 165°. Meets OSHA and NFPA code 30standards. Powder coated yellow finish.STORAGE SOLUTIONSmodel VBM-45model VBA-16model VSC-3501-102model VSC-JC-137MODELNUMBEROVERALL SIZE(W x D x H)CAPACITY(GALLONS)NUMBEROF SHELVESDOORTYPESNET WT.(LBS.)LIST PRICEEACHTWO DOORSVBM-22 34" x 18" x 35" 22 1 MANUAL 170 $439.00VBM-30 43" x 18" x 44" 30 1 MANUAL 240 485.00VBM-45 43" x 18" x 65" 45 2 MANUAL 330 585.00VBM-90 43" x 34" x 65" 90 2 MANUAL 440 969.00VBS-30 43" x 18" x 44" 30 1 SELF CLOSE 250 $576.00VBS-45 43" x 18" x 65" 45 2 SELF CLOSE 340 676.00VBM-GS-134 34" x 18" ADDITIONAL GALVANIZED SHELVES 4 $59.00VBM-GS-143 43" x 18" ADDITIONAL GALVANIZED SHELVES 4 59.00VBM-GS-334 34" x 34" ADDITIONAL GALVANIZED SHELVES 7 59.00VBM-GS-343 43" x 34" ADDITIONAL GALVANIZED SHELVES 7 59.00ONE DOORVBA-12 23" x 18" x 35" 12 1 MANUAL 140 $348.00VBA-16 23" x 18" x 44" 16 2 MANUAL 170 422.00VBA-24 23" x 18" x 65" 24 3 MANUAL 230 476.00VBJ-12 23" x 18" x 35" 12 1 SELF CLOSE 148 $403.00VBJ-16 23" x 18" x 44" 16 2 SELF CLOSE 178 476.00VBJ-24 23" x 18" x 65" 24 3 SELF CLOSE 238 530.0055 GALLON DRUM - TWO DOORSVBV-1 34" x 34" x 65" -- -- MANUAL 366 $640.00VBV-2 59" x 34" x 65" -- -- MANUAL 520 1.152.00VBW-1 34" x 34" x 65" -- -- SELF CLOSE 386 $730.00DC-20/FC-100/125Bin Storage CabinetsThe Bin Storage Cabinets are designed for high density storage and organization of parts. These cabinetsoffer easy accessibility to contents while maintaining cleanliness and security. Available in three sizes: 60"wide, 48" wide and 36" wide, each with different configurations of bins and/or shelves. Bins are made ofa durable polyethylene with molded-in back hook for secure hanging. Front edges are lowered for bettervisibility and easier part picking. When not in use bins can be stacked on shelves, worktables, carts, orother flat surfaces. *Back and door louvered panels for customized configurations.MODELNUMBEROVERALL SIZE(W x L x H)NET WT.(LBS.)LIST PRICEEACHBIN CAPACITYVSC-3501-132 132: 48 (A), 48 (B), 18 (C), 12 (D), 6 (E) 36" x 24" x 72" 400 $1,033.00VSC-3501-102 102: 48 (A), 48 (B), 6 (E) 36" x 24" x 72" 425 1,001.00VSC-3501-NB Custom Configurations* 36" x 24" x 72" 300 677.00VSC-JC-171 171: 64 (A), 64 (B), 13 (D), 6 (E) 48" x 24" x 78" 521 $1,342.00VSC-JC-137 137: 64 (A), 64 (B), 3 (D), 6 (E) 48" x 24" x 78" 533 1,252.00VSC-JC-NB Custom Configurations* 48" x 24" x 78" 410 864.00VSC-SSC-227 227: 80 (A), 90 (B), 30 (C), 18 (D), 9 (E) 60" x 24" x 84" 657 $1,447.00VSC-SSC-185 185: 80 (A), 90 (B), 6 (D), 9 (E) 60" x 24" x 84" 874 1,336.00VSC-SSC-NB Custom Configurations* 60" x 24" x 84" 700 946.00HOOK-ON BINSVSPB-3021 (A) 4" x 5" x 3" 1 $2.80VSPB-3022 (B) 4" x 7" x 3" 1 3.00VSPB-3023 (C) 6" x 11" x 6" 1 7.00VSPB-3024 (D) 8" x 15" x 7" 2 11.00VSPB-3025 (E) 16" x 15" x 7" 3 17.00SHELVESVBSH-6018 Adjustable Shelves for VSC-SSC series 60" x 18" 25 $80.00VBSH-4818 Adjustable Shelves for VSC-JC series 48" x 18" 23 75.00VBSH-3618 Adjustable Shelves for VSC-3501 series 36" x 18" 17 66.00DC-20/UPS/FC-70model VSC-SSC-227Keyed Handle Lockcomes standard withmodels VSC-3501and VSC-JC.Padlock Handlecomes standard withmodel VSC-SSC.Padlock is not included.Phone (800) 348-0868www.vestil.com
Stainless Steel Solid Rivet ShelvingHigh quality stainless steel solid shelving is made of type 304 stainless steel construction with brushedfinish. Each model includes five (5) adjustable shelves with a uniform capacity of 600 lbs. per shelf.The 18 gauge thick shelves are adjustable in 1½" increments. Two-piece corner posts design includesplastic connectors. Shipped knock-down, easy assembly.MODELNUMBERSHELF SIZE(W x L)OVERALLHEIGHTUNIFORM CAPACITYPER SHELF (POUNDS)NET WT.(POUNDS)LIST PRICEEACHLWSS-1836 18" x 36" 72" 600 96 $479.00LWSS-1848 18" x 48" 72" 600 117 599.00LWSS-2436 24" x 36" 72" 600 114 $568.00LWSS-2448 24" x 48" 72" 600 139 677.00Stainless Steel ShelvingDC-25/FC-100Provide easy access to stored items from all sides. High-quality stainless steel (type 304 with a #4brushed finish) construction is ideal for the commercial or industrial use. Each model includes fouradjustable shelves ideal for different height products. Shelves are 18 gauge thick and hold up to 600pounds each (uniform load). Units ship knock-down and requires assembly.New241MODELNUMBERSHELF SIZE(W x L)OVERALLHEIGHTUNIFORM CAPACITYPER SHELF (POUNDS)NET WT.(POUNDS)LIST PRICEEACHSSS-1836 18" x 36" 74" 600 110 $796.00SSS-1848 18" x 48" 74" 600 135 899.00SSS-2436 24" x 36" 74" 600 129 909.00SSS-2448 24" x 48" 74" 600 158 1,080.00Plastic Bulk Shelving & StorageMODELNUMBERNUMBEROF SHELVESSHELF SIZE(W x L)OVERALLHEIGHTTOTAL UNIFORMCAPACITY (LBS.)NET WT.(POUNDS)DC-25/FC-100Largest all-purpose industrial-grade shelving system in the industry. Our unique locking collar systemlets you choose whether to build up, out our both. Our rigid high-density polyethylene panels area stout 2⅝" thick with a grid top that allows liquids to flow through, promotes air circulation andprevents dust build up. Optional drip trays available for different applications, contact factory. Theentire system is chemically resistant, making it an ideal choice for HAZMAT storage or any otherapplications, corrosive or not.LIST PRICEEACHPBSS-3616-3 3 36" x 16" 51" 500 35 $159.00PBSS-3624-3 3 36" x 24" 51" 750 41 198.00PBSS-6624-3 3 66" x 24" 51" 1,390 64 325.00PBSS-9624-3 3 96" x 24" 51" 2,025 102 398.00PBSS-3616-4 4 36" x 16" 75" 675 48 $228.00PBSS-3624-4 4 36" x 24" 75" 1,000 56 279.00PBSS-6624-4 4 66" x 24" 75" 1,850 88 450.00PBSS-9624-4 4 96" x 24" 75" 2,700 139 554.00DC-20/FC-100Newmodel PBSS-9624-4STORAGE SOLUTIONSSecurity CabinetsStand-alone Security Cabinets are specifically designed to secure small to medium sized productswhere they are stored - on the sales floor, in the back room, or in the receiving area. Open meshdesign allows for quick visual inspection and will not deter sprinkler systems. Units are not toexceed 1,000 lbs. Shelves are sold separately. Panels are constructed of 8 gauge galvanized weldedwire grid with 1½" x 3" openings. The frame is constructed of 2" x 2" 14 gauge galvanized steelframe. Industrial graded hinged doors feature built-in cylinder lock. Shelves are 4 gauge galvanizedwelded wire grid with 1½" x 3" openings or 20 gauge galvanized steel panels.NewMODELNUMBEROVERALL SIZE(W x D x H)UNIFORMCAPACITY/SHELFNET WT.(LBS)LIST PRICEEACHDESCRIPTIONVLPSC-4030-6 HINGE SINGLE DOOR 48" x 30" x 72" 200 254 $1,549.00VLPSC-4030-8 HINGE SINGLE DOOR 48" x 30" x 96" 200 296 1,712.00VLPSC-8030-6 HINGE DOUBLE DOOR 96" x 30" x 72" 200 420 $2,408.00VLPSC-8030-8 HINGE DOUBLE DOOR 96" x 30" x 96" 200 482 2,623.00VLPSC-WS-30 WIRE GAUGE SHELF 44" x 26" -- 29 $62.00VLPSC-SS-30 SOLID STEEL SHELF 44" x 26" -- 17 80.00DC-20/FC-125model VLPSC-4030-6www.vestil.com Phone (800) 348-0868
STORAGE SOLUTIONS242NewPhone (800) 348-0868WBT-S-4824WBT-G-4824NewNewSHOWN WITH OPTIONALCASTERS AND FORK POCKETSCASE-1814NewPlastic Work BenchEasy up, easy down and two easy ways to change them around! Our Work-Bench can be set up inminutes to create an instant temporary or permanent island of productivity within any warehousemanufacturing floor or office environment. Pick from four sizes to fit virtually any need. Ouroriginal grid-top is ideal when work produces small scrap that can clutter work surfaces. Chooseour solid top panel option for tough jobs that require a clean, flat work surface.MODELNUMBERMODELNUMBEROVERALL SIZE(W x D x H)UNIFORM CUBICFEET CAPACITYNET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONUBX-Y-NW NO WHEELS 48"W x 31"D x 31½"H 15 60 $332.00UBX-Y-W 5" WHEELS 48"W x 31"D x 38"H 15 68 456.00DC-20/FC-200MODELNUMBERDESCRIPTIONOVERALL SIZE(W x D x H)OVERALL SIZE(W x D x H)TOTAL UNIFORMCAPACITYUNIFORMCAPACITYNET WT.(LBS.)NET WT.(LBS.)LIST PRICEEACHDESCRIPTIONWBT-S-3624 SOLID TOP/GRID LOWER 36" x 24" x 36" 580 lbs. 31 $140.00WBT-S-4824 SOLID TOP/GRID LOWER 48" x 24" x 36" 785 lbs. 41 225.00WBT-S-6624 SOLID TOP/GRID LOWER 66" x 24" x 36" 1,070 lbs. 53 235.00WBT-S-9624 SOLID TOP/GRID LOWER 96" x 24" x 36" 1,555 lbs. 76 275.00WBT-G-3624 GRID TOP/GRID LOWER 36" x 24" x 36" 500 lbs. 29 $127.00WBT-G-4824 GRID TOP/GRID LOWER 48" x 24" x 36" 688 lbs. 39 215.00WBT-G-6624 GRID TOP/GRID LOWER 66" x 24" x 36" 925 lbs. 48 220.00WBT-G-9624 GRID TOP/GRID LOWER 96" x 24" x 36" 1,350 lbs. 70 260.00DC-20/FC-125Folding ContainerRequires minimum storage space when not in use.MODELOUTSIDE DIMENSIONSFOLDED NET WT. LIST PRICENUMBER(W x D x H)HEIGHT (POUNDS) EACHF-CRATE 23½" x 18½" x 12" 3" 8 $26.40Utility BoxesMODELNUMBER WIDTH DEPTH HEIGHT THICKNESSNET WT.(LBS.)LIST PRICEEACHAPTS-2448 48" 24" 24" 1/8" 97 $301.00APTS-3648 48" 24" 36" 1/8" 132 389.00APTS-2460 60" 24" 24" 1/8" 114 $357.00APTS-3060 60" 24" 30" 1/8" 117 376.00APTS-3660 60" 24" 36" 1/8" 162 531.00(4) CASTERS 5" x 2", MODEL APTS-C, $54.00 DC-25/UPS/FC-85FORK POCKETS 7-1/2" x 2-1/2", MODEL APTS-F, $111.00MODELNUMBERDESCRIPTIONOVERALL SIZE(W x D x H)NET WT.(POUNDS)DC-25/FC-70/100These versatile utility boxes can be used for spill kits, storage bins, and much more. Forkliftaccessible, able to be locked, and has a heavy-duty, double walled lid, which is sloped to shedmoisture. Model UBX-Y-W rolls smoothly on 5" solid rubber wheels. Units are also available inforest green and safety orange, contact factory for pricing.Aluminum Tread Plate Portable Tool BoxesSecure your tools and other belongings from theft with our Portable Tool Boxes. Safety latchfor padlock securing. Padlock is not included. Constructed of ⅛" thick diamond tread platematerial. Features two sturdy handles for transporting. Uniform capacity is 2,500 lbs.Aluminum Tool CaseRugged textured aluminum storage case with rounded corners. Lid interior includes removablepanel with 13 storage pouches and 4 sleeves. Lower storage area includes segmented walls andadjustable panels in 1/4" increments. Molded plastic carrying handle. Includes removableshoulder strap. Quality locking latches included with two keys.LIST PRICEEACHCASE-1814 ALUMINUM TOOL CASE 18" x 14" x 6" 6 $29.00DC-25/FC-70Aluminum Storage CasesNestable Aluminum Storage Cases keep contents clean and dry. Dual lock and hasps offer extrasecurity. Durable and attractive embossed surface with caps on each corner to minimize damage.LIST PRICEEACHCASE-L LARGE STORAGE CASE 24" x 18" x 20" 44 LBS. 19 $126.00CASE-M MEDIUM STORAGE CASE 21½" x 16¼" x 19¼" 40 LBS. 15 93.00CASE-S SMALL STORAGE CASE 19" x 14¼" x 16¼" 33 LBS. 13 71.00CASE-A SET OF THREE CASES -- -- 46 $276.00DC-25/FC-70www.vestil.com
Rugged Aluminum Storage ContainersRugged aluminum storage containers are constructed out of 100% aluminum. Each container includestwo carrying handles for easy transportation. Rounded corners protect the user. Sheet thickness is 20gauge. Same size containers are not stackable.New243MODELNUMBER WIDTH LENGTH HEIGHTMODELNUMBERUNIFORMCAPACITY (LBS.)OVERALL SIZE(W x D x H)MESHWIRE GAUGEMESHOPENINGNET WT.(POUNDS)NET WT.(POUNDS)LIST PRICEEACHALC-20 14" 20" 14" 5 $60.00ALC-21 15½" 21½" 14½" 6 68.00ALC-23 17" 23" 15¼" 6 76.00ALC-24 18½" 24½" 15¾" 7 86.00ALC-26 20" 26" 16½" 8 97.00ALC-27 21½" 27½" 17" 9 112.00ALC-SET SET OF ALL SIX CONTAINERS 42 $475.00DC-20/FC-70Collapsible Bulk Storage ContainersThese rugged containers will fold flat for storage when not needed. Overall height when folded flat isonly 11". Two-way fork entry openings are 33¾"W x 3¾"H. Uniform volume capacity is 26 cu-ft.Multiple units may be stacked up to three (3) high. Resistant to extreme high and low temperatures.Durable and easy to clean. Manufactured from HDPE.MODELOVERALL SIZE UNIFORM CAPACITY (LBS.) NET WT. LIST PRICENUMBER DESCRIPTION (W x L x H) STATIC DYNAMIC STACKING (LBS.) EACHCBC-4048-S SOLID SIDES 46" x 46" x 31" 6,000 2,000 1,000 108 $318.00CBC-4048-M MESH SIDES 46" x 46" x 31" 6,000 2,000 1,000 115 318.00Multi-Height ContainerDC-25/FC-70Increase flexibility and accessibility with Multi-Height Container. As the user loads or unloads theheight can be increased or decreased. Includes one pallet base (with four way entry) and four sidesections. Pallet base measures 47 3 /16"W x 31⅜"L x 5⅞"H with fork openings: 8 5 /16"W x 3⅞"H on14⅛" centers and 13⅛"W x 3⅞"H on 19" centers. Polyethylene construction with steel corner hinges.Multiple units are not stackable.MODELOVERALL SIZEFOLDED SECTION UNIFORM NET WT. LIST PRICENUMBER(W x D x H)(W x D x H) CAPACITY (LBS.) (POUNDS) EACHMULTI-C 47¼" x 31½" x 37½" 74½" x 8¾ x 2¾" 2,500 84 $327.00Wire ContainersDC-25/FC-70/100All steel construction with galvanized welded wire mesh. Corners have eyelets designed for rigidity andstacking. Legs are wrapped and welded around base to eliminate sharp edges. Containers can be stacked4 high and have a 4" clearance underneath to allow movement by fork or pallet trucks. Container's fronthalf drop gate allows speed loading and access to stored goods. The collapsible design allows for efficientstorage and transportation.LIST PRICEEACHVWIRE-32H 1,000 20" x 32" x 21" 11 ½" x ½" 58 $259.00VWIRE-40H 4,000 32" x 40" x 34" 3 2" x 2" 129 281.00VWIRE-48H 4,000 40" x 48" x 42" 3 2" x 2" 172 385.00DC-20/FC-70NewSTORAGE SOLUTIONSDeluxe Spring Driven Low Pressure Hose ReelsKeep air hoses off the floor and out of the way. Minimize labor, save storage space, protect against triphazards and damaged hoses. For use with air and water only. Solid steel construction with heavy-dutybrackets to resist hose pull. All reels have a full shaft and swivel to assure maximum product delivery.Maximum temperature is 150° F. Maximum pressure is 300 psi / 21 bar. Includes self retracting hose.Type AMODELNUMBEROVERALL SIZE(W x D x H)INSIDE HOSEDIAMETERLENGTHOF HOSENET WT.(LBS.)LIST PRICEEACHTYPEA VHR-20-44 12½" x 5½" x 13" 1/4" 20 FOOT 19 $163.00A VHR-35-44 12½" x 5½" x 13" 1/4" 35 FOOT 21 204.00A VHR-17-46 12½" x 5½" x 13" 3/8" 17 FOOT 20 174.00A VHR-25-46 12½" x 5½" x 13" 3/8" 25 FOOT 22 208.00A VHR-50-56 16½" x 6" x 17½" 3/8" 50 FOOT 40 329.00A VHR-35-58 16½" x 6" x 17½" 1/2" 35 FOOT 39 304.00B VHR-50-78 19" x 7" x 20¼" 1/2" 50 FOOT 57 $379.00DC-20/UPS/FC-70www.vestil.com Phone (800) 348-0868Type B
STORAGE SOLUTIONS244SHR-S-38-25STEELmodelREEL-18modelECR-45-SSHR-P-38-50PLASTICSHR-S-38-50STEELmodelREEL-16Lmodel ECR-50• Swivel Hook• Push Button• Safety CableProvision• Rotate Clockwiseto Increase Tension• Adjustable Safety StopStandard Spring Driven Low Pressure Hose ReelsKeep air hoses off the floor and out of the way. Minimize labor, save storage space, protect against triphazards and damaged hoses. Maximum pressure is 300 psi / 20 bar. Includes self retracting hose.Model SHR-P-38-50 is constructed of durable, high quality impact resistant polypropylene. A positivelatching mechanism automatically locks hose at a desired length. A safety lock prevents the hose frommoving in either direction. An integral wall/overhead swivel bracket and 36" lead hose are included.Maximum temperature is 140° F.Models SHR-S-38-25 and SHR-S-38-50 are constructed of heavy-duty steel with corrosion resistantpowder coat finish. Four-direction non-snag rollers reduce hose wear abrasion. Multi-position ratchet lockand easy tension adjustment is standard. Spring is fully enclosed and lubricated. Full flow swivel preventsleakage. Guide arm is adjustable for handling up to 9 positions and permits wall, ceiling, and floor mount.MODELNUMBERDESCRIPTIONOVERALL SIZE(W x D x H)INSIDE HOSEDIAMETERLENGTHOF HOSENET WT.(POUNDS)LIST PRICEEACHSHR-P-38-50 PLASTIC 15¾" x 9" x 18½" 3/8" 50 FOOT 23 $109.00SHR-S-38-25 STEEL 15¾" x 7" x 17" 3/8" 25 FOOT 30 $141.00SHR-S-38-50 STEEL 20½" x 9¼" x 22¼" 3/8" 50 FOOT 50 186.00DC-20/UPS/FC-85Air Hose ReelsHelp eliminate twists and tangles of hoses, save storage space, protect against trip hazards and damagedhoses with these economical Air Hose Reels.Arm Style, model REEL-16L, is constructed of all steel. Quick and simple manual hand crank andspring loaded axle helps reel in up to 100 feet of 3/8" hose or 50 feet of 1/2" hose. Valve assembly israted at 100 psi and 25 cfm. Unit can be mounted both vertically or horizontally. The wall bracketmeasures 7"W x 3"H. Hose is not included.Cylinder Style, model REEL-18, has a holding capacity of 100 feet of 3/8" hose. Easy hand crankoperation along with a smooth manual rewind. Constructed of durable steel. The wall bracket measures13¾"W x 3¼"H. Hose is not included.MODELNUMBERMODELNUMBERCABLE LENGTH(FEET)MINIMUM UNIFORMLOAD (POUNDS)OVERALL SIZE(W x D x H)USABLESPACEMAXIMUM UNIFORMLOAD (POUNDS)NET WT.(POUNDS)NET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONREEL-16L ARM STYLE 14" x 17¾" x 18" 5" 19 $32.00REEL-18 CYLINDER STYLE 19½" x 10¾" x 11½" 9" 21 42.00DC-20/UPS/FC-85Electric Cord ReelsMODELNUMBERCORDLENGTHWIREGAUGENET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONECR-45-S SINGLE RECEPTACLE 45 FEET 12 23 $359.00ECR-45-D DOUBLE RECEPTACLE 45 FEET 12 30 383.00ECR-50 LAMP WITH RECEPTACLE 50 FEET 16 24 $330.00DC-20/UPS/FC-85Tool Balancers115V 1-PHASE STANDARDHelp eliminate the danger of tangled electrical cords with these Electric Cord Reels. The compact design isspring retractable and engineered for industrial use. Complete with 4 foot pigtail and three prong plug. 115V,60 Hz single phase. Ideal for indoor non-weather tight applications only. UL listed and CSA certified.Model ECR-45-S comes with a 15 AMP 3 wire single receptacle with clamp type strain relief.Model ECR-45-D features a duplex outlet box and ground fault circuit interrupter.Comes with a 20 AMP 3 wire double receptacle.Model ECR-50 has an incandescent lamp and single receptacle. Head has tool tap, push throughwinch and metal grounded guard. 75 watt bulb maximum. Bulb not included.Tool Balancers are the economical choice for balancing heavy tools. The molded plastic housing hasa smooth exterior with rounded edges for maximum ergonomic convenience. Hand-windable springtension adjustment knob is flush with the housing. Push-button tension release simplifies decrease intension. Adjustment screw adds drag to spool for fine tuning of tension. Rugged steel upper swivelhook. Oversized cable opening with direct in-line pull to reduce cable wear. Adjustable cable stop andlower safety snap hook. Spring operation - no electricity needed.LIST PRICEEACHTBR-1 6 1 3 1 $60.00TBR-3 6 1½ 3 2 60.00TBR-5 6 3 5 2 60.00TBR-10 8 5 10 7 201.00DC-20/UPS/FC-85Phone (800) 348-0868www.vestil.com
Deluxe Smoking SheltersOpen front design for easy entrance/exit. Square tube anodized aluminum frame construction thatnever needs to be painted. Tempered safety glass side panels are frosted for semi-privacy. Roof topis manufactured from aluminum sheeting. Roof liner is manufactured from decorative aluminumextrusions. Concrete hardware anchors included for installation. Heating options available for thosecold weather applications, contact factory. Ships knocked down, assembly required.MODELNUMBEROVERALL SIZE(W x D x H)INSIDE (USABLE) SIZE(W x D x H)PERSONCAPACITYNET WT.(POUNDS)LIST PRICEEACHDSSH-50 105" x 50" x 103" 96" x 44" x 89" 5-6 595 $3,477.00DSSH-93 105" x 93" x 103" 96" x 87" x 89" 10-12 770 4,253.00Smoking Shelter / Bus StopShelters feature rugged welded steel construction for strength and durability. Side panelsare constructed of clear polycabonate. The top is made from corrugated polycabonate sheet.Mounting plates included. Heating options available for those cold weather applications,contact factory. Ships knock down, assembly required.DC-20/FC-100/250NewDSSH-9950245NewMODELUSABLE SIZEOVERALL SIZE NET WT. LIST PRICENUMBER(W x D x H)(W x D x H) (POUNDS) EACHSSH-7939-80 69¾" x 37½" x 77" 77" x 50" x 84" 490 $1,790.00DC-20/FC-100/250Aluminum Smokers BollardSSH-7939-80Manufactured from aluminum alloy for an attractive finish. Includes internal storage container forholding cigarettes. Easy to empty design. Floor-mounted unit includes pre-drilled mounting holes.Wall mounted unit includes hardware.MODELNUMBER DESCRIPTION HEIGHTOUTSIDEDIAMETERNET WT.(POUNDS)LIST PRICEEACHSMK-F-35A FLOOR MOUNTED 35" 3¼" 13 $135.00SMK-W-19A WALL MOUNTED 19" 3¼" 4 $59.00Storage BuildingsDC-20/UPSModular storage building are ideal for keeping valuable items secure. Constructed of maintenancefree galvanized corrugated paneling. The door measures 45"W x 74"H usable and features a right-sidehinged lock (padlock not included). Modular design is easy to assemble. Once assembled unit can bemoved with a fork lift. Each unit features a wooden floor 5¾" high to help keep products dry. Built-inrain gutters for water drainage is standard.SMK-F-35ANewSMK-W-19ANewSTORAGE SOLUTIONSMODELNUMBERDEPTHOVERALL SIZE(W x D x H)USABLE SIZE(W x D x H)NET WT.(POUNDS)LIST PRICEEACHSTOR-96-G-W-1RH SINGLE 110" x 78" x 85" 105" x 69" x 78" 1015 $2,107.00STOR-912-G-W-1RH DOUBLE 110" x 155" x 85" 105" x 145" x 78" 1750 3,914.00DC-25/FC-100/250Multi-Duty Storage BuildingsConstructed of heavy duty steel these Multi-Duty Storage Buildings stand up in multiple weatherconditions; rain, sleet and snow. The 18 gauge steel roof is contoured for water drainage and will holdsnow up to 45 lbs./sq-foot. The sides are constructed of 28 gauge steel siding. Usable size 109"W x75"D x 80"H. Lag down plates are included for securing unit to the concrete. Ships knock down,assembly required.MODELNUMBEROVERALL SIZE(W x D x H)NET WT.(POUNDS)LIST PRICEEACHDESCRIPTIONMDS-96-DR SHELTER WITH DOORS 120" x 96" x 91" 1115 $1,814.00MDS-96-SM SMOKERS SHELTER 120" x 96" x 91" 1050 1,737.00MDS-96-BK BICYCLE STORAGE SHELTER 120" x 96" x 91" 980 1,484.00DC-25/FC-100/250STOR-96-G-W-1-RHNewMDS-96-DR72"W x 83"H &36"W x 83"HDOORSMDS-96-BKINCLUDES STEELBICYCLE RACKMDS-96-SMINCLUDES 42"W CLEARFRONT PANEL AND I-BEAMBACK BENCHwww.vestil.com Phone (800) 348-0868
246Powder Coat FinishesOptional colors are now available in our baked-on Powder Coated Finish. Simply add "SPO" paint code to your purchase order to customizeand coordinate your new equipment. Note: product must currently be available in powder coat for upgrade. Look for the PC symbol next tothe product for option compatibility. Please contact factory for lead time and pricing for this value added feature.ERGO BLUEBATTLE SHIP GRAYSILVER LININGEARTH BROWNSNOWY WHITESODA REDCITRUS ORANGEHUNTER GREENHIGH-GLOSSBLACKSPO-PC-BL-ESPO-PC-GY-SGSPO-PC-SLSPO-PC-BRN-EBSPO-PC-WTSPO-PC-SRSPO-PC-ORG-CSPO-PC-GRN-HSPO-PC-BLK-HGSKY BLUEMACHINE GRAYSANDY BEIGEKHAKI TANFDA WHITEBUBBLE GUMYELLOWTRACTOR GREENSEMI-GLOSSBLACKSPO-PC-BL-SSPO-PC-GY-MGSPO-PC-BRN-SBSPO-PC-BRN-KTSPO-PC-WT-FDASPO-PC-BGSPO-PC-YELSPO-PC-GRN-TSPO-PC-BLK-SGTouch-Up Paints for Powder Coat FinishesSPO-TUPC-12-BLErgo Blue - Aerosol PaintList Price $8.0012 oz. Aerosol CanSPO-TUPC-128-BLErgo Blue - Enamel PaintList Price $58.00128 oz. CanSPO-TUPC-12-YLYellow - Aerosol PaintList Price $8.0012 oz. Aerosol CanSPO-TUPC-128-YLYellow - Enamel PaintList Price $58.00128 oz. CanWater Base Enamel FinishesOptional colors are now available in our Water Based Enamel Spray on Liquid Finishes. Simply add the "SPO" paint code to your purchaseorder to customize your new equipment. The option can be added to most of our products. Please contact factory for pricing and lead time.ERGO BLUEBATTLE SHIP GRAYSILVER LININGEARTH BROWNSNOWY WHITESODA REDCITRUS ORANGEHUNTER GREENHIGH-GLOSSBLACKSPO-LW-BL-ESPO-LW-GY-SGSPO-LW-SLSPO-LW-BRN-EBSPO-LW-WTSPO-LW-SRSPO-LW-ORG-CSPO-LW-GRN-HSPO-LW-BLK-HGSKY BLUEMACHINE GRAYSANDY BEIGEKHAKI TANPRIMERBUBBLE GUMYELLOWTRACTOR GREENSEMI-GLOSSBLACKSPO-LW-BL-SSPO-LW-GY-MGSPO-LW-BRN-SBSPO-LW-BRN-KTSPO-LW-PRMSPO-LW-BGSPO-LW-YELSPO-LW-GRN-TSPO-LW-BLK-SGTouch-Up Paints for Water Base Enamel FinishesPAINT FINISHINGS & COATINGSSPO-TUPW-16-(color)List Price $12.0016 oz. can withbrush in lidSpecialty Liquid CoatingsSTEEL-ITTOP COATPRIMERSPO-LS-SSSteel-It Polyurethane Coatingoption provides a cost-effectivealternative when equipmenthas to have incidental foodcontact rating. Coating can beused in some mild washdownapplications. FDA approved.SPO-TUPW-32-(color)List Price $20.0032 oz. canLINE-XSPO-LS-LXSPO-TUPW-128-(color)List Price $42.001 gal. canLINE-X spray on Polyurea/Polyurethane Coatings. Coatingapplications extend into a wide range uses in automotive,construction, agricultural, military/defense & industrialapplications. Polyurea has high impact, abrasion & chemicalresistance. Chemicals resistance include: Pool chlorine, auto fuel,diesel fuel, paints, bleaches, organic solvents and fertilizers.SPO-TUPW-640-(color)List Price $206.005 gal. bucketZRCZRC CoatingSPO-LS-ZRCZRC Cold Galvanized CompoundCoating provides excellent corrosionresistance and protection in mostcommon washdown applications.ZRC Coating produces a zinc-richfinish.DC-20
247Parts Index10XX .............................. 4012XX .............................. 40AA .................................... 16A-LIFT ............................ 65AALLS ........................... 32ABLT .............................. 47ABS-130 ........................ 64ABS-PUMP .................. 189AC .................................. 35ACH ............................. 108ACP ............................. 221ADKR ........................... 142ADOL-1416-6K ............ 224ADP-55 ........................ 189AF ................................ 217AFB-44 ........................ 155AFL .............................. 141AFSP ........................... 140AFSR-3672 .................. 217AFT .............................. 207AH .................................. 16AHA ............................. 104AHLT .............................. 48AHS ............................. 101AHT ............................... 80AHTD ............................. 18AHW .............................. 80AIR ........................... 54, 71AIR-J .............................. 85AISS ............................ 138ALC .............................. 243ALEXGATE .................. 164ALL-T ............................. 77ALLH .............................. 63ALLPH ........................... 63ALLPW .......................... 63ALLW ............................. 63ALUM ........................... 213AMD ............................... 18AMPC-500 ................... 214AP ................................ 100APG ............................. 166APHT ........................... 212APPL ........................... 214APTS ........................... 242ARMG .......................... 154ARX ............................... 50AS .................................. 41ASD ............................. 206ASKT ........................... 226ASM-3123 ...................... 95ASP ............................... 81AT-10 ............................. 71ATD .............................. 222ATP .............................. 206ATS .............................. 135ATWR ............................ 22AWR .............................. 20AWR-HR ........................ 21AY .................................. 14BB ...................................111B-1224 ........................... 40BACK ............................. 84BAG ............................... 34BALL ...................... 73, 120BAND ............................. 97BAR ............................. 234BASE ........................... 236BC ................................ 108BC-B-1.5 ...................... 152BDSC ............................. 91BEAM .......................... 229BFSJ-2748 ..................... 39BIT-3/4 ........................... 41BKT .............................. 196BLD-80 ........................ 187BNW ............................ 186BOL ............................. 147BOL-ALUM .................. 152BOL-CAP ..................... 148BOL-DRING ................. 254BOL-FD ....................... 151BOL-JHOOK ................ 254BOL-JK ........................ 145BOL-MB-42-5.5 ........... 150BOL-OR-40-BK ............ 150BOLPP ......................... 150BOL-R .......................... 150BOL-RF ....................... 149BOL-SMK .................... 151BOL-SS ....................... 149BOL-SSTOR-42-4.5 .... 150BPC ..................... 152, 153BR ................................ 255BS .................................. 41BSG ............................... 98BT ................................ 109BTA ................................ 17BTC ............................... 85BTL-BW ....................... 202BTL-EZ-1 ..................... 202BTL-GN ....................... 199BTL-MA ........................ 198BTL-MT ........................ 198BTL-N .................. 200, 202BTL-RC ................ 200, 201BTL-RD ................ 200, 201BTL-RF ................ 200, 201BTL-SN ........................ 202BTL-SW ............... 199, 202BTL-UVN ............. 199, 202BTL-UVW ............ 199, 202BTL-W ................. 200, 202BTL-WN ............... 200, 201BTL-WW .............. 200, 201BTT ................................ 53BUNG .......................... 187BW ............................... 159BW-PJ ........................... 77CC .................................... 24C-130 ........................... 140C-AH-4048 ................... 226C-ATH-4048 ................. 226C-FC-40 ....................... 226C-FH-4048 ................... 226C-HOP ......................... 131CA .................................. 91CABLE-P4 ....................110CAHT-500 .....................211CA-KP ............................ 89CAN-A .......................... 194CAN-CAP .................... 185CAN-RECY .................. 193CAN-S ......................... 194CANOPY-5060 ............ 123CANT ........................... 234CARB ........................... 197CARPET ...................... 219CART ............................. 70CART-CTD .................... 72CART-DC ....................... 72CART-DC-CTD .............. 72CART-LA ........................ 68CART-M ................... 68, 72CART-D-FR ................... 69CART-D-HR ................... 69CART-LT ........................ 71CART-PSS ..................... 69CART-S-FR ................... 69CART-S-GR ................... 69CART-SCL ..................... 70CART-SCTAB-DC .......... 72CASE ........................... 242CB .......................... 33, 209CBC ............................. 243CB-PMPS ...................... 59CB-W ........................... 190CBFC ............................114CBH-32 .......................... 33CBOL ........................... 149CBS ............................... 59CC-48 ............................ 90CCF ............................. 121CCM ............................ 121CCRF ............................. 29CDL-2000 .................... 180CDSC-30 ....................... 91CEP ............................... 97CG-42 .......................... 157CGP ............................. 156CH ................................110CHDL ........................... 180CHIP ............................ 132CJ-BEAM ....................... 39CJIB ............................. 102CK .................................. 83CL .................................. 33CLB .............................. 163CM ............................... 193CNVX ............................. 21COL ............................. 136COLA ........................... 137CONV ............................ 73CP .................................110CPC ............................. 109CPRO ............................ 83CR ............................... 121CRAD .......................... 237CRF ............................. 121CRFH ............................. 30CRP ............................. 121CS ............................ 26, 27CSEC ........................... 143CSHT-500 .....................211CT .................................. 37CTC-1856-B .................. 99CTPT-1844 .................... 99CUSH ............................ 84CUT ............................... 93CWS-13 ......................... 36CYL-2 .......................... 191CYHT-350 .................... 190CYL-D .......................... 190CYL-DLX ..................... 190CYL-E .......................... 191CYL-G .......................... 192CYL-H .......................... 192CYL-HLT ...................... 190CYL-LT ........................ 191CYL-LP ........................ 192CYL-P .......................... 191CYL-T .......................... 192CYL-V .......................... 192DD .................................. 128D-150 ............................. 10D-150/650 ...................... 10D-350 ............................. 10D-520-24 .........................11D-750 ............................. 10D-AW ............................. 23D-CNVR-250 ............... 223D-FAR-120 ..................... 23D-FORK ....................... 120D-HEAD ....................... 186D-ROL-48 ...................... 23D-TILT .......................... 130D-TR-88 ......................... 23DAC ............................. 231DBA-130 ........................ 94DBE ............................... 41DBS ................................. 9DBK ............................... 41DBT ............................. 175DC ....................... 185, 239DC-550 ........................ 174DCC ............................. 226DCHT ........................... 175DCL ............................. 180DCR-110-55 ................. 169DCR-205 ...................... 170DCR-880 ...................... 174DCS ............................. 181DCT ............................. 170DD-9 ............................ 186DDB-36 .......................... 28DDB-C-42 ...................... 29DD-EX ......................... 186DD-EZ .......................... 186DDO ............................. 182DDT-500 ...................... 215DELUXE-C ...................211DESK-M ......................... 84DFDL-3 ........................ 171DF-S ............................ 188DFT .............................. 188DGD ............................. 172DGLI-4 ......................... 187DGS ............................. 172DH-MR2 ....................... 203DH-PH4 ....................... 203DH-PU2-4 .................... 203DHDC-66 ..................... 176DHHT ........................... 212DHHT-250-FD .............. 213DHPH .......................... 203DIB-96 ............................. 8DIE-2430 ....................... 71DJG ................................. 9DKL .............................. 138DL-31 ........................... 179DLI ................................118DLT ...............................110DOL ..................... 221, 224DOME ............ 21, 151, 152DP-FUN ....................... 188DPH ..............................117DR ............................... 178DR-LOCK .................... 163DRAIN-DD ................... 159DRH-P ......................... 184DRH-S ......................... 184DRUM-55-36 ............... 173DRUM-55-FP ............... 173DRUM-55S .................. 173DRUM-DRH ......... 182, 183DRUM-HD ................... 183DRUM-HYD ................. 172DRUM-LRT .................. 173DRUM-P ...................... 168DRUM-PDD ................. 182DRUM-QUAD .............. 183DRUM-RACK ............... 168DRUM-SCLF ............... 173DRUM-SCLG ............... 173DRUM-SP .................... 179DRUM-SS .................... 182DRUM-ST .................... 182DRUM-STIK ................. 183DRUM-TRI ................... 183DRUM-WEDGE ........... 181DRUM-X ...................... 182DSG-48 ........................ 158DSHRT ........................ 178DSHT-500-PN ...............211DSHZ-4 ........................ 235DSJ ...............................111DSP ............................. 162DSSH ........................... 245DTH-1000 .................... 180DTL-22 ......................... 187DTP-11 ........................ 181DTR ............................. 182DTS ................................. 9DVA-B .......................... 187DWB ............................ 163DWC-EL ...................... 216EE .................................... 16E-CART ....................... 219E-CLIP ........................... 33E-MT ............................ 105E-TKPL .......................... 38E-TRACK ....................... 32EAH ............................... 86EALUM .......................... 36EAM ............................... 82EASY-A ........................ 205EB ................................ 209ECH ..................... 107, 108ECR ............................. 244ECSPT-2448 ................ 207EDGE ...................... 33, 97EDP ............................. 189EFHD ........................... 206EH .............................. 6, 16EHLT .............................. 45EHLT-N .......................... 45EHLT-WS ....................... 49EHLTD ........................... 48EHLTG ........................... 50EHLTG-WCL .................. 66EHLTS ........................... 48EHLTSD ......................... 48EHLTT ........................... 51EHLTX ........................... 50EHN ......................113, 114EHTT ............................. 52EHU ............................... 50ELH .............................. 106EM1-200 ........................ 53EM1-500 ........................ 53EMC ............................... 54EMHC-2460 ................. 220EOP ............................... 81EPC ............................. 109EPT ................................ 76EPT-S ............................ 77EPT-SCL ........................ 76ERG ............................... 86ETS ................................ 66ETT-254 ......................... 53EVR ............................. 235EWB .............................. 86EX .................................. 35EXGATE ...................... 164EXL .............................. 139FF-CRATE ..................... 242F-GRID .......................... 80F4 ................................ 123FAB ................................ 36FAB-H .......................... 131FAL ................................ 21FAPT-1628 ................... 206FAS-6 ........................... 141FAT-1829 ..................... 207FBSL ............................ 139FBSS ........................... 139FBTFL .......................... 139FC-29 ........................... 123FCB-818 ...................... 122FCHT-34 ...................... 215FD ................................ 185FDA .............................. 170FDC-30 ........................ 170FDG ............................. 172FDOL ........................... 223FDR ............................. 184MODEL PREFIX INDEXwww.vestil.com Phone (800) 348-0868
248MODEL PREFIX INDEXFDRS ........................... 184FDS ............................. 184FDT-22 ......................... 179FE ................................ 122FEG ............................. 162FES-KIT ....................... 102FF-C-20 ......................... 29FF-FPT ........................ 208FFH-118 ......................... 30FHC-250 .......................211FHCR ............................. 24FHL-PUMP .................. 189FHS ............................. 102FJ ................................... 37FJB .............................. 228FL ................................ 228FL-4000 ....................... 124FL-ADJ ........................ 227FL-LK ........................... 228FLAD ........................... 136FLAT-C ........................ 207FLOW .......................... 234FLP .............................. 141FM ................................... 7FM-T-DUMP ................ 125FMDDL ........................ 171FMDL ........................... 171FMS ............................. 226FNHT-500 .....................211FORK-J .......................... 85FORK-R-54 .................. 123FPDL ........................... 171FPG ............................. 102FPT .............................. 208FRC-2 ............................ 37FSBOL ......................... 153FSL .............................. 140FSR ............................. 229FST .............................. 218FTLP ............................ 125FTT .............................. 185FWD ............................ 223FWR .............................. 21GG6 ................................ 160G8 ................................ 160GAL-5-DOL .................. 194GFN ............................. 210GGR ............................ 147GLL ...............................117GLT-4000 ....................... 52GPTD ........................... 102GR ............................... 146GR-D ........................... 146G-TP ............................ 146GWC-10 ......................... 36HH .................... 85, 107, 128H-LO-J-BEAM ................ 39H-TRAIL ........................114HAND-TPE .................. 214HB-C ............................ 234HBD ............................... 54HBS ............................. 231HBST-500 .................... 213HCB-PUMP ................. 189HCH ............................. 106HCR ............................... 24HDC-305 ...................... 167HDC-450 ...................... 168HDC-900 ...................... 167HDD ............................. 169HDFJ ............................. 38HDLL-4 .........................116HDOC .......................... 223HDOF .......................... 223HDOR .......................... 223HDOS .......................... 223HDOSC ........................ 223HDP ..............................115HDP-CL ........................115HDPRG ........................ 155HDSA-C ....................... 233HDSW .......................... 164HDT-500 ...................... 172HDU-C ......................... 233HEAT-S .......................... 31HEX ............................. 157HG ............................... 155HIA-C ........................... 233HI-J ................................ 39HIGH-T ........................ 215HIPM .............................. 58HKIT .................... 137, 157HL-55 ............................. 23HLD ............................. 170HLGN ............................. 32HMS ............................. 120HOOK .......................... 120HOOK-8 ....................... 223HOOK-BASE ............... 120HOP ..................... 129, 132HOP-LP ....................... 130HOP-OE ...................... 131HOP-PTD .................... 130HORIZ-70 .................... 172HPC ............................. 109HPC-400 ...................... 195HPCR ............................ 28HPRO .......................... 154HPRO-RF .................... 154HPRO-SS .................... 154HR ............................... 210HSA-C ......................... 233HSRB ........................... 177HT .................................. 67HT-PANEL ................... 217HU-C ............................ 233HWG-600 ..................... 108HWL-330 ....................... 63HWV-1000 ................... 108HYD ............................... 64HYDRA .......................... 64HYS ............................... 60IIBC ............................... 183IBIKE ........................... 220ICF ................................. 28ICRF .............................. 28ISEAL-TT ....................... 96ITMAT ............................ 83ITT ............................... 127JJAN ................................ 41JAR .............................. 198JBOL ............................ 149JDFT ............................ 188JIB-CB ..........................112JIB-CBX ........................112JIB-FM ......................... 103JIB-HC ......................... 103JIB-LC .......................... 103JIB-P .............................112JMD ............................... 56JUG ............................. 197KK-LIFT ............................ 64KNEE-D ....................... 224LL-1818-4 ........................ 40L-220 ............................. 58L-270 ............................. 58LAD ...................... 133, 134LAD-MM ...................... 134LAD-R .......................... 135LAD-RF ........................ 136LAD-TGN ..................... 134LAW ............................... 86LBDR ............................. 34LBPH ........................... 237LC-803 ......................... 215LDLT .............................. 67LDP .............................. 189LEG-D .......................... 224LFH-55 ......................... 222LHCR ............................. 24LID ....................... 132, 195LIFTER-2 ....................... 65LINE-SA ......................... 42LJ ................................. 228LL ................................... 31LL-LED .......................... 31LL-PMPS ....................... 59LL-SAI ............................ 32LL-SAF .......................... 32LLCB-202058 ................ 63LLF ................................ 63LLH ................................ 63LLPH .............................. 63LLPW ............................. 63LLS ................................ 32LLW ............................... 63LLW-PAILD .................. 195LM .................................119LM-HP ..........................119LMEC ............................111LMS ..............................119LO-DC ......................... 174LO-J ............................... 39LO-J-BEAM ................... 39LOW ............................ 105LP-170 ......................... 193LP-4000T ....................... 90LP-6 ............................. 193LPBP-24 ...................... 159LPC .............................. 109LPDT ........................... 174LPRO ........................... 153LPRO-RF ..................... 154LPRO-SS ..................... 153LSC .............................. 209LTS ................................ 84LTSD .............................. 84LUG ......................209, 211LWC ............................... 35LWSS ........................... 241MM .................................... 39MAIL-55 ....................... 205MATL ............................117MB-24 .......................... 232MB-C ........................... 232MB-C-30 ........................ 29MB-RS-C-36 .................. 29MCD ............................ 225MCHC ............................ 25MCHT-350 ................... 190MDC ............................ 239MDS ............................. 245MDU ............................ 232MEZZ-200 .................... 164MFM ............................ 227MG ............................... 157MHBC .......................... 132MIA-C .......................... 232MINI ..............................111ML .................................118MLM ..............................118MMJ ............................... 38MOTO-LIFT-1100 .......... 49MPD-5 ......................... 194MPG ............................ 255MPO-3 ........................... 93MPPB-4794 ................... 98MPR ............................... 25MPS ............................... 42MPT ............................... 56MR ............................... 210MRBR ............................ 24MRC ............................ 198MRCG .......................... 161MRHR-39 ....................... 25MRR-2310 ..................... 25MS ................................. 42MS-15 ............................ 36MSA-C ......................... 232MSJ ............................... 38MT ................................. 68MTC ............................. 167MU-C ........................... 232MULTI-C ...................... 243MWP .............................. 62NNEST ........................... 237NEST-F ........................ 236NJ .................................. 37NPCT ........................... 209NPG ............................. 160NPL .............................. 222NVD-40 ........................ 181OOBOL ........................... 149OCC-2 ......................... 191OCTO-55 ..................... 183ODF-PUMP ................. 189ODG ............................ 163ODMD .......................... 225OEPW-1700 ................ 254OFC-200 ...................... 193OH ................................. 37OLA...............................115OLF ...............................115OROAD ....................... 220ORWC ..................... 35, 36OTC ............................. 178PP .................................... 82P-CADDY ...................... 79P-HOP ......................... 130P-JIB .............................114PACU ............................. 30PAIL ............................. 196PAIL-LINE .................... 196PAIL-PAL ..................... 194PAIL-PST ..................... 189PAIL-T .......................... 194PAL ................................ 34PAL-D/R ....................... 125PALL-200 ....................... 65PANEL-H ..................... 216PBAR ........................... 142PBIN-19 ....................... 227PBOL ................... 152, 155PBSS ........................... 241PC ................................ 208PCB ............................. 145PCD ............................... 42PCG ............................. 161PCH ............................. 230PCS-1626 .................... 254PDL-800 ...................... 179PDL-800-M .................. 179PDH-1624 .................... 224PDOC .......................... 224PDP-55 ........................ 189PDR ............................. 168PDS ............................... 98PE .................................... 7PEL .......................... 62, 88PES ............................... 30PEXGATE-30 ............... 164PG-C .............................110PG-S .............................110PFSL ............................ 139PH-F ............................ 210PI ................................... 55PIHP .............................. 31PINTLE ........................ 120PIT ............................... 202PJ .................................. 79PJ-CYL ........................ 191PJ-LIFT .................. 78, 103PKG ............................... 95PKG-CART .................... 98PLB ................................ 35PLDL-HD ..................... 217PLDL-LD-2-4PP ........... 217PLH .............................. 106PLID ............................. 129PLP2 ............................ 100PLPB ........................... 100PLPBL ......................... 100PLPG ........................... 100PLPR ........................... 100PLPS ........................... 100PLSC ........................... 205PM ............... 73, 74, 75, 78PMM ............................ 219PMPS ............................ 59PMSS ............................ 59PMRA ............................ 78PN-ST-1 ......................... 96PNU ............................. 207POLY-D ........................ 182POPUP .......................... 73POS ....................... 81, 225POST ........................... 236POW-CAR ..................... 89PP ............................ 7, 210PPC ............................... 34PPI ................................. 55PPT .............................. 208PPW-748 ..................... 254PRAIL .......................... 144PRCT ........................... 215PRCT-HD ..................... 215PRCT-N ....................... 216PRCT-S ....................... 216PRCT-T ........................ 216PRCT-V ....................... 216PREG .......................... 154PRG ............................. 159PRM ............................. 222PRN ............................. 230PROGRAM .................... 46PRRJ ........................... 230PRS ............................. 230PRSN ........................... 230PRTD ........................... 229PS .................................. 65PSB-42 ........................ 229PSC ............................. 205PSDT ........................... 174PSEAL-12 ...................... 96PST ................................ 49PT ............................ 68, 89PTC-8 ............................ 79PTDSC .......................... 91PTM-GPT .................... 219PTDS ........... 49, 55, 58, 59PTDSC-66 ..................... 91PU ................................ 210PVC ............................. 162PCV-A .......................... 162PW ............................... 254PWB .............................. 98PWC .............................. 36PWP .............................. 99Phone (800) 348-0868www.vestil.com
249QQIT ............................... 105QPC ............................... 34QPC-7280 .................... 224QPC-HT ....................... 212RR-CAD ........................... 22RAMP ...................... 21, 23RB ................................ 209RBW .............................. 37RCP-B-BY ................... 161RCR ............................... 25RDB ............................... 40RDBT ........................... 175RDC ............................. 176RDP-55 ........................ 189RDSPB ........................ 166REEL ........................... 244RERC .......................... 238RHCB ............................ 24RK .................................. 21RLAD ........................... 140RMC-4 ........................... 35ROL ............................. 218ROTATE ........................ 46RP-90R ........................ 189RR ................................... 6RRC ............................... 46RS .................................. 15RSB ............................... 26RSH ............................... 27RSMH ............................ 27RU ................................... 5RUD ............................. 161RWC ........................ 35, 36RWPT ............................ 82SS .............................. 19, 61S-2001 ........................... 94S-CB .............................. 61S-FORK ....................... 120S-STAND ..................... 166SA-1012 ......................... 37SAC ............................. 231SAJ-1012 ....................... 39SAW ............................ 210SB .......................... 26, 209SBA................................ 26SBM ..............................116SBR-120 ........................ 25SBRL ............................116SBS-1012 ...................... 37SC .................................118SCA ............................. 204SCALE ..................... 46, 92SCC ............................. 179SCOOT ........................ 220SCR ............................... 15SCRAPE-1 ................... 120SCS ............................. 204SCSC ............................. 66SCTAB ........................... 69SD ................................ 184SDD ............................. 206SDOL ........................... 226SDSP-4048 .................... 99SE .................................. 19SE/HP ............................ 60SECS ............................. 38SEH ............................... 19SF-1012 ......................... 37SFS ................................ 79SFT .............................. 254SH-GUN ........................ 95SHEET-R-57 ................ 235SHM ............................... 83SHOP .......................... 238SHOPT .......................... 97SHR ............................. 244SIREN .......................... 166SITE-C ..........................211SIZER-4 ......................... 93SJ .................................. 37SJ-35 ............................. 39SJS-1012 ....................... 39SKB-7 ............................ 35SKID ............................ 100SKIRT ............................ 44SL ...........................60, 118SLG ............................. 163SLPT ............................ 130SLV ...............................117SME ............................... 28SMK ..................... 151, 245SN-4165-RL ....................11SNAP-H-25 .................. 145SP-175 ......................... 126SP-TOP ......................... 39SP-TOP-R ..................... 39SPA .............................. 203SPB ............................. 124SPB-N .......................... 124SPBOL ......................... 151SPG ............................. 142SPHT ....................211, 212SPL ................................ 99SPO ............. 129, 148, 246SPR ............................. 144SPREAD ...................... 124SPS2-2041-C .............. 204SPS ............................. 203SPS-HD ....................... 204SPS-HF ....................... 204SPT .............................. 207SPTT ........................... 131SQ ............................... 145SQSPB ........................ 166SR ................................ 237SRBC ........................... 177SRC ............................... 37SRF-18 .......................... 93SS .................. 96, 161, 210SSA.............................. 140SSAL ........................... 231SSB-42 ........................ 229SSC ............................. 169SSC-17 .......................... 36SSD ............................. 184SSDSC .......................... 91SSEAL ........................... 96SSH-7939-80 ............... 245SSKT ........................... 226SSRAIL-96 ................... 143SSRT-47 ...................... 235SSS ............................. 241SSSC ........................... 255ST .................................. 96ST-TRUCK-300 ........... 214STAIR .......................... 138STAND ........................... 57STAPLE ......................... 96STC-1835 .................... 204STEP ........................... 141STGR ........................... 146STOR ........................... 245STP .............................. 177STPC ............................. 89STRAP ............... 33, 34, 97STRAP-8 ..................... 223STRAP-P ....................... 93STRAP-P2 ..................... 94STRAP-PS-HD .............. 94STRAP-VH .................... 94STS-120 ........................ 83SU .................................... 5SV-1012 ......................... 37SW ................................. 34SW-HAND ..................... 93SW-PJ ........................... 78SW-KNIFE ..................... 93SWD .............................. 93SWA ................... 87, 88, 89SWA-R ............... 87, 88, 89SWAC ............................ 23SWC-22 ......................... 36SWMD ......................... 229SWR .............................. 22SY .................................. 14SYNC ............................. 85TT-22 ............................... 40T-DUMP ......................... 57T-HOP .......................... 125TAL ................................ 58TAP-3 ........................... 188TAS ................................ 18TB .................................. 41TBR ............................. 244TC ................................ 155TCD ............................... 56TCD-FM ....................... 125TCD-U ........................... 56TCSC ............................. 27TDR ............................. 180TEG ............................. 156TEGC ........................... 156TG .................................. 12TH .......................... 56, 125TILT-DOL ..................... 183TJ ................................... 37TJIB ............................. 103TL-100 ............................. 8TL-200 ............................. 8TLAD ........................... 138TLP-2 ............................... 7TM ................................. 55TM-22-M ........................ 54TMS ............................... 55TOE-B .......................... 143TPA ................................ 42TRASH-TOP ................ 185TRI ................................115TS .................................. 19TSB .............................. 145TSCT ........................... 218TS-ET-60 ....................... 29TS-EVAP ....................... 29TSF ................................ 82TST-120 ......................... 83TT ............................ 89, 90TW ............................... 187TWC-400 ..................... 214UU-RACK ....................... 237UF-WHL ............... 210, 213UBX-Y .......................... 242ULTT .............................. 52UNI ................................ 51UNI-P ............................. 52URTH ............................. 25URWC ........................... 36UT-TRAY ..................... 178VV ............................ 40, 236VAC-6 ...........................111VAN-J ...........................113VB ................................ 158VBA.............................. 240VBG ............................. 162VBJ .............................. 240VBM ............................. 240VBR-9 .......................... 235VBS ..................... 158, 240VBSH ........................... 240VBV ............................. 240VBW-1 ......................... 240VCAB ........................... 239VCH ............................... 31VCP-40 ........................ 161VCRD .......................... 176VCW ............................ 158VD ................................ 164VDC ..................... 179, 185VDFT ........................... 188VDKR ........................... 142VDL-22.5 ..................... 180VDP ............................. 189VDPX ........................... 189VDRCH ........................ 181VEDP-55 ...................... 168VENT ........................... 187VERSA ......................... 217VFHK ............................. 30VFP .............................. 123VGLT ........................... 156VGP-100 ...................... 227VHMH .......................... 225VHMS .......................... 225VHPT ................... 208, 254VHPT/D ....................... 205VHPT/S ........................ 208VHPT/TD ..................... 205VHR ............................. 243VHPS ............................. 60VHSR ........................... 236VIAL ............................. 199VISE .............................. 85VLDP ........................... 189VLPDP ......................... 178VLPFS ........................... 92VLPSC ......................... 240VP ................................ 236VPC ............................. 155VPFG ........................... 165VPFS ............................. 92VPJ .............................. 224VPLDO ........................ 222VPP-5R ........................ 158VPRDO ........................ 221VPRP ........................... 160VPTS-05 ........................ 79VPTT ........................... 220VPU ............................... 92VPUP ........................... 158VRP-18 ........................ 159VRSOR ........................ 234VS-ECH ....................... 107VSC ............................. 240VSL .............................. 239VSPB ........................... 240VSRB ........................... 177VSSG ........................... 165VSSR-15 ...................... 235VST .............................. 141VSWP .......................... 121VTR ............................. 255VWIRE ......................... 243VWS .............................. 60VWSA .......................... 239VXL .............................. 165WWAND-3 ........................ 93WBS ............................ 144WBT ............................. 242WEB ............................ 145WHM .............................. 83WIRE ........................... 209WIRE-D ....................... 238WL-100 ........................ 4, 5WLPS-2 ......................... 83WM ................................ 83WMD ............................ 229WMP .............................. 99WP ....................... 126, 127WP-400 .......................... 81WPT-1624 ...................... 57WR ................................. 24WS ................................... 8WSF ............................... 28WSS-60 ......................... 83WT-TBL ....................... 207WT ................................. 57WTJ ..............................112WTJ-20 .........................113WTJ-E ...........................113XXHCR ............................ 24XHDSA-C .................... 233YYB .................................. 42YCG-12 ........................ 161YGR ............................. 147YR .................................. 13YRD ............................... 13YRDS ............................. 13ZZLTT .............................. 51MODEL PREFIX INDEXwww.vestil.com Phone (800) 348-0868
250DESCRIPTION INDEXDescription IndexAACCORDION SKIRTINGScissor Tables ......................... 44ACCORDION SKIRTSScissor Dock Lift ....................... 5AIR CONDITIONERSPortable ................................... 30BBAGSDunnage .................................. 34Polypropylene Woven Parts .... 98BALL TRANSFER TOPSPlatforms ................................. 73Pop-Up .................................... 73Single Ball ............................... 73Strips 73BARRICADESDock..........................................9Indoor Personnel ................... 145Interlocking ............................ 144Multi-Purpose ........................ 155Plastic Chain ......................... 145Poly................................ 142, 155Semi-Permanent ................... 144Stakes, Web Barrier .............. 144BEAMBeam Clamps ........................ 108Beam Tongs .......................... 109Spreader Beams ....................116BENCHESAdjustable Ergonomic ............. 86Electric .................................... 86Linear Actuated ....................... 86Opti-Bench .............................. 86Packaging ............................... 98Tilters ...................................... 53Turntables ............................... 90Work Center .......................... 239BICYCLESIndustrial Bicycles ................. 220BOLLARDSCaps .................................... 148Chain Attachments ................ 254Chain Slots ............................ 145Chrome-Plated ...................... 149CoversDecorative .......................... 152Plastic ................................ 153Decorative Aluminum ............ 152Floor Stop .............................. 153Folding .................................. 151Jumbo Steel .......................... 149Moveable ............................... 150Offset .................................... 149Ornamental ........................... 150Plastic .................................... 152Plastic Hardware Caps .......... 152Pour In Place ......................... 150Powder Coat Finish ............... 148Protective Dome Covers ....... 152Removable ..................... 149-150Self Storing ............................ 150Smokers ........................ 151, 245Spring Loaded ....................... 151Stainless Steel ...................... 149Steel Pipe .............................. 147BOOMSFork Truck Booms ..................119BRIDGESExtruded Aluminum ................. 24Fabricated Aluminum .............. 24Molded Rubber ........................ 24Urethane ................................. 25BUCKETSGalvanized & Stainless Steel .. 196BUMPERSBumper Stops ......................... 41Extruded .................................. 39Fork Truck Carriage .............. 122Hardware, Installation ............. 41Laminated ............................... 40Molded ............................... 40-41Rounded Dome ....................... 40Trailer Crane ........................... 41CCABINETSBin Storage ........................... 240Mobile .................................... 239Modular ................................. 239Non-Flammable Safety ......... 240Security ................................. 241Storage Lockers .................... 239CADDIESFork Truck Fork ..................... 123Wire Reel .............................. 238CANTILEVER RACKINGCantilever Carts .................... 234Heavy-Duty .................... 233-234Medium Duty ......................... 232Structural ............................... 231CARGO BARSAluminum ................................ 33Steel........................................ 33CARGO PROTECTORSCargo Protectors ..................... 97CAROUSELSCart..........................................90King Pin ................................... 89Manual .................................... 91Powered .................................. 89Stainless Steel ........................ 90Thin Spin ................................. 90Turntables ............................... 90CARPET POLESCarriage Mounted ................. 121Fork Mounted ........................ 121Fork Mounted Inverted .......... 121CARTSA-Frame ................................ 217Air Hydraulic ............................ 71Aluminum Ladder .................. 140Appliance .............................. 214Auto-Hite Carts ........................ 66Battery Transfer ....................... 85Cantilever .............................. 234Carton ..................................... 99Cradle .................................... 226DC Powered ............................ 72Containment Drum ................ 176Drywall .................................. 216Electric <strong>Material</strong> <strong>Handling</strong> ..... 220Ergo-Handle .......................... 203Flat Bed ................................. 207Fold-Flat Plastic .................... 208Guards / Bumpers ................. 209Hardwood Platform ....... 205, 208Hydraulic Elevating ............ 69-72Landscape ............................. 209Lift & Tilt Cart ........................... 71Linear Actuated ....................... 68Long Deck ............................... 67Luggage .........................211, 215Mail........................................205Manual Scissor Carts .............. 72Mechanical Scissor ................. 68Multi-Tier Stock ..................... 218Nesting .................................. 209Packaging ............................... 98Pallet ...................................... 90Panel Cart ...................... 215-217Plastic Platform ..................... 205Platform with Dividers ........... 217Powered Drive & Lift ............... 72Revolving Drum Carts ........... 176Rotating Drum Carts ............. 176Scale ...................................... 70Scissor Lift ............................... 69Self Elevating .......................... 66Service ........................... 204-205Stainless Steel ................ 69, 255Steel Retention Basin ............ 177Stockpicker ..................... 203-204Traction Drive ........... 72, 219-220Versatile Platform .................. 217Welding Cylinder Torch ......... 191CASTERSHopper .................................. 129Industrial ................................ 210CHAIRSAssembly ................................. 83Back Support ........................... 84Ergonomic ............................... 83Fork Truck Seats ..................... 84Luggage Cart/Chair ............... 215Worker ..................................... 83CHOCKSAluminum ................................ 36Chain/Hanger ..................... 36-37Drum Chocks ........................ 181Ergo-Handle ............................ 36Rail Car ................................... 37Recycled Plastic ...................... 36Rubber .................................... 35Signs ................................. 36-37Steel ...................................... 36Urethane ................................. 36Wedges, Rubber ..................... 37CLAMPSBeam .................................... 108Horizontal Plate ..................... 109Positive Locking Plate ........... 109Vertical Plate ......................... 109COIL RAMS/LIFTERSCoil Rams/Lifters ................... 121CONESTraffic .................................... 155CONTAINERSAluminum Storage .......... 242-243Bulk .................................... 132Carboys ................................. 197Collapsible Bulk Storage ....... 243Foldable/Nestable Roller ....... 218Folding .................................. 242Galvanized Buckets .............. 196Glass Bottles ......................... 199Graduated Plastic Bottles ...... 200Intermediate Bulk .................. 183Jars .................................... 198Jugs .................................... 197Metal Bottles ......................... 198Multi-Height ........................... 243Pails .................................... 196Plastic Bottles & Pitchers ...... 202Plastic Squeeze Bottles ........ 201Plastic Vials ........................... 199Portable Parts Bin ................. 227Round Metal Can with Lid ..... 198Stainless Steel Buckets ......... 196Tin Bottles with Brush Lids .... 198Utility Boxes .......................... 242Wire .................................... 243CONVEYORSGravity Roller .......................... 73Platform ................................... 73Retractable End Stops ............ 73COOLERSPortable Evaporative ............... 29CRANESAir/Hand Pump .......................114Bridge Cranes ........................111Counter Balanced Floor .........114Gantry Cranes.....101-102, 104-105Jibs...................102-103, 111-113CRUSHER/COMPACTORAerosol Can Recycler ........... 193Drum .................................... 167Manual .................................. 167Oil Filter ................................. 193Pail.........................................195CURBSModular Guard Curbs ............ 255Wheel Alignment Curbs ........... 23CYLINDER EQUIPMENTAerosol Can Recycler ........... 194Caddies ................................. 191Dollies ................................... 190Hand Truck ............................ 190Lifter/Transporter ................... 190LP Tank Caddy ...................... 193LP Tank Truck ....................... 193Portable Clutcher .................. 191Portable Lifter ........................ 191Storage Cabinets .................. 192Wall Mounted Brackets ......... 190Welding Cylinder Torch Cart.. 191DDECKINGCrown Pallet Rack ................. 229Open Area Rack .................... 230Pallet Rack Wire .................... 229DESKSShop .................................... 238Work Center .......................... 239DOCKBOARDSAccessories ............................. 18Aluminum Hand Truck ............. 18Aluminum Truck ...................... 17Aluminum w/Steel Curbs ......... 18Steel Railroad Boards ............. 15Steel Truck .............................. 19DOCK EQUIPMENTAutoloader ............................... 21Bug Screen Doors ..................... 9Bumpers ............................. 39-41Cable Protectors ................ 24-25Cargo Bars .............................. 33Cargo Strapping ...................... 33Car Stops ........................... 26-27Dock Barricades ........................ 9Dockboards .................. 15, 17-19Dockleveler Blanket .................. 8DocklevelersEdge-O-Docklevelers ............. 7Electric Hydraulic ................... 6Mechanical ............................. 6Pit Drawing ............................ 8Truck Actuated ....................... 5Truck Scissor Dock ............. 4-5Weather Stripping .................. 8Dockplates ................... 16, 18-19Dock Seals & Shelters ....... 10-11Dock Shelter Survey Sheet ......11Dock Traffic Systems ................ 9Dunnage Bags ........................ 34Fans ................................. 28-29Floor Tape ............................... 42Hitch Lift .................................. 23Hose & Cable Bridges ........ 24-25Jacks ................................. 37-39Phone (800) 348-0868www.vestil.com
251Line Markers ........................... 42Load Binders ........................... 34Loading Lights .................... 31-32Locking Pin Locator ................... 7Mirrors ..................................... 21Pallet Cargo Decker ................ 42Pallet Pullers ........................... 34Prylever Bars ........................... 35Quilted Moving Pads ....... 34, 224Rail Chocks ............................. 37Scaffolding Nets .......................11Scissor Dock .......................... 4-5Security Seals ......................... 38Speed Bumps ..................... 25-26Speed Cushions ...................... 26Speed Humps ......................... 27Steel Container Ramps ........... 15Strap Winches ......................... 34Sweepers ........................... 41-42Tape Applicators ...................... 42Trailer King Pin Lock ............... 38Trailer Lock System .................. 8Vinyl Strip Doors ..................... 12Walk Ramps ....................... 20-21Weather Stripping ..................... 8Wheel Alignment Curbs ........... 23Wheel Chocks .................... 35-37Wheel Risers ........................... 22Yard Ramps ....................... 13-14DOCKLEVELERSEdge-O-Docklevelers ................ 7Electric Hydraulic .................. 6, 8Mechanical ................................ 6Pit Drawing ................................ 8Truck Actuated .......................... 5Truck Scissor Dock ................ 4-5Weather Stripping ..................... 8DOCKPLATESAluminum Economizer ............ 16Aluminum Hand Truck ............. 16Aluminum Mini ......................... 18Steel Truck .............................. 19DOLLIESAccessories ................... 223, 225Adjustable Tote ...................... 222Aluminum Channel ................ 221Aluminum Pallet .................... 221Auto.......................................224Carpet ................................... 219Cast Aluminum ...................... 221Converter .............................. 223Cylinder ................................. 190Door & Panel Dolly ................ 217Drum ..................... 179, 182-183Fiberwood ............................. 223Floor Hugger ......................... 222Hardwood .............................. 223Interlocking Plastic ................ 254Lifting Dolly ............................ 230Low Profile Machinery ........... 225Machinery Skates .................. 226Nose Plate ............................. 222Open Deck Machinery ........... 225Pail .................................... 194Pallet .................................... 221Plastic ............................. 224-225Plate .................................... 222Plate/Slab .............................. 217Portable Carpet ..................... 219Pro-Movers ............................ 222Specialty ................................ 224Steel Dolly Set ....................... 226Steel Machine Rollers ........... 225Tote .................................... 222DRUM EQUIPMENTAdapters and Upgrades ........ 170Barrel/Drum Trucks ....... 174, 175Bung Nut Wrenches .............. 186Bung Sockets ........................ 187Carrier/Rotator ....... 167, 169-170Chain Drum Lifter .................. 180Chocks .................................. 181Clamp .................................... 179Clutchers ............................... 180Containers ...................... 196-202Controller ............................... 174Covers ............................ 185-186Cradles ........................... 175-176Crane/Hoist Drum Lifter ........ 180Crusher/Compactor ............... 167Deheader .............................. 186Dollies .................... 179, 182-183Drums ............................. 184-185Drum Stick ............................. 183Dumpers ......................... 169-170Faucets ................................. 188Funnel ................................... 188Gauge Level Indicator ........... 187Grippers ................................ 172Heaters .................................. 184Horizontal Drum Tap ............. 188Impact Socket ....................... 187Jack, Drum ............................ 173Lifter/Rotator/Transporter ...... 173Lifters, Drum ........... 171, 179-181Locks .................................... 187Lo-Profile Caddies ................. 174Manual Upender .................... 181Mechanical Transporter ........ 174Near Vertical Lifter ................. 181Pallets ............................ 177-178Poly Drum Handlers .............. 171Positioner ...................... 168, 172Pumps ................................... 189Racks .................................... 168Refuse Containers .................. 56Retention Basins ................... 177Revolving Drum Carts ........... 176Rotating Drum Carts ............. 176Slings .................................... 181Spill Containers .............. 178-179Stackers ................................ 168Stands ................................... 182Tiers .................................... 182Tilting Drum Rings ................. 180Tong .................................... 180Torque Wrenches .................. 187Transporters .......................... 174Trucks ........................... 174, 175Vent .................................... 187Vertical Drum Lifter ................ 180Wedge ................................... 181DUMPERSBox Dumpers .......................... 54Drum Dumpers ...................... 169Fork Mounted Trash Can ...... 125Hoppers .......................... 128-132Lift & Dump Drum Dumpers .. 170Multi-Purpose Tote .................. 56Pail .................................... 195Pallet Dumper/Retainer ......... 125Trash Can .................. 56-57, 125EEDGE GUARDSNylon ...................................... 97Plastic ...................................... 97Rubber .................................... 97Steel ...................................... 97ERGONOMIC EQUIPMENTErgonomic Equipment ........ 43-86FFANSCeiling ..................................... 28Circulator ............................ 28-29Commercial ............................. 29Direct Drive ........................ 28-29Portable Work Station ............. 29Shutter Mounted Exhaust ........ 28Work Station ....................... 28-29FLAG POLEFlag .................................... 141Stainless Steel ...................... 141FLOOR LOCKAdjustable Height .................. 227Economical ............................ 228Low Profile ............................ 228Standard ................................ 228FORGED FORKSForged Forks ......................... 123FORK TRUCK ATTACHMENTSBlade Protectors .................... 123Brush Sweepers .................... 121Coil Rams/Lifters ................... 121Drum Carrier/Rotators ........... 170Drum Grippers ....................... 172Drum Lifters ........................... 171Drum Positioners ................... 172Drum Stands ......................... 182Floor Scraper ........................ 120Fork Extensions .................... 122Front Loader ........................ 124Hoisting Hooks ...................... 120Hook Plates ............................119Hoppers .......................... 128-132Horizontal Drum Carrier ........ 172Lift Master Booms ..................119Loading Platform ................... 125Magnetic Sweepers ............... 120<strong>Material</strong> Spreaders ................ 124Pallet Canopy ........................ 123Pallet Dumper/Retainer ......... 125Retention Basins ................... 177Rug Rams/Carpet Poles ....... 121Snow Plow Blades ................ 124Tilting Drum Rings ................. 180Tow Balls ............................... 120Trash Can Dumper ................ 125Work Platforms ............... 126-127GGANTRY CRANESAdjustable ..................... 101, 104Aluminum ....................... 104-105Festoon System .................... 102Fixed Height .......................... 102Power Traction Drive ............. 102Steel .................................... 101Work Area Portable ............... 102GATESDoor Scissor Gates ............... 164Expand-A-Gates .................... 164Folding Gates ........................ 165Mezzanine ............................. 164Portable Gates ...................... 165Safety Lift .............................. 163Self-Closing ........................... 142GELBlue Silica ............................... 98GRABSPipe .....................................110GUARD RAILCurved ................................... 146Drop In Design ...................... 146Galvanized ............................ 146Powder Coat ......................... 146Structural ........................ 146-147GUARDSAdjustable Perimeter ............. 166Adjustable Rack .................... 154Column ........................... 156-158Column Wrap ........................ 158Corner ............................ 161-162Downspout ..................... 158-159Edge .................................... 162Gantry/Jib Guard ................... 157Heavy Duty Pallet Rack ........ 155Hexagonal Column ................ 157High Profile Machinery .......... 154Low Profile Rack ............ 153-154ModuGuard Curbs ................. 255Modular ................................. 157Overhead Door ............... 162-163Pallet Rack Back ................... 230Pallet Rack End ..................... 154Rack ..............153-155, 159-161Stainless Steel Machinery ..... 154Structural Rack Guards ......... 160Surface Mount, Removable ... 154Triple Elbow .......................... 156Wall Protectors ...................... 162HHAND TRUCKSAluminum ....................... 212-214Aluminum Ergonomic ............ 214Cart/Chair .............................. 215Convertible .............................211Dual Directional ..................... 215Dual Handle .......................... 212Fiber/Nylon .............................211File Cabinet ........................... 215Foldaway ................................211Four Wheel .....................211, 214High Back Aluminum ............. 213P Handle ............................... 212Site Cart/Truck .......................211Stair (Four Handles) .............. 214Steel Stair .............................. 214Wheels .................................. 213Wire Reel Caddy ................... 238HARDWAREConcrete Anchoring ....... 137, 157HEAT GUNSShrink Wrap, Electric ............... 95Shrink Wrap, Propane ............. 95HEATERSDrum .................................... 184Heat Panels ............................. 31Portable Electric ...................... 30Portable Electric Infrared ......... 30Portable Salamanders ............. 30Portable Infrared ..................... 31Quartz Infrared ........................ 31Spot Heaters ........................... 31HOISTSAir Chain ............................... 108Chain Hoist/Trolley ................ 105Drywall/Panel .........................117Electric Chain ................. 107-108Hand Chain ........................... 106Hoist Trailer ............................114Lever Hoists .......................... 106Mechanical Attachments ........111Mini Cable ..............................111Pallet Truck ........................... 103Pneumatic Attachments .........111Portable Cantilever .................114Shop Crane Engine .........113-114HOOKSHoisting Hooks ...................... 120Hook Plates ............................119Hooks with Shackle ............... 120Overhead Coil ........................110Pintle Hook ............................ 120HOPPERSBumper Release ................... 128<strong>Casters</strong> .................................. 129Fabric .................................... 131DESCRIPTION INDEXwww.vestil.com Phone (800) 348-0868
252DESCRIPTION INDEXJLow Profile ............................ 128Low Profile Parts ............ 130-131Open Ended .......................... 131Options ........................... 129-130Poly Lids ................................ 129Portable .......................... 130-131Power Traction Drive ............. 130Specialty Colors .................... 129Steel Chute ........................... 131Steel Self-Dumping ............... 132JACKSBasement Floor Jacks ........... 228Drum Jacks ........................... 173Fork Truck Jacks ..................... 85Heavy Duty Farm .................... 38Leveling Jacks ....................... 228Mechanical Machinery ............ 38Mechanical Screw ................... 38Trailer Jacks ............................ 37Trailer Stabilizing ..................... 39Vehicle Positioning ................ 224JIBSAir Balance Jib Lifter ..............111Extra Travel Tri-Post .............. 103Floor Mounted ....................... 103Lifter Jibs ................................113Mini Overhead Cantilever ...... 102Multi-Station Transportable ....112Portable ..................................112Portable Offset .......................112Tie Rod Jibs .......................... 103Wall Jibs ................................ 103Winch Operated Truck Jib ......112LLADDERSAlternating Step Cross-Over . 137Alternating-Tread .................. 135Aluminum ....................... 138-140Commercial ........................... 134Cross-Over ............................ 136Extension .............................. 139Fiberglass .............................. 139Folding with Wheels .............. 136Fold-Up ................................. 140Maintenance ......................... 134Modular Style ........................ 138Portable ................................. 140Roll-A-Fold ............................ 136Slope .................................... 135Spring Loaded ....................... 134Telescopic ............................. 138Tip-N-Roll .............................. 134Walk-Thru .............................. 138Warehouse ............................ 133LIFTERSCoil Lifter ................................115Cylinder ................................. 191Drum ..................... 171, 179-181Glass Lifters ...........................117Heavy Duty Load Lifter ...........116Machinery .............................. 227Magnetic Lifters ....................... 18Overhead Load Lifters ...........115Pallet Lifters ...........................115Slab Lifters .............................117Spreader Beam Roll ...............116LIFTSAdjustable Box ........................ 64Electric Order Picker ............... 81Hand Winch ....................... 63, 65Hefti-Lifts ................................. 64Hitch Lift .................................. 23Hydra Carts ............................. 64Lite Load Lifts .......................... 63Motorcycle ............................... 49Pallet Master/Server ................ 59Portable Aluminum ............. 64-65Portable Worksite .................... 65Power Traction Drive ............... 49Quick Lifts ............................... 62Residential Wheel Chair Lift .... 66Scissor ....................45-51, 68-72Synchronized System ............. 85Tote-A-Load ............................. 58Tote Lifters ............................... 58Truck Scissor Dock ................ 4-5Work Positioners ............... 57, 62LIFT & TILTLift & Tilt .................................. 51LIGHTSDock Loading Lights ........... 31-32Dock Traffic System .................. 9Fluorescent ............................. 32Halogen Incandescent ............ 32High Pressure Sodium ............ 32Incandescent ........................... 32Work Lights ............................. 32LOAD INDICATORSDigital .....................................118MMAGNETSHanging Sweepers ................ 120Magnetic Catcher ...................118Magnetic Lifters ......................118MATTINGErgonomic Matting ............. 82-83MOVERSDesk ...................................... 84Fork Truck Fork Caddy .......... 123Furniture and Crate ............... 227Gas Powered Trailer ............. 219Power Move Masters ............ 219V-Groove Pipe Mover ............ 227OOVERHEAD DRUM LIFTERSAutomatic .............................. 179Chain .................................... 180Crane/Hoist ........................... 180Drum Clutchers ..................... 180Drum Lifters ........................... 179Drum Slings ........................... 181Multi-Purpose ........................ 179Near Vertical .......................... 181Vertical ........................... 179-180PPACKAGING EQUIPMENTPackaging Equipment ...... 87-100PAIL EQUIPMENTContainers ...................... 196-202Crusher ................................. 195Dollies ................................... 194Dumper ................................. 195Hand Truck ............................ 194Lids .................................... 195Liner .................................... 196Pails .................................... 196Pumps ................................... 189Steel Pail Opener .................. 194Tippers .................................. 194Variable Height Dispensers ... 194PALLETAluminum .............................. 100Bands ...................................... 97Buster ...................................... 35Cargo Decker .......................... 42Dollies ................................... 221Drum Pallets ................... 177-178Dumper/Retainer ................... 125Galvanized Welded Wire ......... 99Inverter .................................... 55Jockey ..................................... 79Pallet Canopy ........................ 123Pallet Master/Server ................ 59Pallet Pullers ........................... 34Pallet/Skid ............................. 100Pallet Trucks ....................... 74-78Plastic .................................... 100Presswood .............................. 99Solid Deck Steel ...................... 99Spill Containers ..................... 178Steel ...................................... 99Transporters .......................... 226Washing Cabinet ................... 254Wedge ................................... 254PALLET JACKSAll Terrain ................................ 77Big Wheel ................................ 77Caddy ...................................... 79Chock .................................... 79Economical .............................. 74Electric ............................... 76-77Full Featured ........................... 74Galvanized .............................. 75Gas Powered .......................... 77Hoist ...................................... 78Low Profile .............................. 74Power Assist ............................ 78Quick Lift ................................. 75Roll ...................................... 78Roll Adaptor ............................. 78Scale ................................. 75-76Side Winder ............................. 78Skid Adaptor .............................. 8Stainless Steel ........................ 75Stop ...................................... 79Super Low Profile .................... 74Turnabout ................................ 73Wedge ..................................... 79Wheel Nose ............................. 75Zinc Coated ............................. 75PALLET PULLERSCam Action .............................. 34Chain ...................................... 34Double Scissor ........................ 34Single Scissor ......................... 34PALLET RACKINGBack Guard ........................... 230Crown Decking ...................... 229Lifting Dolly ............................ 230Nylon Netting ......................... 230Open Area Decking ............... 230Sump .................................... 230Support Bar ........................... 229Wire Decking ......................... 229PALLET TRUCKSAll Terrain ................................ 77Big Wheel ................................ 77Caddy ...................................... 79Chock 79Economical .............................. 74Electric ............................... 76-77Full Featured ........................... 74Galvanized .............................. 75Gas Powered .......................... 77Hoist ...................................... 78Low Profile .............................. 74Power Assist ............................ 78Quick Lift ................................. 75Roll ...................................... 78Roll Adaptor ............................. 78Scale ................................. 75-76Side Winder ............................. 78Skid Adaptor ............................ 78Stainless Steel ........................ 75Stop ...................................... 79Super Low Profile .................... 74Turnabout ................................ 73Wedge ..................................... 79Wheel Nose ............................. 75Zinc Coated ............................. 75PARTS BINParts Bin ................................ 227PLATFORMSAluminum Folding Step ......... 140PLATFORM TRUCKSAluminum Channel ................ 206Aluminum Sheet Deck ........... 206Aluminum Treadplate ............ 206Extruded Aluminum ............... 206Fold Down Handle .......... 206-208Fold-Up Aluminum ................. 206Hardwood ...................... 205, 208High End ............................... 215Landscape ............................. 209Nesting .................................. 209Plastic .................................... 208Pneumatic Tire Steel ............. 207Powered ................................ 220Steel .................................... 207Steel Folding Handle ............. 254POWER PACKPower Pack ............................. 85PROTECTIVE BARRIERSAdjustable Perimeter Guard .. 166Barricades ...... 142, 144-145, 155Bollards ...145, 147-150, 152-153Bumper Wrap ........................ 159Clearance Bar ....................... 163Column Protectors ......... 156-158Corner Protectors ........... 161-162Door Lock .............................. 163Door Track Protectors ........... 162Door Warning Barrier ............ 163Edge Guards ......................... 162Gantry/Jib Guard ................... 157Gates ..................... 142, 163-165Hardware ............................... 157Light Pole Base ..................... 159Machinery Guards ................. 154Modular Guards ............ 157, 255Pipe & Downspout Guards .... 158Rack Guards ...153-155, 159-161Railing ............................ 142-145Smokers Station ............ 151, 245Special Finishes .................... 148Swinging Traffic Door ............ 164Traffic Cones ......................... 155Triple Elbow Guards .............. 156Wall Protector ........................ 162Warning Sirens ...................... 166Water Disperser .................... 159PRYLEVER BARSSteel ...................................... 35Wood ..................................... 35PULLERSLong Reach Cable .................110Pallet ...................................... 34Two-Speed Cable ...................110PUMPS, DRUMElectric .................................. 189Hand Pump ........................... 189Lever Action .......................... 189Pail .................................... 189Rotary .................................... 189Self-Venting ........................... 189RRACKGuards ............153-155, 159-161RACKINGBar Stock Trees ..................... 234Cantilever Racking ......... 231-234Carton Flow ........................... 234Drum .................................... 168Phone (800) 348-0868www.vestil.com
253Economical <strong>Material</strong> .............. 237Expandable Vertical .............. 235Horizontal Bar Rack .............. 235Horizontal Sheet Rack .......... 235Internestable Rack ......... 236-237Pallet ............................. 229-230Pigeon Hole Rack ................. 237Reel .................................... 238Self-Supporting ..................... 237Stackable Bar Cradle ............ 237Standard Sheet Rack ............ 235U-Racks ................................ 237Variable Height Sheet Rack .. 236Versa Racks .......................... 236Vertical Bar Rack ................... 235Vertical Storage Rack ............ 235RACKSFork Extension Storage ......... 123Bicycle ................................... 255RAILINGIndoor Personnel ................. 145Interlocking ............................ 144Plastic Chain ......................... 145Semi-Permanent ................... 144Stainless Steel ...................... 143Steel Pipe .............................. 142Steel Square ......................... 143RAMPSAluminum Vehicle .................. 255Autoloader ............................... 21Container ................................. 15Multi-Purpose .......................... 25Pick-Up/Van Ramps ................ 23Rubber .................................... 25Walk Ramps ....................... 20-21Wheel Chair ............................ 23Wooden Kits .............................. 2Yard Ramps ....................... 13-14REELCaddy .................................... 238Rack .................................... 238REELSAir Hose ................................ 244Electric .................................. 244Spring Driven ................. 243-244RUG RAMSCarriage Mounted ................. 121Fork Mounted ........................ 121Fork Mounted Inverted .......... 121SSCAFFOLDINGAluminum, Folding ................ 141SCALESCrane Scales ..........................118Digital Floor Scale ................... 92Integral Scissor Table Scale .... 46Low Profile Floor ..................... 92Pallet Truck with Scale ....... 75-76Parts ...................................... 91Portable Floor .......................... 92"U" Shaped Platform ............... 92SCISSOR LIFTSAccordion Skirting ................... 44Air Bag .................................... 47Built-In Carousels .................... 46Double ..................................... 48Electric Hydraulic .................... 45Foot Pump ............................... 69Ground .................................... 50Integral Scale .......................... 46Lift & Tilt ............................. 51-52Low Profile .............................. 50Motorcycle ............................... 49Portable ................................... 49Power Traction Drive ............... 49Programable Height ................ 46Remote Control ....................... 46Rotary Air/Hydraulic ................ 48Shorty ...................................... 48U Type ..................................... 50Work Station ............................ 49SCOOTERManual Scooter ..................... 220SEALERSImpulse Bag Sealers ............... 96Packaging Sealers .................. 95Pneumatic ............................... 96SEATSAssembly ................................. 83Back Support ........................... 84Ergonomic ............................... 83Fork Truck ............................... 84Massage & Heat Cushion ....... 84Worker ..................................... 83SHELTERSDock ................................. 10-11Shelter / Bus Stop ................. 245Smoking ................................ 245SHELVINGPlastic Bulk ............................ 241Plastic Work Bench ............... 242Roll-Out ................................. 234Stainless Steel ...................... 241SHOP TICKET HOLDERSShop Ticket Holders ................ 97SIGNSDrivers Beware ........................ 39Trailer Instructions ................... 39Wheel Chock ...................... 36-37SIRENSWarning ................................. 166SKIDAdaptors .................................. 78Plastic .................................... 100SKIRTINGAccordion Skirting ............... 5, 44SLINGSPolyester ................................118STACKERAdjustable Box .......................... 4Basket & Skid ......................... 59Counter-Balanced ............. 59, 61DC Powered ............................ 60Hand Pump and Electric ......... 60Hydraulic ................................. 60Hydraulic Drum ..................... 168Manual .................................... 60Pallet Master/Server ................ 59Powered Drive ......................... 61Powered Lift ....................... 60-61Winch ...................................... 60STAKESSurface Mount Flexible ......... 156STANDSAluminum ...................... 138, 140Drum Stands ......................... 182Fiberglass .............................. 139Fold-Up Step ........................... 79Pallet Stands ........................... 65Paper Dispenser ..................... 98Roller ...................................... 57Sign Post Bases .................... 166Sign Stand ............................. 166Step-Mate ................................ 81Tripod Hoist Stands ................115Work-Mate ............................... 80STAPLERSCarton & Box ........................... 96STOOLSPolyethylene .......................... 141Rolling Step ........................... 141STORAGE SOLUTIONSStorage Solutions ........... 229-245STRAPPINGCargo Strapping ...................... 33High Speed Machine ............... 95Hook & Loop ........................... 97Manual Pallet Probe ................ 94Pallet Probe ............................. 94Poly Dispenser ........................ 93Poly Strapping ......................... 96Steel Strapping ........................ 96Strapping Cart ......................... 94Strapping Machine .................. 94Strapping Tools ....................... 95Strap Winches ......................... 34Vertical/Horizontal Cart ........... 94STRETCH WRAPDispenser ................................ 93Film ................................ 87, 93Hand Held ............................... 93Knife ...................................... 93Scale ................................. 87-88Semi-Automatic Machine ... 87-88SWEEPERFork Mounted Brush .............. 121Magnetic .................................. 42Magnetic Sweepers ............... 120Manual Brush .......................... 41TTABLESAir Bag .................................... 47Die Table ................................. 71Foot Pump ............................... 69Lift & Tilt ............................. 51-52Low Profile .............................. 50Mechanical .............................. 68Mobile Tilting Tables ................ 57Opti-Bench .............................. 86Pneumatic ............................... 71Post, Hydraulic ................... 67-68Post, Mechanical ..................... 68Power Traction Drive ............... 49Rotary Air/Hydraulic ................ 48Scissor ............. 45-50, 51, 69, 71Spring Self-Elevating ............... 66U Type ..................................... 50Work Positioners ............... 57, 62TILTERSAir Corner Tilter ....................... 54Bench Top ............................... 53Economy ................................. 53Efficiency Master ..................... 53Electric/Hyd. Corner Tilter ....... 54Ground Tilter ........................... 51Hinge & Sliding ........................ 52Mobile Tilting Table .................. 57Pallet Inverter .......................... 55Portable Uni-Tilt ..................... 52Single Scissor (Uni-Tilt) ........... 51Tilt Master .......................... 54-55Tilt Master Straddle ................. 55TONGSBeam .................................... 109Die .....................................110TOOL BALANCERSTool Balancers ....................... 244TOOL BOXAluminum Tool Case ............. 242Portable Aluminum ................ 242TRAILER LOCK SYSTEMTrailer Lock System .................. 8TRANSPORTERSCarouse ................................. 226Corner Guard ........................ 226Drum Caddies ....................... 174Drum Controller ..................... 174Fixed Height .......................... 226Machinery .............................. 227Pallet & Container ................. 226Tilt .................................... 226Trucks ................................... 175TRAYSUtility 178TROLLIESChain Hoist/Trolley ................ 105Low Profile Manual ................ 105Quick Install Manual .............. 105TRUCKSAppliance .............................. 214Barrel/Drum Trucks ............... 175Chip & Waste Trucks ............. 132Easy-Access Stock Truck ...... 205Folding Security Trucks ......... 218Hand Trucks ................... 211-215Hand Winch ............................. 65High Rise ................................. 58LP Tank Truck ....................... 193Manual Low Profile Drum ...... 174Multi-Purpose Drum .............. 175Pallet Straddling Drum .......... 174Panel Truck w/ Storage Tray . 216Poly Industrial Tilt .................. 127Portable Steel Dump ............. 131Powered Platform .................. 220Spring Assist Drum ................ 175Stockpicker ..................... 203-204Tilt Back Drum Truck ............. 175TURN TABLESCarousel .................................. 91Heavy Duty .............................. 89King Pin ................................... 89Manual ............................... 90-91Powered .................................. 89Thin Spin ................................. 90VISESQuick Adjust ............................ 85WWANDPallet ...................................... 93WEATHER STRIPPINGWeather Stripping ..................... 8WHEEL RISERSAluminum ................................ 22Portable Caddy ....................... 22Steel ...................................... 22WORK PLATFORMSAdd-A-Level ............................ 82Dual Side Door Entry ............ 126Fold Down ............................. 126Fold Down Ramp .................. 127Linearizer Electric .................... 81Opti-Bench .............................. 86Optional Accessories ............. 127Posi-Crank .............................. 81Single Side Door Entry .......... 126Stockpicker ............................ 126WORK TABLESAdjustable Ergonomic ............. 86Electric .................................... 86Linear Actuated ....................... 86Opti-Bench .............................. 86DESCRIPTION INDEXwww.vestil.com Phone (800) 348-0868
BRAND NEW PRODUCTS254NewmodelPPW-748BOL-DRINGNewmodel VHPT-SL-LEG withVHPT-SL-JACKPhone (800) 348-0868Can't get enough? Here are some more products - fresh from the drawing board!Be sure to check VESTIL.COM regularly for more new products!shown with optionalPCS-HDL handleNewBOL-JHOOKmodelPCS-1626NewmodelOEPW-1700NewNewInterlocking Plastic DolliesStong, lightweight dollies include special interlocking edges that allow users to connect multipledollies together to form a larger platform size. Hand holes are included for convenient carrying,while special pockets in the deck allow for easier stacking. Units roll on four swivel 4" x 1"polypropylene casters. Optional steel handles are available. Handle height when installed is 26".MODELNUMBERPLATFORMSIZEUNIFORMCAPCITY (LBS.)NET WT.(POUNDS)LIST PRICEEACHDECK HEIGHTPCS-1626 6'W x 5'4"L 6½" 250 10 $49.00PCS-HDL OPTIONAL STEEL HANDLE 4 $19.00DC-20/UPSSteel Folding Handle Platform TruckSteel platform truck includes a fold-down handle for convenient storage. Handle includesunique fold-up storage pocket for tools, picking slips, or whatever the application requires.Platform features rubber edge guards and a non-slip rubber surface. Trucks roll smoothly on tworigid and two swivel 4" casters. Steel construction with a painted finish.MODELNUMBERPLATFORMSIZEDECKHEIGHTHANDLEHEIGHTUNIFORMCAPCITY (LBS.)NET WT.(POUNDS)LIST PRICEEACHSF T-1929 19"W x 29"L 5¾" 27" 330 10 $129.00DC-20/UPSPallet Washing Cabinet & Optional Pressure WasherOur Stainless Steel Pallet Washing Cabinet makes it easy to rinse, clean, and remove debristhat can accumulate on plastic pallets. Constructed entirely of stainless steel, simply plug inyour existing pressure washing hose using the snap connector provided. Minimal installationrequirements include a connection to a minimum of 6GPM @2500 PSI. Since there are nomoving parts, this washer is perfect for low volume applications involving slightly soiled pallets.MODELNUMBEROPENINGPALLET SIZEOVERALLDIMENSIONSNET WT.(LBS.)LIST PRICEEACHRESERVOIRPPW-748 7"W x 48"H 10 GAL 76"H x 39"L x 39"W 350 $6,095.00DC-20/FC-100Model OEPW-1700: Optional Electric Pressure Washer is heavy-duty commercial grade. Comeswith magnetic motor starter and industrial rocker on/off switch for pump motor with autostart/stop function. Wand assembly is stainless steel with variable pressure, 4 quick disconnects,stainless steel nozzles, and down-stream detergent injector. 3PH, 10HP motor is wired to230V/240V.MODELNUMBERWATER PUMPPRESSUREOVERALLDIMENSIONSNET WT.(LBS.)LIST PRICEEACHHOSEOEPW-1700 2500 PSI 3/8" ID x 50' 30"H x 30½"L x 20"W 325 $5,490.00DC-20/FC-125Chain Attachments for BollardsWelded chain attachment allow you to create barriers around workstations and machinery. Idealfor indoor and outdoor applications. Factory installed (welded). Available on all sizes of SteelPipe Bollards. Powder coat safety yellow finish. Steel Pipe Bollard and chain sold separately.MODELNUMBER DESCRIPTION LOCATIONMODELNUMBERUSABLEOPENINGNET WT.(LBS.)NET WT.(LBS.)LIST PRICEEACHSPACINGBOL-DRING D-RING 6" FROM TOP 1 3 /8" 180° 1 $11.00BOL-JHOOK "J" HOOK 6" FROM TOP 2"D x 1"H 180° 1 18.00SNAP-H-25 ¼" SNAP HOOK, WORKS WITH COIL CHAIN ABOVE 1 $2.50DC-20//FC-50Semi-Live Skid Legs & Lever JacksThese are new options for our Steel and Hardwood Platform Trucks (see pages 207-208). Skidlegs attach to existing caster mounting holes (hardwood decks) or to existing caster brackets(steel decks). Legs and jack feature a durable powder coat finish. Options may be customer orfactory installed.LIST PRICEEACHDESCRIPTIONVHPT-SL-LEG SEMI-LIVE SKID LEGS (FOR HARDWOOD PLATFORM TRUCKS) 15 $38.00VHPT-SL-JACK SEMI-LIVE LEVER JACK (FOR HARDWOOD PLATFORM TRUCKS) 19 38.00SPT-SL-LEG SEMI-LIVE SKID LEGS (FOR STEEL PLATFORM TRUCKS) 15 33.00SPT-SL-JACK SEMI-LIVE LEVER JACK (FOR STEEL PLATFORM TRUCKS) 19 24.00DC-25/UPS/FC-70www.vestil.com
Stainless Steel Scissor CartOur fully welded Model SSSC carts resist corrosion and wet environments. All parts are madefrom 304 grade stainless steel, including the hydraulic pump and foot pedal. These carts aresuitable for most food, medical, and pharmaceutical industry settings. Also suitable for washdownapplications. 2 rigid and 2 swivel polyurethane wheels with brakes standard. Units featurea high quality actuated, single-speed hydraulic pump. Handle height is 39".New255MODELNUMBERPLATFORMSIZEUNIFORMCAPACITYNET WT.(POUNDS)LIST PRICEEACHSERVICE RANGESSSC-200 17¾"W x 27½" L 10 7 /16" TO 29¾" 200 LBS. 88 $2,940.00SSSC-400 19 4 /8"W x 32 11 /16"L 13" TO 35 13 /16" 400 LBS. 172 3,588.00DC-20/FC-70ModuGuard Modular Guard CurbsThe ModuGuard Modular Guard Curbs may be used in hundreds of applications for protectingrack and machinery. These innovative guards feature sloped sides and ends for better protection.Great for use indoors or out, units install easily with the concrete installation hardware(available separately). Bright yellow finish helps attract attention.modelSSSC-200modelSSSC-400MODELNUMBEROVERALL SIZE(L x D x H)BOLTHOLESNET WT.(POUNDS)LIST PRICEEACHSTYLEMPG-C CENTER SECTION 21¼" x 6" x 5" 2 13 $38.00MPG-E END SECTION 21¼" x 6" x 5" 2 13 38.00MPG-T T-SECTION 12" (8¾"L) x 6" x 5" 1 11 33.00MPG-L L-SECTION 8¾" (8¾") x 6" x 5" 1 8 24.00MPG-ABK-1 CONCRETE ANCHOR KIT (FOR MPG-T & MPG-L) 0.5 $6.00MPG-ABK-2 CONCRETE ANCHOR KIT (FOR MPG-C & MPG-E) 1 $12.00DC-20/UPS/FC-50Aluminum Vehicle Twin RampsRamps provide a safe means for driving vans, pick-up trucks and some passenger vehicles fromground level into and out of high building entrances. Ramps can be securely fastened to dockwith pin locks. To avoid hang-ups, measure under clearance and wheelbase of vehicle. Theoverall width is 18" with a usable width of 14". Side curbs are 1¼" high. Welded aluminumconstruction.MODELNUMBERUNIFORM LOAD CAPACITYPER PAIR (LBS.)WORKING HEIGHT(MAX TO MIN)NET WT.(LBS. EACH)LIST PRICEPER PAIRLENGTHVTR-7-14-8 7,000 17½" to 12½" 8' 62 $1,508.00VTR-5.5-14-10 5,500 22½" to 16" 10' 77 1,798.00VTR-7-14-12 7,000 27" to 19" 12' 126 2,210.00VTR-6-14-14 6,000 32" to 22½" 14' 144 2,524.00VTR-5.5-14-16 5,500 36½" to 25½" 16' 166 $2,835.00VTR-6-14-18 6,000 41" to 29" 18' 201 3,376.00VTR-5.5-14-20 5,500 46" to 32½" 20' 228 3,702.00VTR-5.5-14-24 5,500 55½" to 39" 24' 288 4,620.00DC-20/FC-100Bicycle RacksOur Bicycle Racks make it easy to store bikes where space is at a premium. Welded steel units featuremounting flanges pre-drilled with 7/16" diameter holes for easy mounting (hardware sold separately).Racks are shipped fully-assembled and ready to use. Standard in a galvanized finish (model BR-GL-Gonly) or black powder coat finish. Other powder coat finishes are available at an additional cost.Please contact factory.MODELNUMBERMOUNTINGHOLESNET WT.(LBS.)LIST PRICEEACHMOUNTING STYLEOVERALL SIZEBR-GL-G GROUND FLANGE 2 26"L x 20"W x 40"H 40 $239.00BR-L2-BK GROUND FLANGE 4 40"L x 36"H 50 209.00BR-L3-BK GROUND FLANGE 4 65"L x 36"H 75 259.00BR-ST-BK GROUND FLANGE 4 36"L x 20"W x 26"H 95 249.00BR-M3S-BK GROUND FLANGE 4 40"L x 18"W x 26"H 120 279.00BR-M3D-BK GROUND FLANGE 4 40"L x 28"W x 26"H 140 329.00BR-M3S-W-BK WALL FLANGE 4 40"L x 18"W x 10"H 65 229.00AS-383 3/8" x 3"L CONCRETE WEDGE ANCHOR (SOLD EACH) 0.1 $3.00SPECIAL POWDER COAT FINISH OPTIONSDC-20/UPS/FC-125ERGO BLUEBATTLE SHIP GRAYSILVER LININGEARTH BROWNSNOWY WHITESODA REDCITRUS ORANGEHUNTER GREENSKY BLUEMACHINE GRAYSANDY BEIGEKHAKI TANFDA WHITEBUBBLE GUMYELLOWTRACTOR GREENBR-GL-Gwww.vestil.com Phone (800) 348-0868MPG-CMPG-TBR-L3-BKBR-L2-BKBR-M3S-BK BR-M3D-BK BR-M3S-W-BKMPG-EMPG-LNewBR-ST-BKBRAND NEW PRODUCTS
SPECIAL CUSTOM FABRICATION256Occasionally you will find that an off-the-shelfproduct will not work for your application. Ourflexible engineering and manufacturing processes sallow us to make design changes and customizeour products to meet your specific needs.Please contact our sales department for a productsolution today.SPECIALSSPECIALSSPECIALSSPECIALSPhone (800) 348-0868www.vestil.com