Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ITK Polyclonal Antibody, Invitrogen™
Rabbit Polyclonal Antibody
Supplier: Thermo Scientific PA579542
Description
The synthetic peptide sequence is 575-617aa, FRLYKPRLASTHVYQIMNHCWKERPEDRPAFSRLLRQLAEIAE Add 0.2 mL of distilled water, will yield a concentration of 500 μg/mL.
ITK is an intracellular tyrosine kinase expressed in T-cells. The protein contains both SH2 and SH3 domains which are often found in intracellular kinases. It is thought to play a role in T-cell proliferation and differentiation.Specifications
ITK | |
Polyclonal | |
PBS with 4MG trehalose, 4MG trehalose and 0.05MG sodium azide, 0.05MG sodium azide | |
Q03526, Q08881 | |
ITK | |
A synthetic peptide corresponding to a sequence at the C-terminus of human ITK. | |
100 μg | |
Primary | |
Human, Mouse | |
Antibody | |
IgG |
Western Blot | |
Unconjugated | |
ITK | |
Tyrosine-protein kinase ITK/TSK, Interleukin-2-inducible T-cell kinase, IL-2-inducible T-cell kinase, Kinase EMT, T-cell-specific kinase, Tyrosine-protein kinase Lyk, ITK, EMT, LYK | |
Rabbit | |
Antigen affinity chromatography | |
RUO | |
16428, 3702 | |
-20°C | |
Lyophilized |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction