2000 04 The Computer Paper - BC Edition by The Computer Paper

FREE

IiIJ'O w w.canadacomp!l tes.corn

,ILt'; EQFI;ION ILOWER MAINLANOI

000 VOLUME 13 NO 4

J (J~) JJM~2 JJ~ ~

m ~j r

i Jr )

~i '~

~ f A~c~

t r:.

•

D44L

•

Business

•

Solutions IMMENSION XPS Tgeer

DIMENMON XPS T000r • Intr' Pentium' Rl Processorat mmMHz • 128MBSDRAMMemory • IDGB'UgraATAHard Dme (7200 RPRI) • 17uETIOMonitor (16.0" v.is.) • 16MB All Rage120Pro Qaphics • 40X MaxVariable CD-ROMDmm • SaundDaster 64VSound

• Intel PenbumBI Processor at 700MIR • 120MBSDRAINIrienwy 20GB' Ultra ATAHwd Drive(7100 RPM) • 17" E770Monitar (16.O"vis) ' 31MB NIDIA TN12M64AGPGmphics • 402 MaxVariable CD-ROMDme • Soundglasler Uvel 512VSound

• herman/kardonSpeak«s

• herman/kardonSpeakes

3Com' 3C905C-1XM10/100 Blnmet Card • Microsoh' Windows' 90 SecondEdigon • Nlicrosolt Ogice 10OO Small BusinessErfigon • 3 Yearlimited Warranly'

• SCom3COO SC-TXM 10/100 Bhemel Card • Microsofl Windows 90Secand Ediuon • Microsolt Olfice 2000Small Business Edigon • 3 Year limited Warranty'

DIMNRSION XPS 07$$r • Intel Penlium RIProcessor at 733MHz • 120MBRDRAMINemwy at 356MHz • 20GB' Ultra ATAHard Dme (7200 RPM) • 17" MTN Monrior (16,0" vis.) • 32MB NVIDIA1NT2M64AGPGraphics •OXMaxVar iable DVD-ROM Dme • Soundglaster live! 512VSound • Altec taming AG-340 Speakers with 5ubwoofer •3Com 3C905C-TXM 10/100 BhemetCard • INicrmoft Windows 90second Bfrihn • hlicrosoh Olfrce 2000Small IkmnessEdibon • 3 Year limited Warranty'

• • •

the XPSSeries is o grad mragbasinessso/ufmn wdbalFordabfe/of«once end paver.

Amfesof upgredeabfedesktopsdeigned for mnningmemwybungry appfrcefkrnswbrfebd/anc/xg mat dud~rm for mmimumvalue

ten

POLL OIMSllL%ON L SERIES Peshlgglge. Fhet Series defiven aiFordoMecompaDTv7ily, muSmafra pafwnance endndnmridrg far your office B urger-priced small busineu pone for ~ s epplicogons Ag areupgrodesbfe ond mme w88Deg's

renownedservice andsupport

•

'LI3

•

Q Dsie Cafe; lUISTSSPl

Q nude Qa: ZHC SFaun

EI oruguQh znrs Innpl

DIMENMON XPS TSOOr ODSgerSHD

DIMENSION XPS TTOOr I pSeeegao

DIMENNON XPS DT$$r ~

• 20GS'Ultra ATAHard Dme (TZN RPM)Add $100' • S wndBlaster live! S12V Sound AIM S130' • 3YrwrNud hakmn DayOnSkeSeniice' Add I tga'

• 30GB'Igha ATAHard Drive (7200 RPgs Add $120' • 25$58 SDRAMMemory Add$320' • 3YearNmtIhuin«S DayOn.gte Sevke' Add SIN'

• 19"M 990hkeitor (100" v/s) A dd NTD' New 32MBNVIDIA geTORCE4X Add$220' AGPQaphics Card • 3 YewNndhmwus DayOn.sh Sendce' Add SIN'

DIMENNON LSOOew • Intel' Celemn™ Processor at SDO MHz • 31INBSDRAMMemory • 43GB' Ultra ATAHard Drive (5400 RPM) • 15" 6550 Monitor(15.7"vis) • htd 3D AGPGraphic • 4NMax Variable CDdtOMDrive • Swmdglasler 64VSound •3Com' 3C905C-IXM 10/100 EgwmetCard • Microarit' Windows' 90 SecondEdihm • Iriiuosolt Ogice 2000Small BusinessEdition • 3YearUmiled Warranty'

IMMENSION LS Set

DIMEWION lSSOr

• Intel Penlium RIProcessor at 550MHz • 64MB SDRAMMemory • IDGB'Ukra ATAHard Drwe (7200 RPM)

• Intel PenhumRIPracessor at 550MPH • I28MB SDRAMMemory ' IOGB' UlhaATAHard Dmn (7200RPM)

•

$5O

EI oee cudr. sluecseeI DIMENNON LSOORM OpSseschm IOGB' UlbaATAHard Drive (7200 RPM)Add$50' • 64MB SDRAM Memory Add$00' •3 m V NegBur inem DzyOn5iteSendrxf Add $169'

• 15" E550Monitor (13.7" vis)

• IT' E770Manitor (16" vis.)

• Intel 3D AGPGraphics • 401 Iriax Variable CD410MDriue • Soundglmte 64V Sound •3Com 3C905C-1XNI10/100 BhanetCard • Miaosoft Windows90Second Editian

• intel 3D AGPGraphia • 40X MaxVariable CMOM Dme • Soundglaster 64VSouci

• MicrosoftWwksSuite with MoneyBasic • 3 YearUmited Warranty'

•

$5K

• herman/kardon5peakers •3Com 3C905C-1XM 10/108 Ethernet Card • Microsoft Windaws90 Seamd EISon Microsoft Ogice MN Srmll BminessEdition • 3YearUmited Wananly'

• •

Q osie cade:lrnulssrpl

Q aude Cak: lun lmePl

IMMENSION lS Der IISSmmleo

DIMmWON LSSO D~

Add $150' • IDDMBiomega Dp Drive with One Dhk Add $99' • 118MBSDRAINMemory Hard Dme fi200 RPIN) Add$100' •8XMaxVariableDVD4IOM Drhe Add $74' • 20GP Ulba ATA • 5YearNet hence Day On.sgeSeniice' Add $169' • syimNoeheessDayOrvgh5enice' Add $169'

.dell.ca 1-800-863-F305 1Iuur Ducamuhk Price.SITIPPINGANDAPPHCMHETees NOT IHCIUDEO.PRKESANDSPKIHGOIONSVAHDINCAIMDAontynur SII8IKT TOONNGEWHHOUT

NOIKE5uaueeduesnut indudedunsnerM ad may dilfe horn mal Tawn Ise'ug arngel by M Fmruciulsunlnu canada,e 'ekpsdrnr wary a eu Egal henm sevens uuly.Isve prie hve msssmash Isuu, solus re eah upwunl rud nallhmy. Fe mrrzuruuhuheuur a uqiry orker. leasetens s ojcn ru dsuguwehuuremu. 1FurIhrd or'wa, Ggnem I hwuuhyhs ruhraauhk npudryues drpund'mgw upurr6ngeuhemee 1seeM'1 Hwnnly aul srkuceu suuim QiduIur Tugdregs Furumpy plmu wwuruM ranch lss cordonaller Road suzesel, Nelh Tax onhriu hit H115 eruct wwwdrgra 4osis write

penuggmotil

may nmheungrhh in uslu'msulu. IKHNICIANNlt 8E OOPMOIEOIFNKESSA« FOllOWINGPHONESHEDTROIIOIE STIOOHNG. QR rhu M logo, Ohuems, ds E hgu ad 8uDhuu eu hudeeh d Dd comymr cepuague md, es Iuul trade hguundpunwuu au ngilhrud rrdsurrh ml Qkruu is 1erdrneh of hal cap«aha Mimeo ad twnhm au rrgiwrud rudsurriu d Mieedl cepalrhn Num ha nghlmd oakueh of Keu Qpurrsus AE uwuruudeeh rud re«cavd IrldsnahasIhuprupcnydlhsr nrpucgn hddss Olouo M Qmaar capurr6m Agriga merel

E®LL+ www.dell.ca

ge1N. T

BUSIN

0 0

Pie ' SyncMaster 170MP

uv e

• Eligh-breed TFT-LCOmonitor • Built-in TV tuner

•

QwikLaser Printer QL-6100

. He®

QwikLaser Printer + > ul QL-5100A

• 12 ppm

• 12 ppm • 600 x 600 dpi • 4 MB memory

ye+

QwikLaser Printer QL+050

• 8 ppm • True 600 x 600 dpi • 4 MB memory

• True 600 x 600 dpi

• 4 MB memory

r •

•

MSRII

':. i

MSRP

la II

T ~0 SyncNlaster 770TFT -. • 17" viewable size

/gal

iv '

SyncMaster 700NF

• Optically fiat image

0 • LCO display

25 mm Aperture Grille Pitch

• 26 mm dot pitch

' 0 •

•

Multi-Function

Multi-Function Printer SF-5100P

Printer SF-5000P • 8 ppm • 600 x 600 dpi

•

na Ib vl

• 6 ppm

•

• 2 MB memory

•

• 300 x 300 dpi

MSRP

• 2 MB memory

Yfa0 ay

•

0 0

SyncMaster 753OF

• Flat sdeen - novhibie curvature • .20 mm dot pitch

SyncMaster 750s

• 16" viewable size • .27 mm dot pitch

uuRp

• 6x OVO-ROM, 32x CIRRO RealMagic™Hollywood II Plus MPEG card • 6 games nry m candy, paouoe dtgour •Hr ualdnr'F GaIr Ma dden

• 64 MB Internal flash nleynorv • Seven preset equalizer modes ~ • 20 Hz - 20 kHz I

MSRP

qe9P

IL ~

H eavy Gear u

H FI 'l s

Irtrcparr

IN stfsfgso

ka wriri •

•

MSRP

unRp

cr zeaasamcupa Becfrunid canadaIuc.vdpp, srcuosfw, oruorlaf andouikiwer amfrodem adu ofsaouuogBcdnmid co. Md. Manufaccucw mggwledrecoil priceiswbjed Io changowilhouf priornotice. pricesamcubjed Io applicablemcef, oealm marsell fw Iwc.Appearanceaod p IgmfionsamIubjcd Io charunuifhwu prioruofioe.Agofher brandaod pmdud oammwe rcgiclwwl IrademarksorIradcmorlu of their mpedivemmpauics.

'ALL SAMSUNG PRODUCfS ARE AVAILABLE AT. Aspert Technologies 110 - 11100 Bridgeport Rd. Richmond 604-232-0328

Campus Computers 108 - 2605 BridgeSt. Vidoria 250-920-9828

Dexton Computers 3112 Boundary Rd. Burnaby 604-437-0077

Evergreen Computers 1615 Lonsdaie Ave. North Vancouver 604-990-3960

Frontier Computers Micro Concepts Ste 105,1755 West Broadway Ste 102, 1245 West Broadway Vancouver Vancouver 604-73941060 604-730-8183

•

• •

•

Canada'sComputer Information Source

AVw&

BC EDITION APRIL 2000

6 From the Editor

8 t i ers 122 The Last Byte

Johnny Canuckvs. the Bruin Enters

76 Systems for collaboration, teamwork 76 freeteam Web portals 76 lAN Line: Eamith server 8 gateway 108 When teams go awry

10 A fi rstlook at Palm's colourhandheld

82 Exploring Windows 2000

12 What's New

82 Linux Inside: Anticipating Linux 2.4, KDE2.0 82 Graphite igook unveiled at MacWorld Tokyo

14 Sir, it's your fridge calling TCPfools into convergenceet home 22 Theworld ofcomputing ...mmingsoon to o telension neor you 23 Oigitat devices go au naturel 35 Revisiting the family network HomePHAnetwork solution continues advance 44 ISB gives lAN high-speed Internet

87 Micmsoftlaunches Windows 2000

109 Windows2000 Pm a smooth install

92 Papers create Canada's largest onbnejob site 92 Weavingyourown Web site:Part 55 Cascading Style Sheetsr Port 13 92 AppleCanada launchesonline store

93 Cali forniafirm smeDssuccessonline 102 Mom DS!. ofl'erings for Canadians 48 Desktop video-processing software 48 DeskJet1220cxi a capable tabloid inkjet

48 Money makessense Moneyend Quicken look more al ike than ever

49 Apple targets video enthusiasts and pms TCPlooks ot iMoc DV,PowerMec 64 64 Take one!

TCPlooks ot PC-hosedvideoediting systems 65 Analogue-to-digital video-editing survey

94 Offi ce Suite Training:Back to basics 94 Linux for NewbiesPart 9: Youhavemail 94 VB Tutorials Part 9r Password and splash tricks

100 learning Red Hat Onux lacks depth 100 Running Linuxfor neophytes, power users 104 Quick tips for PowerPoint

103 Low grades for Real Mence software 111 Home software suite includes the Works

112 Marketplace

112 Just ifying personalfinance software

117 Adver tising Index 118 User Groups 119 Calendar

119 Classifi ed

op 9 TM

Friendly. Flexible. Fun. BP EhfPAC Front Volume Infra Red Remote Control Included

llasterPC by EMPAC is designed for you to choose award-winning, brand name components and develop a PC that'sjust right for you. You no longer have to worry about compatibility because all components have been pretested for reliability, and high-quality performance.

Control Knob lwith mute)

Intel' Celeron Processor 433MHE

Bulk-in FM Tuner

32MB (PCIBB)RAM,BSGB Hard Dnve Windows' 00 (2nd Etu Grsphias Blaste SIVATNT AGPw/16MB SDRAM M o n itnr Exha Creagvs'S2XCDJIOM CrsesveeEnsonigAudio PCIsmmd sard Bloater PCChassis Win00104 Keyboard,Scroll M ousewlPad

InteP Pentium'III Processor SSOMHB assed

Modem Blsstm MK 64MB(PC100)RAM, 1 SGB Hard Drive Grophiss Bloater' RIVATNT AGPw/16MB SDRAM y n n dows'00 (2nd E(L) Creative SX DVD w/ DXR 3 Deooder MonitorExlm Creative SoundBlaster uvel

Crwmve' Chassis 0 Iwl Infra RedRemote Contnd) W in90104 Keyboard,Ssre0Mouse wl Psd

Front Panel Interface Center IUSB, Optical output, MIDI, Audio In/Outputl Awerrf-Wlnnfny fprv2r/9rcte Sound Bloater IJtml

Seri Sound Card. PC World June1999(USA) 1999 World Class Award,PCWorld June 1999 (USAI

• C-DVO Encore SX Winost. Winuorw Mega(inc. April (999 (USA) trDDVD' Encore Dnr 2

Best Buy. PC Woriu Juns1999 (USA)

ersphho Moran' MVA 1HTS tmm Drool Award, osmevs DepotJune 1999 I USAI Modem Bloater Rash Sa PCI Ediiow Choire, PC Msgmins July1999 (Turkey)

Csmhrldae Sounuwortts' Speehere Serleo The Family PC 190 Award, Family PC June (999 (USAI PCWerhs FourPolntaunound

Sponsors

Best PC Speakers, PC World August 1999 IUSAI

2 Yeas Warr a n t y Afi BIBSterPC'6 carry 8 2 year limited wsrrenty With first Veer on-site service. (ons(team/re mayno(be eut((sbi'e(neerie/n riess/

Celeron • eerssres

S4M 8(PC100)RAM, 0068 Herd Drive Graphissshntw RIVATNTAGPw/ISMBSDRAM Cmatiwp 62X CDROM crestivd' sound Bloater uvel Creative' Chen(a 0 (w/ Infra Red RemoteContmll W in90104Keyboard,Ssra0 Mouse wlPad

3 ComNetword sard W i ndows'00(2ndEd) MonitorExtra

Bust Buv, chip Megurinh April trna (inuiei

Graphics Master MVA TNT

(noe l.),

Intel' Pentium' III Processor SSOMHE

;R ~i e pentlumIll

Intel' Celeron Processor 433MHS 32 MBIPC100)RAM, 0868 Hsnl Drive

Graph(as Slastw SIVATNTAGPw/10 MBSCRAM Crmmve' 62X CDJIOM CrmnivenEnsonia Audio PCIseund emd Bluster PCChassis W in90104 Keyboard,Sarog Mouse wl Pad

Modem Blastm' 96K Wt ndowseQnd 90 Ed.) Monitor Extra

npc eyemmu uun hereuunngmuu upon request.

InterPentium Bl Processor also svsihble tnterceleroriPraeasmr also available

•

0 r • •

o •

• •

•

Free Shipping!

The glass is half full rccogruxeas the computer." ment in learning and Millennium Edition, or Windows ing the firstgeneraThese first-gcoeration systrou - ME, the successor to Windows 98, tions of what are tems are aimed at the business bleshooting to make will be out later this year. But again, referred to aslegamarket, and the arguments for sure thc v ideo and improvements to the mean time cy-free and legajust want it to world" ) their adoption indude lower audio werc being cor- between reboots for this OSare still cy-reduced syssccln to haec rcsonatcd tems. Among initial cost and easier manageabecauseI havereceived a rectly captured. unknown.) biTity. However, no manufacturlot of feedback &om With the latest digital Linux distributions &om Cord, the manufacterhas ruled out home variavideo products, moving Storm and others claim ease of urerss who've TCP readers. Tony tions of t his basic c o mparable to announced Colbers wrote "you hit v ideo data into t he installation design. Peter the nail on the head," computer is just anoth- Windows, so computer userswantI I Hortcnsius, director of while Raanan Mintx er file transfer. Of ing an alternative to Windowscan technology devdopcourse, you still need a start looking elsewhere. However, commented that just ment for IBM's Personal wanting products to work "doesn't sense of aesthetics and an under- while Linux has proven itself as a IBM'sLusar SystemsGroup, briefed us seem too much to ask for. After afi, s tan ding of how a movie is assem- stalwart server OS, it hasn't had to recently on the company's we are paying for these products bl ed from individual shots,but there face the mwdy environment of a EON (edge of the network) stratewith money that certainly does is software that will provide tutori- user base with diverse interests gy, which is a central concept drivwork" And rather than afi thebanter als , or templates so your first effort and —most i mportandy — huge models are variability in skill level. Windows Compaq with its iPaq. Hewlett- ing IBM's desktop computer design about user friendly, "it's time to isn't a complete bust. admit that computers are the most O ne readercommenting on last servesboth novicesand eipertsrea- Packard and its ePC line, and IBM this year. EON is about making user-defiant products currently m onth's colmnn said he didn't want sonably well. Some argue that with stifi-to-be-branded models computing simpler in the netavailable, wrote George Dunbar. to poiot fingers at Rehnond, Wask Apple's Mac OSdocs the best job of code-named Luxor and Stardust. worked world, and the strategy Legacy-reduced means some addressesboth business and home, Being a techno-optimist, I'm ever (M inosoft's headquarters), but.... afi in serving both common ports, like the par- or "e-lifestyle," users. hopefulthatthegolden agcofcorn- H e then proceeded to list the com- beginners and In sum, the industry appears tob» afiel or serial ports, have puting isjust around the corner. And p uters h» had running Linux, and experienced b een eliminated a n d making good progresstowards that there arc areas that have seen dra- h ow stable they afi were. While it' s users. Maybe replaced by universal serial elusive goal of PC as appliance, still too carly for the ultimate Linux wiU be metic lnlpiovcable to serve less bus (USB) ports. Legacy- where we'll be able to just hit the On lrlcnts ln verdict on Microsoft's justt echni c a l l y frce systems dispense with button, then proceed with whatever released Windows 2000 usabiTity. The afi old-style ports and have task we want. But I wonder if, 12 operating system (OS), ini- skilled users too, subject of this scrapped the internal expan- months hence, I' ll be compeUcd to tial indications are bu t like m onth's La b sion slots as wdL Legacy- writeanother Ijustwantittowork" that it is a lot Windows 2000's Report, v i deo frce PCs are sealel boxes ranL editing, is a case more stable promise, time that are generally a lot in point. TCPhas t han an y will tell. Interesting times ahead In PC hardsmaller than the beige 'tcstcd consulllcr Windows OS David Tanaka, Editor enclosure wc've come to to date . ware wc fc scc- I gtps Siaidest oriented videoT hat's no t eliting gear in the saying much, pmt, but it was VOISRHIW, THEV IH ?HSQgspgdagg, HPRS?ICPIS?! user-defiant in critics might RSAILV OCHIS Iy ISSQip fRNCPIy HKMDHORS!( 4~ "SHRH- 4W" argue, but thc fwgHf 50stg!HIH& two areas First» SR l5$RS5IMIIAR the typical home Bewhtt-Padtstdbepg 15 MV 5fRSSH.SAVRR that Window is computer platform was too 0000H PRS)SH!g puny, requiringcostly upgrades to the OS most poop)e have on their 'SSIRH. I H y!2MWi I bring it up to video-ehting snuff. computers, and a general improveSccond, the products were dfificult m«nt in Windows will have a good to set up and use. It wasn't easy for impact on a lot of people—at least the casual videographer to aeuafiy in businesswhere this successor to produce a movie &om last year's NT4isbeingaimed.(porthercstof vacation videoswithout a big invest- u s co nsumers, Win dows he words I filled this space with last month ("I

s ometimes

guugM

ComputerPAPER I

'' '

tuu elisesio Soll SNOm tseieeassaeuss unct wsooeso 'i

mtsaam slauam

steve cssore linea ~ .QI avaaose ~ o teamat8I tvaava ar k ~ ,o anew. mmsnmmaumuasvuva naca~ a ammu mmmmmlwm oesusha evaa uooraw ns Jsue ISSJaiamau xa tuuanlni ssuanms faints, assi eeusao 'I

sosnas

etesassceas sseats «rarv nrteiu iii ael sn rite awt tsulumau Ourawsnanst~

mul iluuu

Ill

eeu frsaasarmu.u HIIm Imususueiui Ious arrsassveotnao rmsesim%uuxlui soscsrsnrson umeotnacs am vsvw sfllf Wlllul uanuui ssmutu Sierra Iavs t tvstMlcllm aitumu «setewvx isrs Hvwu suman. Imoluiui, oewuna mBltaumlssmllEuurtun Jrsaaaweseaaaws

a •I

' I

Rtanam ttsxum uusu urassaa ease ~ o uoen cvvs n,vsvevv,testa to

T0TA Luisuat tlclsuos

plea liwi es.SISS

•

sama

•

uiiw imls its.us'

ilv uvvsumi. Sui SSS .Cail ae.i.u tean is lri tat ciluir ewaRanettsa Srs33Ri,rocusa rrs.sits savu saa.cleans 1eteesr 33mFe 14lse%-t1st

m imam

ist SiaSi,never. SaXai iis Plassatit rri&Irr. fe ala ril alla. iaonsaee010ui 31st

wuma

Inssve m, seaau.Taosr. SeIm su nrss ma ial-ital fir. Su siaesii tmtaull 1st asiair ni uvewl,Scarp iil nwv ala sal lira rw ail) SslSSI islsw1arrest@ tie Sirius Ssane SiStereStat etna ul OaSis ness ul07SHiul. Fe at 0 taHini Iuimx 1 mwae, ecru tn Ssuiu trice Ssrenl aovare u ra r n 'I

sataa ssvrovu ceuav iuaseeIe. Seaoa mrs Ssssve aa. Cia tin.llwsa,esias sa iiev ala 533arsl ilev a fa Iii0 uaersl

•

roses ii wsud sv curve tuwseas esov Iirer wsvIi caves,vro • sow esve evea CIIlm II lie ctslpuv suit sr sstesiir assie wIw rrva tresstvIise tree a sria •xltHS aleeiae.,treeea uai su. awlse eeeteee iael we usair eeasea Infuse aeeea Iaoa ree Iiel ewi si tscavan awrm teil, ~ D iii Ovoavnsveaniiel noei ttv vsrsoa iwsaeel cvevw tuaeo le welarei iaiceoacimalv irsc n arusevva aoeioese uvaa a svl vsostv svrwra Sfai resoea oui a eeastiiieiioseeaassnvwaeeneoeeaivewd seas loe mnsea auwselwairrtvroe srvsuaswuve a tewu.

as •

m ltwsvcsvreaav ewe Ilo Isa%slee tl vvo v 4$losrs ilv assoc rmw ai sru a eiw in d i iseil v esvs sort, e isl viva rw Ill dews bsvsrll • I wve v eve avvnm Vv weve eovoe h Iii cata INIcollrrll ee aa asairs Silie

weriteotwev sasasuua Oui Slilv Ovoertav acne aleua sum d Ixla iaosa caen nia im.siu

• I' 0

• •

••• •

0 •

•

1. Fa st and easy to install s of t~ a r e .

8. Cu s t o mizable local start page.

2. C o u r t eous live tech support.

9. Gr e a t l o ng distance rates.

3. 10 0 f r e e i n t e rnet

10. Get 15 hours f or j u s t $9.99 a month.

software programs.

G u ar a n t eed c o n n ec tio n n o m a t t e r

11. More plans to choose from than any other provider.

what system you have.

12. C o nstant u pgrading to t h e 5. R e liable e-mail service.

latest technology.

6. Yo ur o wn c ustomized portal s ite

13. ISDN service available for business

with local links.

a nd residential .

7. H igh quality modem hook-ups.

ld . 14 day money-back guarantee.

1 5 H O URS FOR WI T H

$9.99.

A D E A L L I K E T H ATa THERE S E V ERY R EA SO N T O T R Y U S •

• I

' l l

•

st l cs

Crabs card is roptired bttemet Direct strtues f<tr a tip.is'lb uu busy sttpud pttbcy. eruct Itutyrutty by plttulllce. Ilttetlte( Daecl s stattdtud settles tuld wtldllulftt tlppiy

Q InternetDiFect i b Loo k C o m m u o I e o t i o o a I n e. Com p a n y

One ( hip ('vn Turn

One Second <)f t '

T od v s =arne opponents are ious er to bear. So we' re issuin~~ you an u n n v a ied n capon. The neve Viper II rap h i c s c a rd i s e q u i p p ed w i i h ax A CR p olver a n d a tr a n s f o r m a ti o n a n d l i « h t i n e e n » i n e f o r i h e mosr reahsii c im a e s e ve r B e t t er y et . Vi per II now f e a tu res

S3TC t e x t ur e c o m p ression, w h i c h h u r l s u p t o 15 m i l l i o n iriangles at y our m o n i to r every second tor i h e m osr inr'ense

k'pER//

ll «««HI»«»H t«li«uerr«l» so nwp«n

[

30 action ever. stake your screen imaee com e ali ve U nless, o f c o u r se, y o u ' d p r e f e r t o m a k e i h e m o t h e r w i s e .

A LIS»I O

GRAPH I CS

CC«I I AI UHIC Ai lcQ N

Hul e' I . I ; i i l h ' « R '

g W WW. 53 . Cp m

high quality, wispy share image displays

EachAZURAmodel is designedto deliver the bestposstbh

valueforyour compugngdollar. AZURAhasasolubon toff justaboulany

typeofcompu5ng need, youcall choose

fromanypmoonfiguredsystemor

anybarebonesystem vdlhspuafl ccomp0. sells.

. rg>r .--r-r.y +- r r~ lalaP ainbcanls IliuP Paagsnm IU ymcwmx

basis Canner™fxscesw

igentiunpliI

•

8»

•

s •

•

AZURA C433I+

AZURA500A+

Intel Cefemn PIOCSSSN al 433MHz Mainbnald manufsclured by Intel 32MB SDRAM (PC-100) 6AGB UDMA ATA Hanl Drive 44x BDECDROM On-Board Video On-Board Audio

AZURA 500A+

Inlal Penh um III Processor at 500MHz Asus P38 ainboanl 64MB SDRAM (PC-I 00) 13GB UDMA ATA Hard Orive 44x BDE COUIOM

InleP Pentium III Pnesssor at 600MHz

Azure Modem 56K" Creauva Amplifled Speakers Mnuse / Pad induded

Creabve Sound fluasrer PCI 512 Audio ATI Raga Pnl/6MS AGP Azure Modem 56K" 17' Amaa SVGA Monitor Induded

MSRP $8L9.00

MSAPS5W.O)

4x Rmnlmma COROM Creative Sound Blaslm Uve valuel Creases Lsb 16MBAGP Azure Modem 56K» Creative AmpliTisd 4pL Bmakem

Creauva Amplifled Speakem hrxxoscn Windows 96SE w/CD

Mkxusoft Windows 98SE w/CD

Asus P3B Mainbomd 128hB SCRAM (PC-1 00) 13GB UDMA ATA Hmd Drive (raaaan)

Mkxuscne Vyfndows 98 SE w/CD Mimosofl Keyboaldimouse tr Azum SVGA Monbo Itugudsd

MSRP Sgei (K)

Contact your nearest A2Uf8 authorized dealer! 0 E Iu

Courtanay

Gibson

ComcxVagsyComputer Tik(250g$07B

Gnnufe Plsbn

Haze)ton

PmducfhmCnmpulam

Knmloops

Omnyx Syslsms

Tab(504)8563301

SkygneMien Syshm Tat(780)5390577

BLC Tech

TaL(250)8424)012

Tab(250)8514lgg

Kamloopa

btedicfne Hat

Dna SlapCompubu Tik(250)5544180

P. CIK)u)gam

Pengoton

tkA & M Computer Tab(403)flt8.1889

PL Albeml

DC ComputerHospital TaL(604)942-2830

R&B

Abe'sCompulmShop

PowegRlvw

Surrey

Queen hhartotta

RCCS Tik(604)4838970

SbatetpcMcbgs TeL(604)5024$18

EchoBayoffl cesmri m ptus Tik(250)5694599

• m I wssammm amsn Nwa mser. mean in sn senw n wan aaeseasee Innnnsn'I waawlnlfiler rase N • I eslWin ennnauIsesnl na rssaesmerne lees, Ilambansl SneeenN ribesna ssaanan waisnn ansm ~ sears N

cmcneaeaesasww seamsn wealei snare

mm wa aamnmsn numila salwwwINasm'.Iwl as sm~ bae na mmmm sauna sannnu • ucmne n saasnnsu ~ cmeeaaesmassesw ne nawnnlsenaemINmnsm csinnnns

TsL(Ã0)4924556

TaL(250)7238578

c NEW L NOT A B L E 0

A first look at Palm's colour handheld ' inallycolour! The new Palm Blc has an 8-bit. 256-color active-matrix display from Sharp, along with a new colour«nabled operating system. At l92 g (6.8 oz.),

We were able to play with the Blc to Bnd out what dilference a colour display makes to the Palm experience. On first viewing, it is a bit underwhdming. After some time spent using

(hnp//www.palm.co rn), the subsidiary recently created by3Com Canada.

Palm Canada rolled out the new model in mid-February,but The Computer Paper had the Palm Blc isthe lightest colour bandheld on the opportunity to look at thc device about a the market, according to Palm Canada month carlicr.

it,however,small things become apparentconflicts are indicated in red, and selected text

is highlighted in yellow, for example—that make you see how iiiucli better Jre icons look on this display. It' s not until you return to

a Palm with a monochrome screen that you r

fully realize the impact of colour. company Thc expects the Pahn Blc to

appeal to thosewho create imagm, play graphics-intensive games, or prefer to categorize information by colour, and to those who use applications in which screen

•

readability is a key factor —mapping, and r«adingcbooks or electronic documents.for example.

•

The Palm Blc comes with a suite of colour

software, induding WcbChannel Manager, for •

o(Bine viewing of Web content; Album-T«-Go,

•

an image-viewing and transfer program; powerOne,an enhanced calculator; and a colour~ n gam e. Thc Palm Hlc has 8 MB of RAM, plus 2MB of reconfigurable Flash Memory. A lithium ion battery provides up to two weeks worth of

power, and can be fully recharged in 90 minutia. It comes with a HotSync cradle and a DV25 adaptor to connect with your PC. A USB

adaptor can bepurchasml separately. The Palm

3« uwu Wa

Blc has an estimated street price of 5679.

Pakn Og gg Driving the new display is Palm OS 3.5. The OS upgrade will be backward compatible for

>0) 33 N

II I I

Palm Bl, V and VH models, with the exception

of the Palm Ble, which does not have Bash ROM. Upgrading to the latest OS will not, of course, make the monochrome display on

33 3 333

Today, this is all yoU heed« ftsfrgs, Faxes, Saws, cmttgCefxes.

older Palm devic«s colour, but it does offer same benefits. It includes an new agenda view

that combines tasks and appointments; a i«snide(upi!cation option that allows you to done a contactand change the name Bdd, rathm than having to input common information hvice far two people from the same company; an on-acr«ca menu bar that removes the aced to press the menu button;

Euro symbol support; and an improved priHere's a bmaktbrovghdesigned tomake your job easier. One simpleinvention, with !he power to print, scan, copy, and in some

models, fax x». gal(mrthan washng yourfirn«monaging a pile af equipment,yovcan vs«year new HP A8630ne hsbacon» more egacsvn. More cracxhm.More sue««saul. www.lip.cow/so/«Sin«ac

vate-record format that allows you to see the placcholder but not the contents of secure records. The company abo says HotSync and infrared data transfers are faster under Palm OS 3.5.

We' ve«mated a family of AINnQnas to fit justabmnevery budget. Induding the HP lasadat 3!50. Oar superior laserquality printing withail the reliability and ~ that youwould expect fromHP. So instead of dos«ring vpyour work area wsb favr separatemachines,gertlm one that does it all. HPAINnOn«s. Dapendobl«. Easy to use. Designed xi helpyougat ahead.

Palm Blxn On the sameday it launched thecolour model, Palm announced the release ofa new monochrome modd, the Palm IBxc. The Pabn Bine isan enhanced version of the Palm I Be,anth 8 MB of memory (comparml to 2 MB in older models), and is aimml at power users. According to Michael Moskowitz, the new generalmanager of Palm Canada,who

exw

presided over the hunch in Tomato, We

/ WE ~

I28!FIRXBNIP FgflEIIESII(ffs

gg 'l I

o'iiie

Im ply.

t av • a t

believe the new Palm Hlxe product offers an id«al combination of functionality, Bexibility and valuefor people regardless of whether they' re using it for business or personal use." The Palm IHxe has anestimated retail price of 8379. Continued on page 40

10 Asisth 2000 it% ooartnsn stursn BoBxnoN wwwamsrtsomsxsas««m

per month Join iPrimustoday andreceive: 'Free e-mailaccount >14 daymoneybackguarantee!* ' >24Hour, 7dayaweek Customer Service ~HighspeedT3and OC-3access >20 MBPersonal WebSpace Sign upafriend andget onemonth free!

C a l l 1 8 8 8 3 9 6 -J 7 2 9 w w w . ip r im u s .c a

c o r p . s a l e s @ip r i m u s c a

t (AHS Athlon-powersd PCs on the wsy On Mach 6, Sunnyvale, Can.-based chipmaker Advslem Mime osvioss (AMD) ~ that its 1 GHz Agrion pmcessor gifip/hn m.mwgigakerizcom)will be used in commemiagy available systems fern Cmnpaq snd Gateway. AMD's mial. Intel. has also been trying to beak this

Nohialaunches nsw mohjje phones HANovER, Germany-cell phone glanl NoMa gspyhwm.mna.corn)has taken the wraps off its new Sriffi/PCS mobile phones. seemingly with the expess intenfion of ecgpsing afi ils compefitom. Among ils several new peducls, Nokia imvegsd ils World Tiaveler GSM/PCS 900 MHz/1,900 MHz fikiperphone, which

it says is the corn panyb rww tlsgship pmmiwn mobile hand-

bsmer and is expected to rehasa its own 1 GHz Penfium gl pnxmssos befme the end of March. Bcgt AMD and Int el have been boasbng about ckek speeds for months. Back in December, intel took the

eEA •

lead with ils Penfium gl, running at 800 MHz. AMD says systems based on the new Atlrion ~ wi fi appeal to business and power PC users with highly demanding~ . In a ckfibon to the I GHz ~ . AMD also annouresd avafi-

ability of 950 MHz and 900 MHzAlbion models.

set. Scheduled to ship this summer, the NAMa 8890 is designed for those in Norih Amwican market wanring to nmn woridwkn to GSM 900 temtories. and vice versa. 11w handset, which has a blue-tinted 1luminated display,

— TCPStaff

tips the scakm at just 91 9 (3.1 oz.). Its featune indude voice dialing, which allows users to stare up to eight voice tags M the phone memory.Once thevoicetsg isrecmded, aphone

E-Vectm first in HP's e-pC line

call can be made simply by acfivakng the featwe with a single kersboke. or the button on the headset, AAdsa)IIAg ge pAvscoRM Azine to tha phoAe.

-4fewsbytss

IBMIS EON alms to simp((()f computintg EON (edge of the network) is IBM a coiporee backup' ?" he asked, the answer being they Personal Sys tems Gro up's shouldn't have to be. Hotensius also showed folz new yet-tete.named patforms grilpy/nvw.ibm.com)grand plan to make compufing easier. "What does it take to

simpuy end-user compubng in a net~ ~

work e d

world?'

that will be ~ by rn id-year as part of a new IBM brand: • NetStation network computer. Introduced in 1997, it now

runs Unux and includes boot memory so it can be booted

as ke d Pe t er

up Mcsfiy, not just over the network.

Hortermius, director of technology d evelopment f o r th e group. at a briefing with

• I<ruiser. A "business-to-business-t~nsumer product' IBM will sell to businesses, who vrig in turn sell them or use

In answwing his own quesbon, Hortensius ounned

them as incentives or pmmiunm for their customms. A brokerage house, for example. coukl pnlvide iribirisers to cfients as a kind of tmgelted Net appfisnce to access the

?CP. the scope of EON thinking, stewing four peducts that wifi be inkoduced by mid-2000. EON is about IBM ecognimg that the PC Is fast becoming a device that sits on the edge ol the

finn's Wsb site quickly and easily. 1?e de/ice will undergo trials in the U.S. in Aprik Parlidpants in gw pilot include

Lycos, AT&T and Fidelity. network. As the role of the PC changes, so do users' expectalimw. ortenskm said EONdevices wouk? be useful out of • (uxor (cmknnsme): A mors tadlfiond PC form, this Mgathe box. not just enabled, bul ready to go." por example, to addresse-commerce, PSG is swriofri iu secure cNP technology to be embedded on the motherbowd, which will addnms specific e-business needs for authentication, secure sigiWI9, etc. H mtensius abo talked about e. ifestyle ~ " in th e next wave of computers, to help manage the work-at-home and home-at-work content that may mist an a single dmrice like a notebook PC. Why do home things have to be part of

cyneduced device is a stylish unit with an LCD monitor that encases the gum of the computer itself. allowing for a vwy small footprint. It retains a paragel port and PCI slots that accept low-profile bowds. It will sell for around 92,800.

• Slmdust (code-name): Tui s legacy-fne computerhas USB porls but no standanl parallel or serial ports or expansion slots inside. 5 does snack to an optional expansion chassis that accepts knv- proSe PCI cans. -David Tens/m

Hewlett-Packard canada (htlp://www.hp.corn) has leeched the e-Vectra, the first business computer in ils ePC line. The e-Vsctra is a legacy-educed sealed unit occupying about a quater the volume of a standmd desktop PC —the mock-up HP slewed ?CPwas

about the size of a large desk d'cilonay: gxgex27 cm (3.5x9x1 0in.). Acconfingto product manager Mike Osskovic, HP wanted to sefisfy three custonnx gnwps with the e

Vectrm chiel financial oncers, IT peptmeim, and endusem. Oreskovicsaidthee-Vectra'sseder design and lack of fioppy chive or expansion slots means easier management (a 25 pwcent lower failure rate) and ewer cost (the e-Vectra starts at 8899). Among the featwes to improve the~ ity a nd security in a corporate environment, are a master key" for ag PCs on the network, and a portriocking systmn to prevent unmrihorized affachment or nmeval of devices. The e-Vecba ws be avmlable with Cekmm or

Penbum fil processors. and with either Windows 98 or Windows 2000 pre.instaged.

~ ® TATiUNG E 5 •

•

• • •

•

• •

•

12 /PAL ztrm Vta 00tes/Im IAPEFI 80 50AICXVwwwcensdnnnnVxtm.corn

•

Guaranteedoptime. Withwebsite hostingfromAT8TCanada, yourwebsite will alwaysrise andshine. ATSTT Canada now ouers a full range of sophisticated, reliable Internet web hosting services —plus the dependabigty of a 99.5% uptime guarantee'.

Complete Solutions. With one of our Business Services web bundles you can choose your access option, get a domain name and web site and set-up multiple e-mail accounts.

State Of TheArt Facilities.

tl 10 3

• Up to 100MB of web space • Up to 2GB of transfer • CGIAccess • E mail address with auto response and forwardmg

• Tragic logs • SSL secudty

• 24/7 network nlonltof ulg

• Fast, Sun Ultla servers • UPS with diesel back-up • Multiple DS.3 connections • Server colocation • UNIX based Microsoft FrontPage Hosting

Domai nNameSearchAndRegistration. Ihke advantage of on.line domain name search with instant activation. ATST T Canada is a Premier Partner with the InterNIC, guaranteeing you the fastest reglsttadon possible.

YourSatisfaction Is 6uaranteed. If you aren't completely satlsned after 30 days,cancel-without

( '

penalty. 'We also guarantee a minimum of 99.5% web site availabigty, or you' ll get 25SI of your monthly fee refundedl ATstT canada web hosting service. It's the perfect place to bring your web site.

• IOMB web site

From

• Imoitit

• 750MB data transfer

Saveopto $1,000'. Call beforeApril 30, 2000andwe'l waiv etheset-u fee. As one of the leading business.focussed global ploviders, we' re committed to bringing you reliable Ieadingwdge solutions for all your local, Iong4istance and Internet needs.

For more information talk to an ATtkT Canada Sales Representative or call us today at

1-888-278-5374 or visit www.attcanatLLca/business/mebhost.html

ATIT Canada,. Thenetwork the world works on. serves nnl vailable m aamana call for inbnnsdm webasehoabng ie also avasameIn bunmes Incwdmg somm e. planesconfed aourmmwnw or vbbwww.escanada.calbuslnseslwebhoalhbnl mrfwdmr nformswm por ~ on9 9.9a guslsnbm please vlnl wwwnanwuab.cnlbvvdnsssffpmlnrasss.hem 'scen smvmfees wrcesd sl,000.egal cwenl flrsl sl,000 crdpTenne 8ISIcorld5nw apply. Glemmles enhfscl lo chlergn ATSTCorp, usedunder lcence. Plemmnvms Ihe foaowlng ~ code Nf 99.

u OOT EO M

HOME a

Sir, it's your fridge calling Thelatestexpression ofconvergence isanything with a current running through it connected to everything else with a current running through it, using Internet protocols

Sy Tam%snags ry to imagine this:you're sitting at work when youget an etrtrtg fmttt 'rztnr fridge. lt has noticed that for tanight's dinner m enu youarc gaing to need some chccse and milk, but you arc low on chc«scsnd the milk you have is going bad. The &idge asksyou to stop at thc local grocerystare to pick up botk When you arrive home, you find an email telling you a service reprcsentativ» for thc washing machine will b» available to come in during the week. It seems the machine detect-

ed a problem and noti6ed the manufacturer. And a&sr dinner, you relax listening to several MP3 music files your stcrco downloadcd according to instructionsyou gave it earlier in the daywhen you werc at the offlce. While ag of this sounds like something out of TheJenans, it may in fact be only a fewyears away from becoming areality. Right now, both Sun Microsystemsand &6croso& are leading the charge towards the mnncctcd home, and there is a seemingly ever growing number of hardware and networking companies looking to provide the infrastructure needed to make it

ag possible.

set-top b oxes through aset-top box, which wasalso playing and ag other an intcractivc version of BBC America'sTep ef kinds of home the Pops music pmgram at the same time. One device that caught a lot of attention at products," says Curtis Sasaki, CBS was a Whirlpool fridge that had a built-in director af prod- Web browser. The browser waspart of Qubit uct marketing for Technology'sWebTablet solution that operated c onsumer a n d using BeInc.'s BelA platform (formerly known embedded prod- as Stinger). The browserwould allow accessto ucts at Sun videos and menus, and would even do online M icrosystems i n food shopping. Purchasedfood isscannedwith Cupertino, CaliF. a handheld barcodereaderbefore being placed "The challenge is to in the &idg».This allowsthe &idge to checkits

Sarah Woods,a research fellow for The Knowledge Lab at NCR Corp. in London, England, says the goal of networking appli-

make it easy for consumers list of contents against planned menus to see to connect their productsto the what is needed. It wig even contact the local

television, or to get a quick weather update as you are leaving work

network And that is where Iini comes yoccry stare todeliver thefood right when you into the picture." drive up toyour home. "We have a no-compronuseanitude to the Internet, and iF you are going to build an Internet apptiaxc, r~u'6 baler make sure it does the interact," saysDavid Armitsge. president and founder of Qubit Technology in Denver, Colo. Qubit's WcbTablet does not just have to be built into fridgcsor stoves. It csn abo be used asastand-alone product,allowingmembers of

HomeGateway serveracts like a party host, making sureallthe guestskeep talking and no problems occur between them

Sunexpectsevery applianceand devicethat is manufactured in the future will have lini icagy connect to a network on which theywill be recognized by cvcry other lini-enabled device connected to that network Think of it

-- rigigi

as a kind of "Hi I'm herc! Let's Talk!" signal. The communication between these dcrices and appganccswill be helped along by another bit of Sun technology, its Home Gateway server. This standards-basednetworking tech- a household to access the network and its

use. For most people, operating a stove is less intimidating than logy'ng onto a computer or surfing the Web. The information these deviceswill accessand present will be tailored for their useand easyto understand. Youwon't surf the Web from the browser in the microwave, but you may use it to get recipes while watching a favourite cooking show on

Microsoftnnd UPnP "There hasbeen no lack of jetson-like scenar-

ios,"saysGreg Sttjgvan, product managerfor, „ the Windows division at Micmso& Corp. in ' Redmond, Wash,"But time is thc most important commodity that people have and if technology caa givepcopk morc time, it will allow them to bemore Bcxible-and that is valuable," For sometime, Microsoft hasbeen pursuing a connected homevision. While it is similar in scopeand ambition to what Sun is proposing, there are fundamental differences. Microsoft's dot-corn home isbased on Universal Plug and Play (UPnP), a technology that builds on the Plug and Play specig«ations of Windows 95 and Windows 98.Those operating systems instantly recoyure when a printer or other peripheral is connected to a PC, and they automatically install the right drivers for the devices. Similarly, UPnP should automatically

recognize anydevice connected to a network Another differenc between Sun's .corn Home and UPnP is that Microsoft is basing its

system on standard Internet pmtocols, not on aology acts like a party host, making sure ag devices anywhere. The tablet is about the size proprietary code. "Our approach is that we should buiM on the guestslieep talking and no problemsoccur ofastandard magazine,approximately20 mm open Internet standards because those stan(0.75 in.) thick and weighs about a I kg (22 between them. The Home Gateway server will also act as a

lb.). It has an 800x600 pixd, 10-inch colaur

dards have done a good jobof connecting to all

bridge to an external network such as the LCD touch screen and can communicate wire-

kinds of devices on the global Internet,"

lcssly with a network at speeds equal to a TI

Sullivan adds. "What these devices would send

internet, and could be incorporated into DSL

At the recent Consumer Blectrorucs Show

and cable modems.

(CBS) in Las Vcgas, Sun Micmsystems lnc.

•

built into it. Iini will lct such devices automat-

Sun's dot-corn home

detailed its home convergence initiative, which

•

ances is to make mmputers and Internet technology morcconsumer-centric and atsier to

back between each other in UPnP is XML masline, according to thecompany. Menlo Park, Calif.-based Bc Inc is moving sagingand so there is no proprietary layer." Sun's Sasaki adds that the Home Gateway

server is also capable of handling devices that

are network-ready, but don't haveJava or lini

heavily into the Internet appliance arena with its BeIA. The company sees BeIA as the ideal

platform on which to build Web-based and 'For devices that want to have a lot more network-based appliances because af its small capabiTities and fan«tionality on a network, footprint and memory usage,making it anrachaving lava ar Jini makesa lot of sense,"Sasaki tive for a wide variety of devicesthat are not proposes ."Butotherdevicesmay nothavethe able to run a full-blown operating system. It memory or not need ag that kind of inforrna- would be a little ridiculous for a toaster to run tion (availableonanetwork j. Wehavethetech- a fug version of Windows 98 just to tell you nology that can Bt into the gateway box and your toast isburning! Rob Enderle, vice-president at Santa Clara, attach to these[non-java, non-Jinij devices." So what would a home look like if appli- Calif.-based technology research firm, Giga it caUsthe .corn Home, for mnnecting togeth- anc«sand deviceswere able to conununicate InformationGroup,saystheadvantageofsu«h er a bmad rangeof mnsumer technologies and with each other and the outside world? At thc connected devicesgoes wcg beyond the geeappliances,basedaround its Iini and Javatech- CBS,severalcompanies showcased such tech- whiz factor of &idges seeding their owners nologies. These technologies will be used to nologies:Boschdemonstrated an online dish- email. It is theseappliances' potential to send hrip various home apphancesspeak not only washcnSonyexhibited networked digital cam- email requests for service and support when to each other but to the outside world through eras, DVD drives and mini-disc players; and things go wrong, to download software Philips demonstrated a digital video systemupdates, or to havespeedy accessto technical the InterncL Javatechnology isbeing utilized in phones, that let peopleplay aninteractive golf pmgram manuals that is really interesting. in them.

14 /tPRL 2000 ll% COMPUTER%Pat BG EDITUN w ww. ~ e

s.ca m

This means that a fridge, microwave, stove or stereo would automatically mnggure itself to the network and acquire a TCP/IP address. It would use a discovery protocol based on HTTP to tell other devices it's available on the network. The devices would communicate

using XML A common criticism leveled at Microso&'s approach isthat it still requires a PC at the centre of it ag. Certainly, Microsoft still sees a place for a computer in the home, Its foUowup to Windows 98, Windows Millennium, (which is expectwlto debut sometime in the middle of theyear), will featme UPnP support. But a PC is not critical for UPnP to work in a home environment, according to Sullivan. The key of this initiative is that it does not

requir«a PC," SulJivan adds. "It is not tied to any operating system or platform. If your Continued enpage2I

CONNECTED,

Get faster access to your ideas with lhe LaCre FireWrre Hard Drive,' ll can send data along its FireWire" connector at AOOMbps while linked to up to 63 Fir eWrre enabled peripherals. And il's still holswappable. Plus, rl's available up to 36GB. All of your peripherals workrng togelher as one. Now who'd have thought ol thate

4htTLP Ic P

k~ '

I '

•

. .

i i

1 1'

•

i ,

P .tts / O n

' •

' .

•

, :

' ,

•

• ,

• •

(~)

•

. .

i l

• •

, t

ri :

•

'1' I

AAe d g ait/lang Pro

t n I r n I I I — n n e d i a M a i -. ~P& I I CII I ITI III

& rr I & I '

•

1 ex I

i i

•

x I •

I I

•

r•

I I

I I ,I

I,gl INK (("V(r '

r lI

P o w e r S t a t io n PC Partner V(A Apollo Pro 133 AGP Nei n Board 64MB 168 Pin H ig h Perl'ormance SDRAM (PC 100) 1 44MB F l oppy D r i v e 8 4GB Ul tr a DhlA 6 6 I D E H ard D n v e Ulira DMA66 Cont . w / 2 x l 6 5 5 0 Serial lx B i -Direct i o nal Parallel, 2xUSB Porc AGP 53 Savage 4 3D Accelerator Card w / 8 518 On Board AC-97 Sound Card 50x Speed UDMA CD R OM, Speakers 1 5 t ( o n - rn t Lo w R ad. SVGA Mo n i t o r P n P ATX Mid-Tower Case with CSA Power Supply 107-keys Windows 98 Keyboard,PS/2 Mouse 1 Year Parts (k Service Warran t y

w/128KB w/128KB w/128KB w/128KB

L2 .... L2 .... L2 .... L2 ....

$ $8 $ $

Su o e r i o r S t a t i o n 3 D Nowl

PC Partner i 8 10 M i cro ATX M ai n Board

A MD K6-2 3D Processor w/ 6 4K B L l c a c h e Acer ty(X59pro MVP4 ATX Nein Board w/ 5 1 2KB Cache 32MB 168 Pin High Performance SDRAIM (PC100NHt( 1.44MB Floppy Drive

, '8.4GB Ultr a D M A -66 ID E H ar d D r i v e i l x B i - D i r e c t i o n a l ParaUe(,2xUSB fa 2xSer ial P o r t ' On Board 6 4 Bi t 3 D G r a p h ics Accelerat o r On Board 3D Sound Pro Wavetable Card

8 4GB Lil i r a D M A 6 6 I D E H a r d D r i v e Ultra DMA-66 ID E C o n t r o Hcr

2 x l 6550 Serial, 1 Parallel 5. 2xUSB Port On Board Trident Blade 3D Graphics Engine On Board AC-97 2 0 Au dio Sound Card 50x Speed UDMA CD ROM, Speakers 1 5 h o n - l n t S VGA M o n i t o r . 2 8 m m d p P n P ATX Mi d-Tower Case v;ith CSA Power Supply 107-keys Win98 K e yboard. PS/2 b lo use

56KBps v 90 Modem 50x Speed UDMA CD-ROM, Speakers (

, 15 N o n - r n t L o w R a d . SVGA M o n i t o r P n P

ATX Mid T ower Case/w CSA Power Supply 107-keys Win98 Keyboard,PS/2 Mouse 1 Year Parts &; Service Warrant y

= ELF R O N

845 55 880 930

433MHz w/128KB L2 .... 466IVIHz w/128KB L2 .... 500IVIHz w/128KB L2 .... 533MHz w/128KB L2 ....

$ $ $ $

775 785 8 10 860

KS-2 30 450 KS-2 30 500 KS-2 30 533

$ $ $

730 740 790

M ode m & M ic e

M oth erb o a rd s

H D /F D C o n t r o l l e r s P rint e r s eyb o a r d s 8 C a s es M ultiM e d i a

Monitors

D rive s 8 T a p e B a c k u p

' a I

•

. (/rrr/rkrrrtr

I 1 •

Par(Br.rh

ATra /as

AMD K6-2 39

V ide o G r a p h i c s A d a p t e r s

' I

C elero n - A l l - in-O n e 32MB 168 Pin High Performance SDRAM 1 44MB Floppy Do v e

Z Ev a a a m

433MHz 466MHz 500MHz 533MHz

1SGB $188 EGG M , DRIVE

.I 4 I

•

Intel Peathsa IH Procesmm/1331HIS Bas Asus PBC-2OOO i820 AGP/PCI/ISA ATX Heht Board

3df

IAdlBl Weppp Dries 13GB Ultra DIIA-66 7200RPll IDE Hard Driec Ultra DlIA66 Coat. w/2a16550 Serial,lxal-nlcec tlonsl Psndlel AGP 3dls Voodoo 3000 Grephtcs Cord with 16M! Cxeetiee Labs Linet Vehte Cetd-Eaetroameatxt Aucuo sea Bpeed UDHA CD-ROll HLiWBO sub-woofer Speaker opthptom 4271 17' ~ m m Dp BI svGA Elonitor ATX Md-Tower Case with CSA Pcmuer Supply 107-hersWlndaas 98 HeptmasLPS/2 Hoses 2 Year Ports ib Sereiee Wameatp

SM I SLB258KE LZ ...

12&MB SDRAM PCLSOcmpricet $1 62.00

256MBSDRAMPc-iggcssplbmt $368.00 64MB &DRAM PC-Ilzcemplsm $9 5. 0 0 12&MB SDRAMPC-III csmpnud $184.00 12&MBECCSDRAMPC IN $20 5 . 00 256MBECCSDRAMPC ile $4 1 0 . 00

uansl Psrsnsl AGP aphue TllT2 Ultra Card 32Ml TV Oat Auresl Vortex 2 Euperttusd A3D 2.0 Souad Carl 508 Speed UDHA CD-ROH AliceLsosiol 45.2 Sub-woofer Speaker Ssmsuaa TSOS 17 ~ a u a DP lil SVGA Hoattor ATX btid-Tower Case with CSA Power Supply I~ 107-hops Windows 95 Heptkksrd3%/2 Ilouse 2 Year Parts rs Sereiee Wsrrentp

EKE

557llSLB 255KS L2 ... 42 01 733hSLB 255KS L2 ... 42,1S

16MB 6&as72-Fm EDO SIMM $ 4 7 . 0 0 32MB 6&at?2-Ba KDO SIMM $ 8 8 . 0 0 32MB &DRAM PC INcsmplisa S 4 8. 0 0 64MB SDRAM PC-INcempasat $8 1 . 0 0

Intel Peatium IH Processor/133MIS Bas Asas P3V4X VIA Apono Pco 133A ATX Based 1281IB 168 Piu SDRAII iPC1338lns) P/v~~ IA M B PtopppDrlee i3GB Ultrs DNA.66 7200RPM IDE Hard Dries Ultra DML66 Coat. w/2S16550 Sorialrlxni-Duce

BASE CDR - $150 Soay/Verbsdm CDR - $225 tswslu 80mio CDR - $1.60

• VALUE

W - 8 3 OPS? Kit

SNI P S L 2... j 1 , 7 5 557IISCr %86KS l2...41,8 7KNISh'

100MB

. 90 Internal Fax

Zip Disk oice Modem

2 .50 •

$ 25 .00 •

NetWare v&.2

Hmdm PnennlSwmmvu BGB InUBd OAT Onvn .. $980/1150 3COM30500e TPC ISA Elhcmd Ounce $1 0 2 3COM ~ ISA/ PCI EmenctlPO. . $0 0 /77 5 \ 0 5 3COM 3019250 lmacnT US™berk Hnrhcn ..... 5 0 0 $1 45 Q/3Q2Q fhntm Palanl Surusuru 24GB Iwae DAT Wive . $1295fR75 3CCSI 3CQQBPCI Ecemel Xl Cumbu eM~ Pru tl w ttxhimy 5 8 0 N cc/QHFJ27MQtha . .. ....$5250/$0 • 0 HewlstlpuckanlSautum4008hordccsrtOAT5172$1960AOpmpaEEwmel cumbu...........—.— — — — — $1 8 kml ~ mzs/2030 Gene DEzzspcy QA Euwnm cuneu . . 5 2 0 "mc Hutmze pa Ede/Bema pm tfh lssntuT . $ 1 t 0 fhhhhm vtz kun/unvm pn» —.i.. .Sess Huwtm knmsvusmn CLT coh scmDrnn ourn .... $7220//570 okce osczscy pa Eonmctccnou Huvccltpm pecked Srcasae OLT smcsCQ EA101C lcsmuT USBNtherk Harhce ..... . $ 6 5 $3 2 „

. .

• hawcmvz 2 5flQtha

InmaNe.eeadw VS 1

HaNHPadard~

72020GB M/Exl orie..5550/680 Hsl cptnmtcslsAEHrExpraa Pm tin combo ..... t 9 6

W tCh Ntseang 1 Sever Run 5User le .—..............., $1615 Onchmm 30GS QE/SCSIInl Onvn EchoSWhcl .5 • 15/695 Irad PClA02158 ISA ~ Rni srnnmCunent », Ncddn/e 5 I 5/I 0 AegtvuUc Only ....... $1 2 0 0/ I 7 2 0 Omdrnnm50GS SCQ H OnVu EChOSW Ind... ..- $ 9 7 5 Mal PSA9500 PCI E ~ Pro I n t Cadm ........... $1 7 2 3CGM 3CI 6733 ~ Snikh 4 10/1 008aun T .... 5 3 6 5 Nuynnrn512SSIAddrivn Lw Orty ....... $3795/6560 OunntumDLT45540GB IWBd SCSI Ome .. .$2235/2535SMC 120087Pa EICad Cundm . ..I$ 3 4 3COM 3015951S cnctkHS ISSwikh HQD 12 Pa l....$ 9 5 0 .

DLT0000HGs Idad scsio ... .........Sgzstxn50 sMC 84168T IsAEcerEz cnmbn. .....-..........--....-.... $6 0 tcouzcfmmmmaum 8 femme HH24PH .... $1360 Netware Bma& Business Suite vS IHH Snngula SmrPinnBGSDAT fnUEXI DriVa.......... .. ....t 7 00/965 $MC 843287 Pa Fduvsnum Cunanr 5 9 3COM 3CM901 Snnnsnd 0 100 Snihe 3300 12 Pal .. $1 6 85 ,„ NetwareSmagBucinucnv5Snrvur w/5 ucur ......—.. $1550 Sangnluscapinn 24GSDATInhad Orhe,............. $1055/1230 3COM zc16900Su/nusua 0 100 Swikh 3300 24 Pat ..$2600 -' t mcam„r i n t S e ry e r S / U S B H u b zco azc N HH e w~ lk ..s 0 s H H sso s , 39024mmduH IIIQQsndd/390024Pal„$562D ,

R QSQFT 4 T

snnam TnPushm20GBHIDE/scsl Taiiii Q'vm.. 3• 30/400 Hp JNDI/ud Jzzsm tfsx Icsnmr Ba 9/la saver. .... 5 20 5 cfsco cuhdfmzmz XL+ latm swmh Sary upc/SUUH ISGS Im/ExtOnvn — — —... $2 20/265 Hp Jnernd J410IN 4NN 1$1$aateT Pnnl Saner —.'5 5 8 5 mm Cddfm~o+ 4 1$ S ~ Snny SOT 7000 M/Exl 48GB OAT . . $075/1030 Hp Juevud J3253Amx lsnumacaT BaPnnlSavw $3 6 5 HP Jclmh Pnauve Iurm 16 Purl 1$100 Smkh . $ 1 550 Sae SOTQXN M/Ex Z«MOAT ............... . Sucatrgs Hp hdhmt J3265ASeh tatfxe 7 aa RH Sava 34 05 HP Jctrth Prucww «efm 40 Rm tafm Snhm —. $3 • 70 SunySOTHQQQM 4ea OOSC OATBCQ . 5 I 4 0 0 HPJue'vud J3HCASNN tlh5 108aeIT $365 Inhl SuninncnSSNHIXSSPalSnhm ............ . . $ 3 • 0

Hp Jcekma J3H3A 800N IOfIMlnmT ...

ower Protection WmdnwuNT Sever vis CDna Ctenlc Uc. . .

msm w i o ~

Winduwc2000Savnrw/taerdcle.

hH ~

Slag

~ .- .. $1510APC SmkuPS300

5 460 hhlErpneacl071$100SenhkmnSnsch16Pnri . 5 8 0 0 $ 150 MalExpneu410TNQSISkmhkmeSeSch24Pol $ 11 7 0 pm Bd prcanr snrvur paA21 515. 3 0 0 Mnl Bontuc 46DTI $1 00 ~ 0/dk h I 6 pot ..-. $1 3 50 isnoo a a R H s I RM . ....$305 hma o cm y fWIQQSHHI Q WQ24Rd.....ttsss -- $1010 is tm ~ ~ ~ 3~ , 544 0 ~ F QQ IWI OUs ~ tz ~

hm~ ~ ~ trad nsutinmwpara Qnhnnspsnmx2US ....

„$2 3 0 Inlet Benet ESI QQ QSRPUS Gipaht swikh 7 pal ......... $12350 NntgnnrPSIOI • Pat HencnT Prinl Sunmr..... ......... 5 I 40 Nnaner FS102NA2 UrlgssntnT Pal Sekh ............ 5 I 5 5

SIQQ

„

Nvlsnurpsn01$f0087 pmlsaver ..

— 5,» American Power 120 Volt

51 s2 Ihdsuaptt055 IWIQQsaeTPatamddslinsne)..-... 3 I 4 5

Xirun m ParlomotsRubePap/ Rrl................

3r d/122 Nal9anr FSISCNA 8 flh1000atnTPOrtSmkh ....... 6

SnuChsucSmugBucinnccSnrvnr v45 w5 Corno 52ue BackUpS zcmm.-... -. $120I \ 32 Bnckoaunsaner v46 ws cleat ... . $4235 BnckUps 500M/ssm . 5 I 0 0/203 Isnunnestm wnhmzswtsau/mtm .site suckUPSRn~ —— — ... s t gs / 2 3 2 / 3 2 3)Q\gyg ~ fa/ gQ~ 5Q( ~ ~ focumuculporl IWIOOEevmm+58Kumuuden . $$• 5 • IgnmmeSklt vachm20eusaadc Le. . . $242D ~ Pm ~ .-- .. . . . $3 33rd DQ Nnxm Rndprt lmnou Fad Esmmt cwehc . 52 0 9 Minuae shk saver w Qw5 ckemc le.--..— 1 8 20 SackUPS Ru IQQQ H400 ....- — $540/700 lrrunm Radpal RM56vf SIK l e Modem 5 I 00 smamps QN2$sUsm .............. . .. t 34 5/ 4 2 5 .

. .

n n e rs

\ggj j j j l j u i .

3COAf3Cct058 TX PCI' Fast te/t est Ettfemet7Acafp te

« ~ m~

. $405/6 90/0 2 0 ~

24 5

$69.00

Q~ I tfc nnr PCMCIA 1$100 ErwfMI + 55K Mcdnr/I ..........-... $3 6 5 ' 3COM3C905SCOMBOFedElhwknk1$100Cuneu $1 9 8 5 12 2 / 13 5

. Mdto 8 EP57$lg s u bmn Hckupscamsp2061$400C ~ z cf~ i~ ~ i . .— — $ ' Q005me....-....-..—...............ssgd ~ kka M dPi Image Quality . .

0 B ae e T

UnnCnndiliunar LR600/lRIZ50 ....,................ .....$128(173

O'Ill'Q 00 pcnamsurgua/nmynouschiiiisT4...—....$26 I 33 0P ~ . s rccg ~ sln Dnx/rasynchdhhmhyd. meap.,titp ...... 0 .....tcs i t z~

„

~ ~ ,~ ~

~m se a rxpedEH s c —- - . ...s I 63 zcoutc90584xocumstmrtaks c .. ..'...siocs

--— -- 5 ,2 5 SCUM tcf6722 ~

„

ndssnr/MQpcrt Hub $2 2 0

H~ m a ~ ""' " 5 tcoutcf6721 ncuccnnM I a lhumu»2purmubt 390 s~ ~ cbf z ~ - — $71'0 tcouzcfsy m ~ tsfo sspurtnub. . . szs s

~' — "" 3 COM3C16751 ~ t$ 100 1 6PnnHub .. $ 4 9 5 Hpcstcnfxncrjckt200dm™ f yppmfnmnch/crk Szfle ~ Insu /unmcncuscummyd .......5 • 4 / 5 6 ~~ I~ ~ ~ ~ a ~ — --- 3 D Unk DFE 530TX 1$100 PCI FaaEeemnl Adupla Id cmQTNUmwiul'1290do lymm 16HI Nulnark$23$5 Nnlwurk rsnAnucl 7/T OucnlcwshTnl..... ... 5 • 5 / 6 0 3COM 3ct6670ASupaShn*U hb Is 12 Pat ..... ... $7 35 Ol/nk DFE 570TX 1$100• Purl PCI Sever Aduphr ... $$328 55 H gmokmu/hAIZQQ dd,tcppm,tfxtr ..... Sm t 3 CCNI 3CISGIA~ UHub lspl Pal $12S 5 Ocke OFE SH 1$1(e OwdSpuudc Purt fh a 5I I g Hp 50$Q tncusat200dpi 16ppm11xlP Nahvak. $3160 SCCH SCIHIQ ~ 0 D/ e f Sp urn the tz Rm - $94 5 Dcink DFEC16Fanaunme»6 Purl QnckuunHub.... 5 3 9 0 Ie 5MQGN latneal1209dyi.Grnphwcndnnnvn... 5QSS ~ S c™ ~ 0 m H ~ Q H " Sf 300 Gene oshg owf spuH 1$100 5 pnn Hub w/swah t \ I 0 HPSKNlmuhuL1200dp32ppm. ..$40m ~

3COM 3C16/00A ~

Hp 0100N lacnrjuL1200da .32ppm.dnleak ... Q4 N Hp 01000N lntainll20tkfp 32ppmGuphntr .. $5175 Ie'4500 cnnr lncnqclccndpliRnt24ucl.3xkor . 53705 mr 4500N Cdnr Ueminl,600dpr,6lhn /harsh ....... $44N

WTPO.

. 511 5 ChkmkDSH40udSpnad 1$1008Pn/l nubw/Smkh 5 I 9 0

5 I 4 7 CLUnkDSH.I6 Dual Spa

m I$100 IS Pun Huh/SnnH $3 5 0 31XH 3C16702A cuccnnud 1$TPC ... $2 5 0 HP J3294A PrnCunm 19/1000ncuT 12 Purl Hub....— — $6 I 0 zccNI zcls/0th ~ I / l po . ....—.—.-.—.... 5 6 9 Inlel PSAQIKI pm IQIH Pcl Fncl QhaneiAdnpnr. . .. 5 6 0 7 3COM 3016710 ~ 5/I PM ....-....... .....--- $ 4 8 5 Inhl pIUW470 E rExpreccpratODI Scnnr Ad m 6500 uar UHaeccsdd I'zxttrzzkm ... . Sm/0 Twlatett Pair tpl nr.... 3 8 S HP8500N CulnrLacminL600dpi 32MB Nehmrk $10135 Assembly Cal 5 10/Iceaeuy Cable 1$1$25 9 .......... $8/10/12 Glink DE Ji 04inkDE~mTTpe p /cgpnrifho 5 Pun Huh ........... . ..............„$ 5 55 3 bacmt/LASIHRafa obooumsavaadcptw...........,s s30 Umnnrk Opbe M410n12ppm4HI USB ................ $1255 Cabin Cnl 5 1$1008ntnT Cnbhr pnrh ............................... $0 25 ~ og ct1zip purl lee luwnak Opbe T61015ppm4MBPnrntd ii..-ii $14 70 Cable Cut 5 1$1008acnT Caklu pa IOQ 8 ..-.....-........... 5100 ~ O E4 6TP12 16apon Hub . —— — — - — .—.... — - - 3 \ 8 2 haul nsuchrae SHIQITXSFadEsemal8 1$100 tha 5 2 8 5 leunark Opbn7610n lcppmBINI lsflscsnteTx. $1030 ccnnndnr Rag u Si 30 ""' I/ant Befnvu 330T Quxkubh Hub 1$100 16Purl.-..—.— $7 6 0 Lmemk OPun761220mnr,msI.PnfaM 6 teel -. $7/10 Tuel Rds afnevu 325 — — — Laaunk CPI/a Tgfrnzccenk Icmf 1$1008nnnTK $2205 ueckdrnm CubhTmw Imnl Be/ntu 330T ShCkabh/Hub 1$100 24Anrt ..... . 3 11 3 5 3 0 0 hhlM M Snl m u e s pnnlhb 5 8 8 laNg L mv/mrkoplraygfczgppmmmpauM . guts v Fhttmxtmpa~ $ 3 0 hae InBucmwcSKI QTQ D SPal thb twa aex) ..——.. $1 I • Ndgmnr Grt Ooaloa' szfeth Giado mm/M Cent Laemkch/H Tstcnzdpfr'Kick'mtafffsjccuyx 532/5 — — $• 8 0 - — - - . 5 S I S tmsnar FEIQoiA/FESQIA 1004 Pam Pnrl Hub. Uemnk Opha161635ppm lmmpamd .. $x a 5 Awembly. RGgsfAU Thn casa2$509 $15/22 QK 9156 ~ — —$4 2 /S 3 NdgnnrsDlooik lsl00 fxH spead 4purl Hu b lawntrk opbaT616n35ppmindl lalsnnceTx . $N55 Atnmely RG5$AU uan ccec lm 8 . $ 104 5 3 5 IP " lmnnnrkOpusW91035ppm IQHI llxlTPamd . Sons C4uu RG5$AU BuuPnr8 —.-..-..........- — . 50 25 ~ m t Hunter D5106NA '1$1000uul Speed 6 Pat Hub ...—.— $1 • I "—" — -5 2 3 N dQnnr OSIQSIA 1$100 Qml Spuud 8 P UmrwmOpiruWmsn 35ppm Imm Ilxll;Nchwnk$4450 Cmh RG5$AU Bua Pcr1000 II .... $180 ~ ~ a t Hub. $ 100 -------- — - - - - - - -. 5 NnlscnrOS51$NAOual Speed 16Pat Qnckabh Hub .... 3 4 2 5 Leawk Opbn SC1275 3ppm16MBQcsdp l $2R N Cnnmcm BNC n ............................... . 52 5 0 ~ """ "" 5 LemeeOINHSctzysk.zppm,zzMB.600dpl- ..53035 Iamketw BNC 52dm---...-...-..-.-...................—. —.tz.gs ~ ~ IecgnerO5524NADuntSpatd24Purlsncknkhnuh....s 820 ~ s~ ~ " "-"'".""'"" "'-"-" -"----- 5 SMC 12HTX ExCad 1$1090ata T PCI ...„,.„...„„,„„ $ 3 4 LenrmkOpbeCdnr 120012pan 1200dpiHx17 . 50ms Tatsdc Cmeka ---- -.........—.— -....-....-.—.......--. $3 0 ~ micr I H i""-"- — --"" Sist SMC5200TXE2nub1008PurlHub..........................„.„.$23 3 lnmwrk Cnk r 1200NI 120 0d ' Ixt P 5 1 0 1'frrw/nhr BNC 52ahmwfsmurrdcbup... $300 -

•

™

SQSt&IYIS t nTel: l$0 4 ) 73lH51$$ Fax: {N 4) 7 3 0 -7983 T ech: $ 0 4 7 8 8 4 7 $ 8

' Two Year Parts And Satvice Wananty ISyatema Only) ' All SystemsAra Tested And Bumaddn For 40 Hours Before Shippinq

' • http: //»nhne.mconcept.corn ' Government And Corporate purchase Orders Welcome I

•

I 55. •

•

5•

Ig •

' Fax Ordain And Bida Are Accepted * Ail Prices Rellect 2% Cash Dincount Leasing Availabta ' Prices Subject Yo Change Without Prior Notice

TURN THE PAGE

beth% oagsam~

NFslt Ill I

oagngurr

.T gg g 6Ndplmdpn esHBRAM ~ SP HL-1 2BODX aorta

• 1289r669dpl g ~ -$270tg aortae

10/196BT~

installation

irlA Apollo Pro Ccleron AT Board wit/i Vfibra 16 On Board Sound (100MHZ Buy) I agel Celeron 43 3 M H z w / 1 2 8K S L 2 . $ 2 3 5 I ntel C eleron 46 6 M H z w / 1 2 8K B L 2 . $ 2 4 5 label Celeron 50 0 M H z w / 1 2 8 K B L 2 . $ 2 70

P PM Res Pfi c e Model N/W C P S Pin P r ice 300 9 $35 0 OkiPa 9e6w 6 60 0 dp i $ 309 M L184 Okipage Sw 8 6 0 0x600 $389 ML320/321 435 9 $5 00/705 O kipage 10e 10 600dpi $ 4 6 0 ML520/521 435 9 $6 05/805 Okipage 12i 12 600x600 $925 ML390/391 390 2 4 $ 525/705 Okipage 18 1 8 600dpi $ 1375 ML395/Co)of 607 24 $ 1585/1695 Okipage 24dx 24 600dpi $ 1930 ML590/591 360 2 4 $ 705/955 Model

QR8

Access Cache RPM Intnrtacn Price 512KB 7200 U LTRA WIDE $ 2 9 5 ST 39175LW 6.9ms IMB 7 2 00 ULTRA 2 SCSI $400 IMB 1 0 000ULTRA 2 SCSI $520 ST39103LW 5.6ms IMB 7 2 00 ULTRA 2 SCSI $560 ST318275LW 6.9ms ST318203LW 6ms IMB 1 0 016ULTRA 2 SCS) $825 ST318233LWV 52ms 4MB 1 0000ULTRA 160 $ 845 ST136475LW gms IMB 7 2 00 ULTRA 2 SCSI fi1215 IMB 1 0 000ULTRA 2 SCSI $1345 ST136403LW 5.7ms I MB 7 2 00 ULTRA 2 SCSI $1365 ST150176LW 7.4ms 3 091 70U2 7( n s 2MB 7 2 00 ULTRA 2 SCSI $370 39100LZX4.W 5.4ms 2MB 1 0000ULTRA 2 SCSI $550 3 18350U2 Tm s 2MB 7 2 00 ULTRA 2 SCSI $575 1 8LZXU2 5.4 ms 2MB 1 0000ULTRA 2 SCSI $845 X P36U2 7.5 m s 4MB 7 2 00 ULTRA 2 SCSI $1300 336000ZX-LW 5.4ms 2MB 1 0000ULTRA 2 SCSI $1380 WD91 804048 Sms 2MB 7 2 00 ULTRA 2 SCSI $330 WD9150-0040 5.2ms 2MB 1 0000ULTRA 2 SCSI $500 WD91 504051 5.2ms 8MB 1 0000ULTRA 2 SCSI $ 5 10 WD18300448 Sms 2MB 7 2 00 ULTRA 2 SCSI $ 5 10 WDI8310440 5.2ms 2MB 1 0000ULTRA 2 SCSI $765 SMB 10000 ULTRA 2 SCS I $780 WD1831 0-050 52ms QM309100KN 6.9ms 2MB 7 2 00 ULTRA 2 SCSI $355 QM309100TN 5ms 2MB 1 0000ULTRA 2 SCSI $520 QM318200KN 6.9ms 2MB 7 2 00 ULTRA 2 SCSI $580 2MB 1 0000ULTRA 2 SCSI $850 QM318200TN Sms QM336400KN 6.9ms 2MB 7 2 00 ULTRA 2 SCSI $1215 QM336400TN 5.5ms 2MB 1 0000ULTRA 2 SCSI $1515 MAE3091LP 10ms 256KB 7200 ULTRA 2 SCSI fi 360 MAG3091LP 7.5ms 2MB 1 0000ULTRA 2 SCSI $525 MAE3182LP lorna 256KB 7200 ULTRA 2 SCSI $555 2MB 1 0 000ULTRA 2 SCSI $840 MAG3182LP 7.5ms MAP 3364LP 5.7ms 4MB 1 0025ULTRA 2 SCSI $1 365

sdfQ

sef MB httaRsww nphhgerp • ac» Op(hnl hubno(ogy • No bagtoebmn • Sail wbad & 5

z~ A

barons

li ir r

fcernr iy

Biaatar 8432CDRW Drive

S B Live Vaiuei % data Biantar WatsCarm Gu

• Read & CopyData Direcdy ToDhcs • 256-Viicew)Digihl Oat e worln As A poriane camem • Sprmhi Ih(write) 4x(wwrlte) 32x(nad) • EMUlozt musk eagiae e nmaoo Imagesin64(h4N Res,

PACKARD 2 00 i

A LT E C ~

C D - W r it e r

ROM dcAadh Phyas • ri ( r Dsuiag CD.RW IXacs • Spuds:4x(write) 43 (fawNe) 24x (read)

S yneM eater

• lg" (Ig" Viewable) • Oagmm AG Pitch • l668xl209ogy

0$23.00 IncludesDrive, Disk, PC Card In(mfacc

h' 5 I20

External Drive

mgg~

&SOIIT LCD Olspdup • Foll Ia" Viewablescrasu

o mfitgl Ge t 4OMB Storage for only$2OA)n

cameo~ Zru Authorized Reseller

YSTAIB 5Wenihh MubimaHeSpeukei (2pcc) .................... $39.00

Ys To(i 5 is we(webMuiimwawspeckui (2 pcu) ............,.... $74 00 YsT Ms30Muiiimegias herssuimoafer (3pcc)..............$04.00

ilk! 40MB Mobile Svstem Bundle

Gel

au S 129 1GB storage

Saz2GB SCSI

Acorn powacube piui speelwi(3 pcc) ........................... 5169 00

'nw»hi Xum iocwuna

' SVHDMnafnrOOONF

Get

25 MB USB Drive ggnashmge

2GB Stornn

Jock ...... 40.00

ACS33Powacube SPeakei (3 pce) ......... ............................ $60, an Acs45.2 powercube 3pci speaim wnaoog su(nnnw ....... $80.00

ADA70 oigiui pcwacumspaaii (3 pcc wiih Use) ....,.... sins 00 ADA305DfgHelPoweiCubeSpeaker wluuachannel Suuuw u $(90 00 ADASSO R Dooy Daihl speaker w/au(chere Rear sumwndi$345.0r

7 60 a

• l7" (lou Viewable)

• I taxt024(odelh g g

VSf I 2.50

ACMOWPowacube Speaker (2 pcc) ~

ACSO) Pcwwpfw Piui 5 pcc. Sperkui Syriem ....................... $(02.00 ACS56 Oigiioi Hoh Power 5 pcc. Oum'mgSpeaker Syiiem ..... $(73.00 ACS6$ rice 3 pcc. Speaker Sychm .....,..................,......... $((50e

• 627mm Dot Phch

ISOMB aorage

l o i crnct hiuiic la Tbc Palm Of knur irma

~'~ g ~

ZIP 250MB Internal IDE/ r. Sl or Parallel

Gei ZI P USB 100MB

S N g Sf'

M ' ~ „ .„

ST34520W I orna

•

• 256Bit DualBusGmpbhs Chip • 36 aha)phd- USB laterfsce • Daslneul Display & TV Os(put • Opgnal Ihaohtbm686xl20Mpi • ubgiiccdReran(bm192OMPI • 366MHx hraabsrp DAC

NOIOIOI

Model

B Parallel Ext.

MMesulhnn tn4OO Mnn Cologndn US& 1&SOO

Zip Gmaidge not Included ataraMRIH ZhpHritm • aVIDIA GeF ace 2n GPU watga Ikaashna, thpffnnsciap, Ihsdaiag I)4Mhfsecdata transhr rate, Anhem euadgagimnwiga 28 ance faster than Boppy.

AMD K 6 - 2 3 D 500 MHz . . . ................. $210 • 22GB Cspsdly • USB lnterhce AM D K 6 -2 3D 533 MH z ............... . .. $260 • Aamn Timel loaf 5IMRPM

18. 2GB

AM D K 6 - 2 3 D 4 5 0 M H z . . . .. . .......... $200 Canhsaand uau Onn

36.4GB

anatl Prince

P%l< wx

• ates Celeron 533MHz w/128Kgg L2 . $320 VIA VP3 Super Socket 7 A T A GP Board f(fith 512AB L2 Cache (('f Vibra 16 On Board Sound

SIIysh

DOT-POATRIX

3 1RRQ> '

Capacity 4.55GB 9.1GB 9.1GB 18.2GB 18.2GB 18.2GB 36.4GB 36.4GB 50.1GB 9.1GB 9.1GB 18.2GB 18,2GB 36GB 36GB 9.1GB 9.1GB 9.1GB 18GB 18.3GB 18.3GB 9.1GB 9.1GB 18.2GB 18.2GB 36.4GB 36.4GB 9.1GB 9.1GB 18.2GB

"D 'S

""'"B/54

PC WackeDamop Speikoi ....................................................... $60. 00

pc Wain pour pnhi Sumunr Speawi.................................. Simgn pc wale rar pma sumanr rpmmn Diaiii speikei ............ $(96.00 ~a uau ua Spaair SSubncum............................ $( 3200

~ OamSpeekei 8 armoora Oack) ......,............... Sim 00 , ssm go hruoearh punam Ampuwf$peihii ii scbnuch,

• Mnltimedh Ready

Oei)CCP Thee(or 5. i Dony. 5 SPiekei Syshm O)12500 ............. $390 0P

SG N V ' M i C rOCOneept

bl nhbpth (riggtrc)7.

102 - 124B Want Broadway Vancouver, B.C. VBH 107

F-490

F -48 0

$6199. "

Intel Pentium III 650MHM 128MB Slemory 18.1GB Hard Drive 4 X DVD RO M 56KBps Fax Modem 15" XGA TFT Display iLink S400 Interface Video Out - NTSC

F -45 0

Intel Pentium III 600MHz 64MB Mem o ry 12GS Hard Drive 4 X DVD RO IN 5 6KBps Fax Mod e m 15" XGA TFT Display iLink S400 Interface Video Out - NTSC

$4 4 9 9 . " "

F -43 0

Intel Pentium ni 500MHM 64MB Memory OGS Hard Dn ve 4 X DVD R O M 56KBps Fax Modem 14.1" XGA TFT Display iLink S400 Interface Video Out - NTSC

Z 505H E

$ 39 9 9 .90

Intel Pentium gl 4 50MH z 64MB Me mory 8.1GB Hard Drive 5 6KBps Fax Mo de m 12.1" XGA TFT D isplay 2 USB,10/100BT Lathemet Port Replicator a Fl o p p y

SQN+ +

$ 5 2 9 9 ." 9

•

How Cool are They? 0.18 nhorcn Iechnctogy

F -42 0

$ 3 6 7 9 .90

2 USB,10/100aassT Ethernet Port Replicator & Floppy

AdaphcAPA1350NMMCMPaalelPutnk .. . $07.00

AdaPlecAPA.1400D ShnSCM Nl .............. . 5 t 7 5. 0 0 Aaplsc APA tank SknSCM Nl ICanausI ...... $2 • 3 . 0 0

a e a c v mmhvl%aDVDRO N ~ . EspWDTMWavPhsOVDneogeacanl

5 473 .00 $02 5.90

kodnvtooaohhtnkcanghnosham

Sk os.os

hndPeoltoo NakosIAMCensus 0 .. $2 0 5. 0 0 hu omni%I IAMvnn NadamCensus • RP . . \ 44 5. 0 0 keel pmn00 IAhvSSXNodsmCensus 0 .. 5 3 I 5. 00 lenoshm SthmXPCMCIANhsmel camas. .5I I o . o o hgshevla 3CXFE$75STtoXW lAM Canaua .... $2 I 0. 0 0 eosherle3CCFES74ST tlnoo LAM...... .... $1 S 0 . 0 0 Meoahnle 3CXEIS5ET toemeT ................. .. . 5 I 0 2. 0 0 .

aoshavle 3CXE50SEC toeamTI2 ................ 5 2 00, 0 0 Ide9almh 3CCN1559%X Qahs Modem ........ 5 2 S 0. 0 0 aoahevla3CXN55055XCeOulavMadam ........ $2 0 8 . 0 0 Msgalmla 3CXN35058XVsh Madam(Xaachi ...... $2 0 0. 0 0

shoehorn accyat550D In Ink vsoxNadam... $3 I 0 . 0 0

Nagahnh CCFEMaea to tnlevsat Modnn . $3 I 0. 0 0 alpheitc 3CXWI555GT Ioeamvv5ae Madam -. $2 0 0 . 0 0

Ihgahnta Ckgaostm toessavev5alhodem$3 50. 00 Wno Sshaona242ensnn INrsUglaCoetca 5 230.00 Wcis Sehhan 24X Enmm CDn lSeuml .

.5 2 05. 0 0

Wna Schoon 322eadsmckCeatca .— $2 • 0 . 00 Isna sehoons32xEaakpnn 32x cD meound .5 2 05. 0 0 MslanvFAetotatooEnnT ahamet PCMOA .. 5 0 2 . 0 0 NewNaSahohheamev . . ........,........ .. $0 0 . 0 0 Maoahch OSS IV Tmnt 151 Cash Channels

5 I 7 9. 00

RaoalmhNTeer kalahoaklVPCNOA .. .....5225.09 PCNCIA Mh CDRDSI Imve Inc nol veoulmcl .....5 2 30. 0 0

I BM-T h i n k P a d ThknPnl 700EIEDMUELD.

Tech: eo 4 73 $ 4 7 38

NeeOryRkk™ Iloaawsl

F-360

®I+

I ntel Pentium II 400M H z 64INB Memory 6.4GB Hard Drive 4 X DVD RO M 5 6KBps Fax Mo de m 14.1" XGA TFT Display

Jorosds 430 Palm-Size PC. ~

Stn et 2IMA Jornada 580 with slodem.....$1180

...

-$ 9 3 lt5u3lo

lunkPad 250 .

. Steenlnlhn

Jornada 820 vvkh Modem.. $1 345

g ®

1hlnliPad T70,770E,MME.TP3W, l-t45t.l5tt .

Mrno nvgmo

Model CP U R A M 1 40 0 C D O l splsy P dce 3427 P 3 -500 64MB 9GB 24X 12.1 TFT $3,330 506DX CGI433 32MB 4.8GB 24X 12.1 HPA $1.585 5067 C e l433 32MB 4.8GB 24X 12.1 TFT $2.015 5147 CGI466 64MB 4.8GB 24X 12.1TFT $2,445 514TXV CGI466 64MB 6GB D VII 14.1 TFT $2,875 730TXV P3450 64MB 6GB OVD 14.1 TFT $3,230 732TXV P3-500 64MB 9GB DVD 14.1 TFT $3,510 734TL P3600 64MB 12GB 24X 15.1 TFT $4.165 7367L P3650 128MB 18GB 24X 15.1 TFT $4,855

J ornada 090-133MHX, 32MB~ I3 2 0

5 05 .. 5105 .. $1 79

Intel Pentium I I I 450MHz 6 4MB Me m o ry 6GB Hard Drive 24X CD-ROIN/bulltdn sound 12.1" TFT Display 5 6KBps Fax Mo d e m

$128I2t2IRA

ThlnkPad TP 3eaa,mnn -.

Cp-

Teatsotoo. pavlagaThhcT. saleole poR anoatt2nssno Thlnld'ad 345NXD8 gn 300.

.5•9

MSA44Aoasaemovyafck .......... $29$ kancpcapccndAdephr .............. $110

NNNQ~ '

% 5l

$079 $479 5 $59

MSA4A SWIMemory Seek MSA trA IMMINemovyMkk. MSA424 32WIMammySkh ...

Model CP U RA M H D D C D Disp ay Price 7020CT PII366 64MB 6.4GB 13. 3 TFT $4,650 7200CT P3600 64MB 12GB 13. 3 TFT $5,425 2140CDS K6/450 64MB 4.0GB 24X 12.1DSTN $1,810 2180CDT K6/475 64MB 4.0GB 24X 12.1 TFT $2,510 3110CT PII300 64MB 6.4GB 10 .4 TFT $2,945 4070CDS COI366 64MB 4.3GB 24X 13DSTN $2,485 4270DvDCOI500 64MB 6.0GB DVD14.1 TFT $3,800 4270zovoCel500 64MB 12GB DVD15.0TFT $4,585 4260DVDP3-450 64MB 12GB DVD14.1TFT $4,150 4300 P3 - 600 64MB 12GB DVD14.1 TFT $4,900 8100 P3 - 500 64MB 12GB DVD14.1 TFT $5,450 Intel Celeron 433MHz CPU 8100 P3 - 650 128MB18GB DVD14.1 TFT $6,315 64MB RAM 10GB Hard Drive ATI Rage LT Pro Video 8MB 32wuwl2sh 4X DVD ROM T OSHIBA-Noteboo k PvalegentoCT . .. .............,......,............. ..$14%2WINA 56KBps Fax INodem Salaoks 40WXOVD25000972059CDS . . S M 2I2WI378 13.3n TFT Display postage 7000cT. salslaa 4N940ISTecvawos u I 2lywlayo

— .. $1 84

PCGA4!PTI sanded ealhry 5400 P CGA4%FIAlhstRepocaka . . .. H27

TravelMate 340T

Intel Celer on 4 3 3 M H z 6 4MB RA M e x p . to 19 2 M B SGB Hard Drive Trident Gra phics w/2 .5M B 12.1m TFT Display 5 6KBps V.90 Fax M o d e m DVD RO M D r ive Built-in So und System

.............--...—.5 0022nase

C om p a q - N o t e b o o k

Snrnstore CD W r iter P l u s

Annmh TytodlT 73XX ISISDM1520DM 1550 -$121laMSMA Armada 7400, Tna, toaoC. 3MN, ITXX ... . 5 03I200/RA Amuuh 4tn, 41'lo. 4I20,4tao, 4t3t 4220T . 4I52I2nykk Armada V.IO.E Scales ...................-.....„..—. 5 IWIS3I309

FC'MCIvk

MS20e

Hard Drive Upgrades FDT PD2tablea

TOSHIBA 2E' KIDE Hard DiSk DriVe

5 6K P C M C I A Data Fax Mode V.00 Upgrsdai 5 Years «arron

3CX SH S72 10/100Mbps LL FCMCIA tsrd IXJack) Lifetime warrant>

6.4/I 2/ISGB .........$330/49

Systems Inc..PP;...©... T el: (80 4 ) 7 3 0 8 1 $ 3 F8$$$ {e o 4) 730 7983

P CGIACTt AC Adaphv .—

Mghnnea lh movy Sech

$ 5899 .

TOSHIBA S atellite 2 6 10 DV D

$310

~t CDI S WMvo PCGAOtXI PtkscySmnm PCCAPSXI XG Dock

Intel Pentium 85 650MHz 1 28MB Me m o ry 18.1GB Hard Drive 4 X DVD RO M 56KBps Fax M o de m sn anvl 13.3" XGA TFT D isplay ony Program m a ble Jog Dial

6.4GB Hard Drive 5 6KSp s Fa x M o d e m 12.1" XGA TFT Display saooot

Model CPU R A M H D D CD D i splay P r ice i1420 CGI433 32MB 4.8GB 24X 13 HPA $1,775 i1421 COI466 32MB 6GB 2 4 X 13HPA $ 2 ,210 i1480 Cel466 64MB 6.4GB DVD14.1TFT $3.230 i1540 Cel433 64MB 4.8GB 24X 12.1TFT $2.585 i1541 COI46664MB 6GB 2 4X 13 HPA $2,875 240 C e l300 64MB 6.4GB 10. 4 TFT $2.245 240 COI366 64MB 6.4GB 10.4 TFT $2,810 390X P3<50 64MB 12GB 24X 14.1 TFT $4,100 390X P3-500 64MB 12GB 24X 14.1 TFT $4.590 600X P3450 64MB 6.0GB 24X 13.3TFT $4,490 600X P3-500 64MB 12GB 24X 13.3 TFT $5,175 600X P3-500 64MB 12GB DVD13.3 TFT $5,370 600X P3-650 64MB 12GB 24X 13.3 TFT $5,760 600X P3650 64MB 12GB DVD13.3 TFT $5,855

5 I 04

$24$ $ e04

PCGAGmt gkmdnd

$ 2 79 9 . ~

XG-18

Intel Pentium II 366MHz

I ntel Celeron 433MHz M M X MB Memory .BGS Hard Drive DVD ROM 6KBps Fax Modem 14.1" TFT Display

PCGAGPSIShteo Spndmv PCGAAC5tACAspen .

PCGAepmTdphcap. auyooao 5039

Intel Pentlum SI 450MHz 64MB Me mo ry 6 GS Hard 0 ri l e 24 X RO M 56KBps Fax INodem 13" SVGA HPA Display iLink S400 Interface Video Out - NTS C

Igy

h inkPa d i 1 4 6 0

H SO

PCGAagst Skndndeaeny

Intel Pentium Ig 450MHz 64MS M e m o ry 6GB Hard Drive 4 X DVD RO M 56KBps Fax Modem 14.1" XGA TFT Display iLink S400 Interface Video Out - NTSC

64MB Memory

5 400

PCGAGPaauoa e .edwy

PCGACCmlasenvCnvylngCase $230

$ 38 99 . ~ '

Z 505 R

P CGAOD5IEahtoaCDSGNOlvs

ModelCPU RA M HDD C D Display Price V300 Cel400 32MB 4.3GB 24X 12.1 DSTN $2,200 V300 Cel400 64MB 4.3GB 24X 12.1 TFT $2,635 V300 Cel466 64MB 4.3GB 24X 14.1 TFT $3,215 M300 CEI333 64MB 4.3GB 11 .3 TFT $2,615 M300 P0333 64MB 6.4GB : m 11.3 TFT $3,345 M700 PII366 64MB 6.4GB 24X 14.1TFT $4,140 M700 P3-450 64MB 6.0GB 24X 14.1 TFT $4.570 M700 P3-500 64MB 12GB DVD 14.1 TFT $5,500 E500 PII366 64MB 4 3GB 24X 12.1TFT $2,910 E500 PIM00 64MB 6.0GB 24X 14.1TFT $3,640 E500 P3-500 64MB SGB 2 4 X 13.3 TFT $3,695 E500 P3-450 64MB 12GB 24X 14.1 TFT $4,390 E700 PE400 128MB 14GB I3VD 14.1 TFT $5,140 E700 P3-500 128MB 18GB DVD 15 TFT $6,285

' Government And Corporate Pvrchege Orden Welcome Fax Orders Aad Bids Are Accepted ' All Prices Resect 2% Cash Discoaal Leasing Aveilsbb

IP ~ ~

~ ~ ~ ~ ~ ~ ~ Q

v paces SMSject To+Dense TURNTHEPAGE II•

I 5 I •

•

nih

I g / gg

ors I

L ~ ~ ~ ~ ~ ~ ~ ~ ~ J

Q +~

l@ EQ+~

Xeon Server & RAID Station Slow Ava Call For Details.

©SNQiNC F

arsaawij(

,ghPg nI,OIN1IN VX1+ TM

S E R u/ E R ~~

• 12&MB ECC SDRAIIN4MB EEP OM • 1.44MB Roppy Drive BOusntum 9.1GB Ultra Wide SCS Dnve 6.9ms acosss time, 7200 RPM, 2MB • On Board Symbios Logic Single harm Ultra Wide SCSI Conhogsr BOn Board GD5480 Video Card 2 6 BToshiba 40x Speed SCSI CD-R M • 15" SVGA Monitor • On Board EtherExpress Pro+ 1 100

•56Kbps External Fsx M odem BATX NetServer Case with 300 W its Power Supply • 14 Device Bays,5.25 xg& 3 .5 x6 • 104-ke sKe bosnl &PS/2Mou

(Dual Processor/RAID Capable) • 128MB ECCSDRAMISMB EEPROM • 1A4MB Floppy Drive •SeagateST318275LW 18GB HarlDnve Uk/a 2 SCSI.7200 RPM • on Board Adaptec Alc-7896 Duzi Channel Uas 2 SCSI Contrail/6 •O n Scant GD5480 Video Card 2)EB • Toshiba 40x Speed SCSI CD-RO$) • 15 SVGA Monitor • On Boa/d EtherExpress Pro 100 N B56Kb ps External Fax Modem • ATX NetServer Case with 300 W Power Supply • 14 Device Bays. 5.25' x 8 & 3.5 6 • 104-keys Keyboard & PS/2 Mou

42,225

Passeaee..$2,745

P III550MH $ 2 , 2 5 5 P III~ H~ . $ 2 , 3 0 0

Pm-aeaeH~.$2,790 $2 975. f rrrsscMM Ill-rooMHz..$3 105

$2,485 Pill-rooMH . $2,615 Pm650MHz,

n ssvsrssw ~ '

III-r50MH

$3 6 0

lll-533MHz.,

D o l Pitch 0 . 28mtri~ 0.2 8m m 0. 28mrn 0.27 mm 0.2 7mm 0.2 6mm 0.2 3mm 0. 27mm 0. 25mm 0.2 6mm 0.27mm 0.25mm 0.2 7mm 0 .25mm 0.2 3mm 0. 26mm 0 2 6mm 0.26mm 0,25mm 0 ,25mm

Q115 0. 26mm G810 0. 25mm P810 0. 25mm P81 5 0 . 25mm PT&13 0.28mm P817 O Z 6 mm L700 0.30mm VP140 0.30mm VE150 0.30mm VPD150 0.30mm VPA1 50 0.30mm VP151 0,30mm 'VP181 0.30mm

1024x768 1024x768 1024x768 1024x768 1024x768 1280x1024 1600x1200

Mewsb/e H-Scan

Tgb/Briar etwrsBh Mgennium G400 chiP w/1OMB Dual DlsPlsy Mgennium G400 chip w/32MB Dual Display

•

16.0 15.9 16.0' 16.0" 16.0' 16.0 16.0" 16.0" 16.0 16.0 18.0 18.0" 18.0 18.0' 18.0 18.0 1 9 .6 2 0 .0" 2 0 . 0" 2 0 .0" 2 0 .0" 2 0 .0"

30-7 0KHz $ 3 1 5 30 -70KHz $ 3 3 5 30-85 KHz $ 4 1 5 30-7 0KHz $ 3 2 0 30-7 0KHz $ 3 8 0 30-7 0KHz $ 3 9 0 30-70KHz $ 4 3 5 30-95KHz $ 505 30-7 0KHz $ 4 1 5 30-9 7KHz $ 4 8 5 3 0-86KHz $ 5 4 5 3 0-95KHz $ 5 2 5 3 0-95KHz $ 5 7 0 3 0-95KHz $ 6 4 5 3 0-95KHz $ 7 3 0 3 0-97KHz $ 7 1 5

15 .1 14. 0 " 15 . 0 " 15.0 15 . 0 " 1 5.0 1 8 .1 '

30-95KHz $1,035 30-89KHz $1,135 30-95KHz $1,200 30-115KHz $1,300 30-1 07KHz $1,495 30-137KHz $2 210

1 . 0 procssax $205.00 Oxygen VXI-16 GLINT R3 processor with 16MB SDRAM AGP Oxygen VX1 CU N T R3 proawscr with 32MB SDRAM AGP $320.00 Oxygen GVX1 G LINT R3 & GLINT Gamma GI chipset 32MB AGP $1100.00 Oxygen GVX2 2 x GLINT R3+ Gamma G2 pmcessor 64MB AGP $2185.00 $225.00 permaza Creole/ pennsrka 3 vnlh 32MB SDRAM AGP Lighlning 1200 R eallmags 1200 chcwet 15+16MB 3D Msraxy AGP $ 5 6 5. 00 Tcmwfo 3000 R e allmage 3000 chipeal30+32MB 3D Memory AGP $1860.00

SR@

P ir c e

30- 70KHz $ 2 3 3 30- 70KHz $ 2 4 0 30- 70KHz $ 2 7 6

$185.00 $252. 00

MgenniumG400 Max cd w/32MB DualDisplay $ 2 90.00 & Ed' $415. 00 G400 ch 16MB w/Moccn JPEG

13.T)m)gmKL50KHz $225 1 3.8 1 3.8" 1 3.8'

Pill-600MHz...$4 51 0 lll-66rMHz...$4y730 pill-r33MHz...$47870' Pill-800MHz... $C cEII

111-800MHz., $QczI I

Pagm(ggr M c x Res. 102 4x768 128 0x1024 128 0x1024 1280 x1024 1280x1024 1280x1024 1600x1200 1280x1024 1280x1024 1280x1024 1280x1024 1600x1200 1280x1024 1600x(200 1600x1200 1600x1280 1600x1280 1600x1280 1600x1280 1600x1200 1 600x1280 1600x1200 1600x1200 1800x1440 1600x1 200 2048x1536

t ll-533MHz...

lll-600MHz... $2,025 lll-6rrMHz... $2,245 III- r33MHz... $2,385

VieWSO INC' 9.E .... Model Q51 ~ Q55 E655 M50 Q71 Q73 Q75 E771 E)73 G773 GS771 PS775 M70 PF775 Q95 E790 E7908 GS790 PS790 PF790

• 1 44MB Peppy D/ive • 13GB Hard Drive UDMA 66 8.5ms access rime.7200 RPM • 3Dlabs Oxygen VX1 GUNT R3 C with 32MBSDRAM •50xSpeed UDMA CDdtOM • Irrswsonlc E790 19 SVGA 1600x1280 resolutkm, 0.26mm • ATX Mid-Tower Casa w/Power Su ly • Fujitsu 1044/eye Keyboard/w MS ouse

• Inlel L440GXC Pont .:m iii SerVer BOSrd

+--

BAsusP3CS Penuum ul/Pcrzs B)rard • 1 28MB SCRAM (100 MHz System Bus) •1.44MB Floppy Orive • Adoptee 7892 Ugra160 SCSI Cordrollsr • Seagate ST318233LW 18GB Ha/d Drive Ultra160, 10000 RPM • 3Dlabs Oxygen GVX1 GUnt R3 &. GLint Gamma G1 chipset 32MBr • 50x Speed UDMA CD-ROM Bviewsonk G810 21 SVGA Moniiar 1600x1280 resolution, 0.25mmDP BATX Mid-Tower Case w/Power Supply • Fujitsu 104-keys Keyboanliw MS Mouse

• Asi/8 P3C.2000 Pcn/ium uirPOL Boa B1 28MB S DRAM (100 MHz Syale Bus)

Big D a t a B %

Brg D a t a B X s • Intel T440BX p niium ui Server (RAID Capable)

3D Station BK

3D S ta tion B

' •

($(-m

NEC SONY

S Scsn761 SupsrSam761 19/1FV022mmDP1800xt200@75Hz $ 9 8 0 . 0 0 SScan813 SupwScan81321"/20"VO ~ 1858 xt392NOOHz $1820.00 $2425.00 SScan 814 n 814 21 "/2OV 022mmDP 2048x1 $440.00 DScan 70 70 I 7"/16"V 028mmDP,1280x1024@65Hz $740.00 DScsn 90e 90e 19"/18"V 025mmDPIOOOxt280($75Hz $580.00 DPro 710S DPI I OS 17"/16"V 025nvnDP 1800xt 200@65Hz Flat DPro 900u 900u 19'l1 8'V 025mrnDP,1600x1280@75Hz USB $955.00 $530. 00 DPlus 71 DP71 1T/I I/V 025mmAG,1280x1024@65Hz $1480.00 DPlus 120u 120u 21 /I 9.TV 028mmAG 1800x1440@75Hz Dpkw 200u DP200u 22'/2OV 024mmDP,18xkrl 00($85ta $1485. 00 $1760.00 DPro 2040u 2040u 22"/20V 0 24mmDP 1600x1200@85Hz LXA550W 15" LCD Panel 1024x768©75Hz LCD52 $1700.00 $4685. 00 LSA820W 18 LCDPanel1280x1024LCD80 1 0 ,1 1 FE950 19 /1 SV025mmDP I 792xt 3444!68Hz $735.00 19"/1 SV 025mmDP 1920x1440@73Hz $970.00 FP950 22 /20V025mmDP,1920x1440@76Hz $1490.00 FP1350 1915.00 FP1370 22 /2OV024mmDP204&xl Hz 980.00 CPDG400 1 / I t / V 0.24mmDP1800xt440$$70Hz CPDG500 21 /20V024mmDP2048xt536@75Hz $1770.00 $2900.00 GDM-F500R 21 /19B'V 022mmDP2048xt 535@75Hz

Fa)m)1 N(z)sm*

At11 1le hhI Mew. hhV hid Product Fsstows Cac Organizing Applications MSDutlook Licks

f it l

li il

44.

AdvancedLCD

TFT Display Slim(EN))sr 31-6 1KHz $1,420 Cariin() Case 306 1 KHz $1,320 AvsniGo Wsb Cksascl Manager 30- 62KHz $1,380 48-62 KHz $ 1,545 Storage Capacity t u n znu sus RMn SMs snw r u n RMn IM s stun 30- 62KHz $1,665 Dpcrsl/Ilg 5)'stela Palm os vr.c Palm OSv3.1 Prim OS vsr Palm OS vss Palm OSrla 30-9 5KHz $2,100 30- 107KHz $4,080 pearllowl 0'210 5330 5 S5'0 5( I S5 5 S S(/'

MicroConcept Systems Inc. ': 1 02 - 1245 West Broadway Vancouver, S.C. VBH 1G7

@g al :(6O4) 734 7 ®83 Tech : ( I O4) 73&4k738

s&tgloEF()I FB8) 6

e;,

c OOT-COM

HOME x

Sir, itta your fridge calling ContinuedfrompageIv

of Home Director. And while IBM says Home 1.0, which has a top speed of I Mbps. Director isopen to the upcom manager For Intel ing communica- Doug Cooper, devicecan communicate on a TCP/IP network tions standards, such as Bluetooth, it is sill of Canada Ltd., in Rexdale, Ont., says the thenit is capable of being a UPnP device." waiting to see if it should allow for greater biggestadvantage for consumers is the simSullivan says by using su«h open standards, accessto network appliances.Currently,Home plicity of the AnyPoini solutions. Users anach a UPnP device is essentially network inde- Director is limited to turning devices on or off. a PCI cardto their computer and «onnect it to "We are aware of that dimension of net- a telephone jack. For newer PCs, a USB pendent. This is an important feature since Microsoft believes there will probably be no working [networked appliancesl and we are adapter can be connected to a USB port. For single network architecture that such network- asses sing the value to consumers, " says leif older models, there is a parallel port external ready appliances and devices will communi- Kirke, manager of consumerand complemen- adapter with a printer pass-through port. cate across. "Once the software is installed, it will ask if tary solutions at IBM Canada's headquarters in "One of the scenarios is that in any given Markham."We are waiting for people to tell us this computer is the one that is connected to home you will have multiple networks," that is something they need." the Internet, and then goes out and discovers Sullivan says. "So you may have two PCs and The need to retrofit a house is not a trivial what resour«es are connected and brings them an intelligent device in the kitchen and they requirement. Ask anyone who has to pufi extra together," Cooper says. "The user does not may use the HomePNA ja phoneline network- phone cable through the walls of a house to add have to configure anything." ing standard developed by t h e H o me a phone jack to a room how willing they are to Cyrus Namazi, president and chairman of Phoneline Networking Allianc«j to communi- repeat that experience with Ethernet cable. HomePNA, in San Ramon, Calif, says the cate. But I also have a cell phone, a universal HomePNA specification was designed to make control and a palm jsizej PC that communihorn» networking assimple as possible, withcates wirelessly." out requiring additional wiring in a home. "We are a no-new-wire approach," Namazi A growing, diverse market says adamantly. "We totagy subscribe to the Certainly many analysts think there wifi be a philosophy that nobody is going to driU holes variety of different networks operating in a in their walls and run new wiring to get a nethome in the near future, worked home."

m arketing

We totally subscribe to the

Already, networking the home is agrowing market. Boston-based industry research firm, the Yankee Group, says some 650,000 U.S. homes have become networked, and it expects that number to climb to 10 million by 2003. Karuna Uppal, senior analyst for the company's market research division, says the driviog force is the growing number of homes with two and more PCs and a variety of different network-ready devices. The trends in Canada are similar, according to AC Nielsen Canada. The Markham, Ont.based research firm said in January that of the homes that reported PC ownership, 30 percent daimed to have more than one computer. This is up from 27 percent in 1998. That works out to about 1.25 to 1.5 million Canadian households that are candidates for some kind of networking infrastructure. (AC Nielsen Canada also reported that 6I percent of Canadian households now own at leastone PC, up from 58 percent a year ago.) In order to tap into this growing market, IBM Canada Ltd. has been showcasing its Home Director network, which uses Category 5 Ethernet wiring to link a home's computers, phones, televisions and even security system. It also lets Internet users share multiple modenu forhigher conne«tion speeds and dynamically routesphone and Internet traff ic to preserve the quality of the signals. Thesevarious devices would be connected to a Home Network Connection Center (HNCC) that would sit in the basement or a closetmuch like a fuse box. it would have afi of the homds telephone wires, coaxial cables, and Category 5 Ethernet cables operate as an Ethernet network and carrier of video signals. One major obstacle with Home Director is that it's designed to be installed in new homes and condominiums —or those undergoing extensive renovation —since a lot of new

wiring has tobe i netage d to take full advantage

phil osophy thatnobodyis going to drill holes in their walls and run newwiring to get a networkedhome

—CyruSNama21', HOmePSA Both Sun and Microsoft recognize the importance of simplicity and working within existing structures, and are working with a variet y of networking manufacturers to make their initiatives compatible with their home networking solutions. Sun's.corn Home initiative, for example, is network agnostic. At CES, Cisco Systems showcased its Home Gateway 2000 line of devices that would afiow for multi-service delivery of high-speed, broadband connectivity into the home. The gateway technology is designed to allow a home to be networked so it can accessa variety of new services and content, such as online games and entertainment, multimedia, and the next generation of high-end television. Cisco says the Home Gateway 2000 line is designed to work with Sun' s.corn Home architecture. "Sun is promoting fava and lini, but that is really an interface internal to the home, between PCs, right to stereos," says Louie Di Diodato, a consulting systems engineer for Cisco Systems Canada Co., in Toronto."We are focusing on networking afi of those devices to the Internet using DSLP In addition to DSI„Home Gateway 2000 wifi support cable and wireless networ4, and even future rogouts of FireWire and USB connectivity. Intel Corp. also wants to be a major player in the home. networking market. Its AnyPoint Home Network solutions use existing phone lines to connect PCs and devices to a network. Its latest AnyPoint Phoneline Home Network products support the HomePNA 2.0 specification. It can deliver data at up to 10 Mbps, and is compatible with the current HomePNA

•

Wr4 •

•

from the HomeRF (radio frequency) Working Group, perhaps Bluetooth. some proprietary wirdess systems, and a wireless Ethernet solution based on the IEEE (Institute of Electrical

and Eie«Ironies Engineers) 802.11 specification. The 802.11b "high rate" standard was recently ratified. Devices using 802.11b will have a top data transfer speed of 11 Mbps.

Recently, 3Comrolled out an 11 Mbpswireless network solution, AirConnect, which is

based onthe802.11b specification. While «urrently aimed at the enterprise and mid-sized business market, 3Com expects wireless technology to eventually make its way into the

home,offeringanother networkingalternative

for older homes. One advantage with a wireless solution is the ability to roam while staying connected to the network. rather than being tethered by a phone line. Ii you build it, will they buy?

Nick Tidd, president of 3Com Canada Inc., in Burlington, Ont., agreeswith Namazi that

In the end, the real question iswhether people will accept networked devicesand applianc«s.

using existing phone lines will probably be the way most people incorporate networks into their h ome, w hich i s w h y 3 C om's HomeConnect network solution is «ompatible with the HomePNA 2.0 sperification. HomeConnect solutions deliver data at rates of up to 10 Mbps. A Hom«Connect kit comes with two internal PCI phoneline network

Both Microsoft and Sun will face an uphill battle in getting consumer electronic companies to adopt their networking standards.The cost of incorporating such technology into a toast-

adapters, a standard phone cable, and Microsoft HomeClick Network software, which simplifies network setup. "The manufacturer who is going to win at

the end of the day will be the one who will demonstrat ea strong user-centric focus,"Tidd adds."Consumers really don't care how afi of it works together. They just want to turn it on

and have it work" Other manufacturers have also introduced HomePNA 2.0-compatible home networking products. For example, Oakvifie. Ont.-based D-Link Networks has introduced the D-Link

DHN-910 10 Mbps Phoneline Network in a Box. This starter kit includes two HomePNA networkcards,software and a phone cable. Likewise Diamond Multimedia, whose I Mbps home network cards we tested last year,

er or an oven will be borne by the consumer, and manufacturers are likely to question whether there wifi be a market for the higher priced, enhanced products. NCR Corp. encountered that reaction when it demonstrated a microwave oven with a Web browser on its door. The device produced more giggles than inquiries about when it

would becomecommercially available. "These are people (home appliance manufacturersj that build low cost, high volume devices and make money doing it," Giga's Enderle says. "In the PC market, the margins are thin and in the appliance market they are ultra thin. There is not a lot of extra money to do things like throw flat-panel screens into refrigerators or microwave ovens. Those are things that would sell to a very small audience. These are volume initiatives and the question is whether Sun or Microsoft can really drive it

or will it need somebody like General Electric to make it happen." Q

Convergencecontacts a

3Cotu hup:(/www.3«om.corn Be Iuc«http:llwww.be.corn

Cia«aSystems:http://www.cisco.corn HomePNA: htttryiwww.homepna.org IBMCarp.: httx/iwww.ibm. rom iatel Corp.:http:Itwww,intel.corn Microsoft Corp.: httpyhnavzaicesoit.corn

as also introduced a 10 Mbps version of its HomeFree home networking kit. Diamond Multimedia also makes a wireless home networking product, but we were told by

•

a Diamond representative at Comdex recently that the company is waiting for a firming up of wireless home networking standards before developing that product further. On the table currently are specifications

•

RCR'sKnowledgeLak hup:I/eww.tnowiaugelakcom Qubit Technology:http:/www.qubit,net Sun Microsystems' .corn Homeinitiative: http:lhrww.suo,corn/consumer-enbaddedl

s•

•

I I

•

www.«anauacom putas.«om THECOMPtrtusl PAPER ec 80mON APRIL2«oo 21

«O O T -CO M

HOME v

The world of computing ... coming soon to a television near you By 'Rnmnnh Snhnnrnnnm

elevision, as a technology, has changed very linle since Certainly, television sets have evolved —black-and-white its invention. Today, you turn on the TV, choose a sta- pictures to colour; large sets to palm-sized units; and the tion, and turn up the volume, much like your grand- adventof the handheld converter was a wdcome develop-

ment, bringing the ffrst wave of channel surgng.

parents probably did.

PI1:604-874-0786

NETPRO COMPUTER

Fax:604-874-0787

"We o8'er wholesale prices to the public" • II

•

' -

• •

•

• •

•

ss '

•

• •-

•

• 5

surgngmoreenjoyable and moviesmore engaging.

• •

•

I nte l Ce/eton 400 5710 Celeroa 433 5730 Celeioa 450 5758 celeioa 500 MI9 Celeioa 533 $009 Penbvm II 400 5039

With 15 Monitor Motherboard 32 MB SDRAM 1.44 MB FOD 56K V/Fax Modem MPEG 8M8 Vdao 3D Sound109 44X CO-RDM 120 Watts Speakers Win98 Keyboard 26utton Soil Mouse ATX IT Casing

•

Todaf s multimedia monitors are designed to be both S-VGA computer monitom and digital-

I•

' .

ready tdevislons. Themonitors are built with a

•

' s's '

550 9 5 749

•

Peabum11500 5tms Am b K aat 45 0 Ka.nl 400

•t

I I

t •

•

•t

r •

•\ .

Pentium IB 100Mhz Mninbcard Pentium IB 500Mhz cpu SMB AGP Video/OB

•

• •

64MB SDRAM PC100

•

6.4GB Uitrn DMA HDD 1.44 MB Roppy Drive 17 ATX Tower Case • 16bit 3D sound /OB 40X CDROM 56K V 90 Fax/Modem Win 98 Multimedia Keyboard 2 Button Soft Mouse 120 Watts Multimedia S pnnknrn Pentium IB 550/600 $97 9/91009

•

. t

•

$179 Asua P38-F BX440 AsusPSA-8/with audio $129 Abit BH6/856 $1 53/gt 89 Matsoaic w/Modem/3D Sound $10 5 Giga byte Socket Super 7/Audio/Video $109 Amtion ail in one Audiotdeo/Fax/lan $119 G/gabite Pt it Dual CPU M B $239

•

a • •

K6-II 500 K6-III 400

•

AMD K6-0 3D 450 MHz Socknt Super 7 100MHz M.Board 6.4GB UDMA Hard Drive 32 MB 100MHz SDRAM 3D BMB Video Card/08 1.44MB Floppy Drive IT ATX Tower Case 44 X CD ROM 3D Sound/OB, 120w Speakers Win 98 Keyboard, 2 Button Soft Mouse

•

$529 $549

ll •

•

• •

•

4111 18 PCI 30 Video Pine 8MB PCI/AGP Voodoo 8 Banshee 16MB Voodoo 8 I 2000 Voodoo 81 3000 '16MB 0/amond Viper 770 Riva TNT2 Snipper Riva TNT2 32MB ATI Expert Sl 8MB SDRAMPC100 32/64/128MB $ 59/95/169 ATI Experi 99 8MB S0RAMPC13337/55/128MB $cal5105/185 ATI Expert 128 16MB ATI Ag in Won Pro 128/18MB $40/89 EOD RAIN13/32MB ATI Rage Futy 32MB Pentium 8 400 $191 Pentium lg 500/550/600 $3 49/389/449 Video Camera Kit Imal Cele/an 405/433/455/560$105/tt5/125/159 $99/109 AND K6 II 45N500 AND K6 Ig 400 $129 • i I Ky506/556/Mg/650 $ 2 8 99/399/399 $41 9699/879 K7 700//50/800 t t • t

But after decades of few design changes that were really apparent to consumers, the TV is undergoing what some say is a revolution in design and functionality. Today's televis iona have gone digital, providing stunning picture ciarity and theatre-like sound. And with a variety of potential interactive and data applications developing, thc television in essence is set to begin merging with the computer in ways that will affect everyone. Inthepast,PCsand TVs haveviedforconsumer dolkus. Now, digital TV is forcbtg the two marken to ondst — one large monitor to make Internet

$35 $49/49 $99 $139 $179 $179 $129 $69 $99 $125 $240 $179 $85

Pleaseeall for cunaat pricing. All pttcss ana txtxtvcn avasabssy svbiad lo change wilhsvl oaves prices ie/Iscl 3% cash discount Nott s/xxtsam 1st tycogmnntcat errors. Brand nametmas maes tnxmg to tiwir sspscttm companies.

•t t•

•

We offer: Networking Solutions Year 2000 Solutions Computer Repair 8 Software installation Customize System Integration A/l systems are year 2000 compliant

Nntpro W88t t o Ii

745-West Broadway Unit 101 VAKL MON-SAT:10:00 A.M. In 6:00 P.m.

variety of video inputs to pmvide fast and easy connections to personal computers, DVD players, VCRs, camcord«rs, games and more. Digital TVs are being designed with the future in mind. In addition to receiving today's analogue signal, the HDTV-ready sets are designed to accep t tomorrow's digital TV signals that promise further enhancement to picture quality and sound. TV and computers an: merging, and the TV is poised to begin playing a pivotal role not just as an entertinment unit, but as a powerful source of information linked directly to the Internet, expected to prove popular not just with consumers but perhaps with businesses aswelL Within the nein ymr, television sets will be introduced that will enable users to access email and to surf the Internet from the comfort of their couches. With these new uses, digital high-resolution television monitors could begin making their presence felt more widely

among small and home office users. Emerging technology essentially is bringing the computing world right to your TV screen. Recently , researchers in the U.S. successfully sent high-degnition television (HDTV) signals to each other using next-generation Internet technology. HDTV is a digital version of today's TV signal that can display images with much greater darity. Passing a data-intensive HDTV signal in real time required the use of the Internet2 network, a higher-speed version of the Internet that's capable of delivering data up to 85,000 times Sister than a typical dial-up modem. According to experts, thc meant demonstration proved that the Internet may one day deliver broadcast-quality video to every home. As technologies develop, we can look (orward to delivery of interactive TV entertainment that is actually tied to e-commerce sewices. One day, consumers will be able to see a product on TV, click a button, and gnd out details, such as the price of it and where to buy it. In minutes, viewers can purchase the same chic coat Victor Newman is wearing on Tiir Young andTheRcs/kss. As the Internet replaces TV broadcasts with "cybercasts," a whole new world of entertainment and information will open up to viewers. Those old Leave it ra Ihawv reruns might never look the same. 0 ganesh SakasraaamISmadntiag manager 01Tt/ aad VCRproducts 1stTkbmsm ConsumerBscbnics Csaaca.

contact htgz//smw.gnmsos-mulgmedia.corn

< 001-COM

HOME w

Digital devices go au naturel • output format(easyIo decipherandread), • menu-arleniedInterface.

Sy Ibtmn MacDonald «gular readers will recognize occasional references I' ve made to my years of eing rainml on, slimed on, chased, bit-

ten and underpaid asa wgdfife technologist in the not so distant past. In those days, w«would venture into the woods with a Silva hand compass, a Suunto clinometer, a notebook, a "bear

,J m

/JA N'JID

rjJlm~fj'I'JJ I~ y fj , a I ' J

f , /dpRbfrn'rn~g rbal@W . j.-::

rrJf~ IJJj IJ @If D'vlff/(~r IJJj~p']f j "yf jm Jf fm'JI'. rJ Jf'I'JrJ

bell" (read: Grimly dinner beU)and, occasionally —for when the bear beB was working exceptionally well — a gun. Often, while traversing the woods counting moose poop, bear poop, deer poop, etc. (an awful lot of wildlife management in those days was based on poop). you'd run into a hiker or hunter or fisherme making their way with morc or less the same equipment you had (minus the baggies

door experience. Where such devices have been a boon to professionals for a number of years, it is only recentl y that manufacturers have begun to address what might be called a consumer market" for outdoor-oriented electronicsaffordable incarnations of sophisticated instruments that are finding a wide market among outdoor types regardless of practicafity or practicability. Such qualitative factors are Idt up to the buyer. Expert comments about each device are

provided by Bryan Rolph who not only uses many of the devicesdiscussed here, but represents them at CFE Equipment Ltd. in Edmonton, Alta.

GPS (global poaffioning system) Pri cerange:$200-$5,000(somemodelscancost upwardof $100,000) Usefulfor: hiking,cross-country trekking, boating.

moun taineering, hunting, any long-rangeoutdoor activity. Perhaps the most widely coveted digital outdoor devicethese days. a GPS takes signals from 27 sateUites—put into the stratosphere by the U.S. specificafiy for this purpose—to determine a 3D reading of the user's exact position on the face of the earth in terms of latitude, longitude and altitude. Not quite s«)f sufficient to JamesBond standards yet, with this device you'U still need a map of the area you' re in with accurate latitude, longitude and elevation coordinat«sand the ability to read that map —in order to establish your location. But, with that ancillary item and skill at hand, chances are you will never get lost in the woods or at sea again (or at least you'B know exactly where you settled down for your very personal death by expo-

Usefulfm:hiking,hunting, orienteering,boating, anysit-

uationin whicha standardcompass is used. Not too far removed from GPS in terms nf intent, a digital compass helps you find out where you are with the help of elemronics to point out true and magnetic north. Like GPS, some digital compasses can store way-points to record your course and/or work your way backward. This function will also work as a guide map along any pre-planned or pre-programmed route by telling you when and which way to turn. Common to afi models is that

readingscan be displayed in digiral form or as

full of poop). These days, however, as with so many aspects of our lives. the digital world has reached forth into the wilderness allowing those same biologists, hikers, hunters and fishermen to avail themselves of a wide range of electronics to replace the old analogue stuff, while adding new "conveniences" to the out-

Digital compose Pncerange:$i00-$f50

a traditional compass rose generated by the LCD read-out. Paradoxically, th«se digital devices still use a

spinning magnet called a fluxgatecompasstn

More insidious is the fact that the U.S. deliberately makes the satellite readings fuzzy, so accuracyis only to severalmetres.Th e r«aeon for this is somewhat vague, but essentially the U.S. do«s not want the technology it developed to be used against it by foreign governments for targetting guided weapons. The U.S. can also turn off the GPS sateUite system at any time and actually did so during th«Gulf War. While there is no way around an actual system shut-down, GPS units in the $100,000 rangenot only off«r"sub-centimetreaccuracy" but get around the deliberate fuzziness with their ability to address an established basestation with real-time correction. However, at the less professional level, the size and price of CPS receivers has dramatically fallen as the ability and feature sets have risen. There are numerous models available at prices that vary widely. Unique on the market is the Casio Pathfinder PATIGP-I, which can be worn on your wrist like a w atch ( i t d o es oasisPamgnderP/tytgn-I indude the ability to tell tim«). This handy little unit includ«s an eight channel-receiver ( afiowing i t to address eight satellites at any one time) and usesdata from at least three to calculate latitude, lo ngitude and altitude. It can store up Zo 200 way-points so you can work your way back to your starting point if lost. You can also pre-define the latitude and longitude of your intended destination so the PATIGP-i wiU generate a navigation screen to show direction and distance to specific coordinates from your current position. A map plot feature lets you scale the display

meansthe PAT IGP-I takesreadingseverysecond), it not only displays your position, it calculates your travd time and speed so you can estimate the time of arrival at your intend«d destination. Accuracy,unfortunately, is r«latively low for a GPS device at 30 metres but that's the trade ofi for such miniaturized convenience. Even lessfortu nate is a battery life of only 4-12 hours (depending on which mode it

issetat),so you'd better move quickly orcarry a pocketful of CR2 lithium batteries. Expea to pay about $750 for this item in Canada. AvailabiTity is limited at time of writ-

determine readings, which means it is best to hold the device at least close to level when taking readings. The major difierence between digital compassesand their mechanical coun-

terparts lies in how the directional data is displayed. Pricesdifferencesare accounted for by quality of construaion, number of featuresand the size and quality of the display. What Rolph says: "A compasswon't tell you where you are like GPS does, it just displays direction. The limiting factors to something like this —as with any of these devic«s in factis batteries. A digital compass makes things easier as long as the batteries have power, so you should always carry a backup battery or

ing, but the PATIGP-I can be ordered from even a backup analogue compass. Digital makes old-style compassing and navigation a Casio'sWebsite (htip://www.casio.corn). What Rolph saym"The PAT IGP-I is new to bit more user friendly but I recommend that the market and rather bulky to be worn on the wrist. And, compared to other GPS units, it' s somewhat gimmicky. Nonetheless, it is functional and has its place in the recreational market."

Of cour se,thereare numerous GPS devices

you stiB know the basics of how to use an ana-

logue compassbefore relying on the digital." Shopping tips: Whenbuyinga digiIal compass,lookIor:

• suiiabifity foryourprice range, • way-point storage.

available, most about the size of

those old analogue cell phones Wnnthnr monitor and orientedtoward moreprofes- Prke range:$150-$250 sional applications, like surveying Usefulfor:cross-country travel. mountaineering.boat!

and forestry. With a wider range of o ptions, abilities and accessories. these units range in price fmm about $350 ag thc way up to $5,000 for models that can provide accuracy down to the centunetre. Other variables include

speed of satellite signal acquisi-

ing, anyactivity thatreouiresa ienfithy stayoutdoors. While not exactly on everybody's wish list, I can think of a few recently r«scued snowboarders in British Columbia who might wish they'd had one of these before schussing out of bounds. Again miniaturized, these pocketsized devices read various meteorological determinants to record patterns then, in some cases, estimate oncoming weather up to 24 hours ahead. Depending on the sophistication of the model you choose, factors used to predict the weather include altitude, dew point, wind speed. heat index and barometric pressure. As

tion, the number of sateUites that can be addressed at one time (channels), number of storable way-points. battery life, and weatherprnofing. Some even teU time as well. What Rolph says: "GPS allows people more sure). accessto the wildernessbecause you don'tnec- with GPS. some knowledge and practice is However. there are several drawbacks to essarily have to be a skilled compassman to requ ired because they don't show the linle picGPS. Acquiring a reading can take a bit of time find places anymore. But it's not idiot-proof. tures of gulfy clouds or dewy raindrops you (anywherefrom four secondsto a full minute) see in TV forecasts. Instead, the read-out is You still have to knowwhat you're doing." depending on howmuch atmospheric distornumerical —so you have to know what the Shopping tips tion there is over the area you' re in. Also, read- screen to match the grid cells on your map, Whenbuyinga GPS system.rook fon numbers mean. ingstaken fiom avalley or lowland whensatel- which makes determining your location that • good bacfdightingon thedispiay, What Rolph says: "In most cases,consumerlites are low on the horizon reuder GPS less much quicker and easier. level weather monitors won't tell you what' s • batteryfife. than usefuL Continued on pageZd When set for "continuous" mode (which • numberof channels, www.canadnompul es.rxvn MECOMPI/rbnruinbn SCEDnlON Annltzonu 23

ll r e l i ahle h asiaess y a r t aer ggl-Nyhghlgg ~ ASUS P38-F1 Phl 440BX AGP 2ISA INTEL Pentium IN 550MHz (Retail) Dimm 100Mhz SDRAM 126MB 168pin 30GB Ultra DMA 66 2MB Hard Drive 1.44 MB High Density FD DVD Drive 10X/32X Int. Matrox Millen. Duel G400Max 32MB

Creative Ensonic PCI (OEM) Frontier 1T CS-A1 AlX w/250W PS.

Sony G400 19 inch Flatacreen .25mm IBM Multimedia Internet Keyboard Microsoft lntigimouse 28 w/wheel PMPO 691 60w Speaker

MS Windows 98 Second Edition (OEM) 2 Year Parts & Labour warranty

III INonslei INTEL PNI CC820I, 133Mhz Ultra INTEL Pentium NI 533MHz (Retml) Dlmm tooMhz SDRAM IESMB166pin 20GB Ultra DMA 66 2MB Hard Drive I A4 MB High Density FD DVD Drive I OX/32X Int.

Mstrox Millennium G400 32MB (OEM) Creabve PCI SB UveValue 1024 (OEM) Aopen PCIFM56-H ITU-T V90 56k/V Frontier 1T CS-A1 ATX w/250W PS.

NEC MultiSync Fe700 1T.25mm IBM Mulgmedia Internet Keyboard A Open 28 Rrst Mouse w/wheel Micromedia M+100 Sub Wooier MS Windows 98 Second Edigon (OEM) 2 Year Parts 3 Labour wmranty

AB IT BF6 Pentium II/III 440BX, ATX IN TEL Pentlum SI 550E (Retail) Di mm 100Mhz SDRAM 64MB 168pin 13 .6GB Ultra DMA (7200rpm) 1A 4 MB High Density FD Cr eative 52X int.lDE CD-ROM

•

Cr eative AGP Serage 32MB

• • • • •

Ao pen PCI FM56-H ITU-T V90 56k Cr eative PCI Ensoniq Audio (OEM) D- Link PCI DFE-535lX 10/100 10BT Fr ontier 1T CS-At ATX w/250W PS. Op tiquest 071 17",27mm Monitor

•

IB M Multimedia internet PS/2 Keyboard

• •

A O pen 28 First Mouse w/Vsheel (OEM) Mi cromedia MCI 00 2 wny Speakers

• •

MS Windows 98 Second Edition (OEM) 2 Year Parts & Labour warranty

Junior Tccbalciaa orieamdi (120 boun)g ~ ~

NslsNsllNtghtslh SlaNIIsa ~

• Computer Iuudware snd iis configuration • Basic acnvoikblg

• Experienced instructors snd supervisors (witb A+ and MCSE ceriifiestcs) • Unmatched lowest seining costs. • Leadingedge comyutcrequiymeixsforyourlends«iu Ffacilcc

• Gctcurrentsnd localworkingcxgcricaccsatthe sm w ume you gct seining. You will receive, in teal world working environments, intensive bmdscin training for system assembling and configuring, bsrdwsre snd sotlware uoublesbooring aod fixing, corporate-level losel network and internet scillF.

• Very good cbsnce for top-level trsinees to get co«ip and/or employment opgoraeitics with Frontier Comyuter upon successful completion of tbc worksbontraining.

Frontier Computer Workshop Progrorgg The uaineeswill learn: (30 hours)

• lllicfllct collacciivitii

• Operating Sysnm fundamentals Hands«in Lab pmcriccs: (90 hoes) ' Gaiamsaies is a mustrci aaycaewc~a' MCSE orieatedi

- All-incsns Mslnboard uglizing the Intel 81 0 chipsst

providing next generation features and great graphics perfonnance et a lower cost - Support Intel Celeron 300- 500 MHz Socket 370 CPUs - Highly integrated chlpset with SD AGP VGA embedded, Mogon Compensation circuit inside olr smooth DVD title playback

The nsineas will learn (at a mgisterd irainiag center) Networking Essential Micmsoit NT 4.0 Workstation Mieosolt NT 4.0 Server tvgcmsoa NT 4.0 Entcrarise Server soa TCFriF Micmsoa laternei Informafion Server HaaC«ca Labsiamicaatcasciviiad by axsarieccd aeaaeawimbrcauc cemoaimcceiacma)

- Pnivlded AV or S-Video output for lV connection with 5.1 channel AC3 support - 56K V9.0 Modem, 10/100Mbps Fast Ethernet IAN and dual USB ports for Internet access or external coiriiituriicatlcri

Add on Option: Intel CPU

AS US P2-99 Psntlum 8/IS 440ZX, ATX INTEL Celeron 466Mhz Socket370 Di mm 100Mhz SDRAM 64MB 166pin 10.2GB Ultra DMA 66 Hard Drive

•

1. 44 MB High Density FD

•

Cr eagve 52X int. IDE CDJIOM

• •

ATI AGP Xpert 98 8MB (OEM) Cr ssgve PCI Ensoniq Audio (OEM)

• • • • • • • • •

Aopen PCI M56.H F ITU-T V.90 56k/vo. Fr ontier 1T CS-A1 AlX w/250W PS. Sa msung 750S 1T.28mm Monitor BT C 51 40K Win PS/2 Keyboard A O pen 28 First Mouse+ w/wheel Ad aptor Slot to S370 PMPO SP691 Stereo Speakers 60W MS Windows 98 Second Edition (OEM) 2 Y ear Parts & Labour warranty

366Mhz —500Mhz llilemory 64MB -512MB

]

Fmatier Computes bas a fully equipped bigs tech computer clsssmem available for rent Classroom is fully furnished with a I2 student cssscity. Overhead mounted TV with FC2TV sdsstcnwc included and fulluseofourAIJSL High Syccd

$85and up

879 and up

int ernetconneeiooisFmvidedatnoexaacharge.FREE

Hard Drive

UNDERGROUND PARKING is Fmvidcd. A Private olEcc is availabla io ibc instructor for private use wkb all aecessey businessperipherals. Please call for mom details.

3149 and up

4.3GB — 40.0GB

OjpenBSD

CONIACT PERSON: SAM CIIAN

OpenBSD V2.6 CD Version

(2 disks set) Save time over web orden Secure, Reliable. and Conect,

ibeOpenBSD operating system is used for high reliability servers. Includes built in suung cryptogmpby and Internet servers, making it ideal

® ~4~

for VFN, NAT, www, mail, ctc.

@Sr,,r

For morc information Hap y/www.openbsd.org «AN prices rellect 2% cash discount.

c217

«AN prices & spec. are subject to change without notice. 'AN logos and trademarks are their respective owner. S

w aamm

3O wmaammyg

d ia ibc A+ cmiiiicaiiaa)

-Book Size 272mmX295mmX62mm

s • • •

Why should you choose FrontierComputer fortrainingt

• • • • • •

• • •

• I'

•

• I'

•I• I

w 'leal ava •

•

• •

•

i iiii ii r n • NE W

S TO R E • N EW

ID E A

E-maii:Saies Burnaby@fronet.corn

went.frontierpc.corn

Six Reasons to Shop With Us 4 Largest Showroom, Huge Selections 4 Knowledgeable Professional Staff 4 Most Competitive Pricing All The Time 4 High Quality Parts, High Quality Services dr Easy Acess From N.Van., Coq., Surrey 4 Plenty Free Parking Space

ATIAR(a Wonder IJOACPQMB/16MB(OKI(B

5 3 35/245 GalaemotMssiosmcrPrepbct 256(Reed) Q98 Guiaemot Mssiosmer Xoator 3IMBTNTI Ultre (Re(so QOS GaglemotCeagsr Vidm Kdnloa 2DDD(Retail) Q49

„M~herhoard Pentium Hl Motherboard:

A SUS P3C-D Duel - Pmtiumnl $20 PC133Mbz AGP.AT X $48 9 ASUSP3C-E Pcntiumln 820 PC(33Mhz Remeus,AGP, ATX $ 3 39 ASUSP3C2000 Pcntiumnl $20 PC(33MbzSDRAM AGP ATX 5279 ASUS P3W-E Pcntiumnl 810 Video, AGP.ATX $209 A SUSP3V/4X Cd. Pnl Vis693 PC 133Mhz I ISA 6PCI ATX 51 68 ASUSP2-99 Peauumn/Dl Cdeum, AGPATX / AT $149 ASUS P3B-Fl/F PcatiumlUU( 440BX, AGP.ATX $198 Ahit BV6 Pnl, Cel, I QMhz Ibe, AGP,ATX $138 Abit BF6PcauumH/IK 440BX AGP.ATX 5118 Abi( BM6 BM6Celcrea Socket370 AGP, ATX $172 Abit BE6 K nmtiumlMR 440BX ATX. Ultra66 $208 Abit BP Dual Socket370 440BX ATX, Ultre66 SZOS Aspen AX63PmPBI Pcl 33 Via, Ultm 66 5129 ktel PUI Ce820PCI33Mhz. Seund.Ultm 66, ATX $216 El i le PJSET-M. Pl UPEI,Cel, Vidots3DSousd,56K/Ni $118 E lite P6BAT-A+ Pn/PIE,Cel,PCI JJJDSmntLUlua DMA66 $12 $

539S

CruuiveAGPSsvsgc432MB (Rcld n CruuivcGraphicBloater RIVA TNT2 Ultra 32MB AS UShoP V4600GeFores 32MBPare ASUS AGP V6600GeFemc 32MB Ddsxc ASUS AGPV4NO Cere res DDR 32MB Pare

$138 5289 $345 SRN $41$ $489 5149 5199 5353

ASUS AGP VINO Cepercc DDR 32MB Ddosc 3DFs ACP Veodse UI JON 16MB Ezktail) JDPx AGPVeedoo Nl 3000 16MB ((Retail)

3DFx AGPVoodooRI MOO 16MB TVI'user(Rctcil)

A&dam/ECMCEA JCotwUSR V90 566 PCI FmModem (Oghfl

565 3Cem-USR V90 548 PCI (terr uacear) ymrceorw (Oml SSS 3Con USR V90 54k FCI (letc Savmere)Vdre Fssme4cw(Oral $99 3Com-USRPCMCIA 3CCM556 56K Modus (Rddt) $299 3Com-USRPCMCIA 3CCFEMJSIB 56K + 10/100 Len $443 Ao lan PCI / ISA Mk V90 Vous Fsx nakm(Retm D 545 / 19 XimcmCteditead (PCMCIA) 56K Modem(Rucil) $199 Xiaom RBElve6GRcclPod 56K+IOOMlsn Cerdbus(1)986)L $398

ASUS PJA(X) /PIAOSuper7, Xmn Xe 2(sound)ATX /AT 5142 / 132 / $135

ASUS P5.99VM Sis530 MicroATX Ulaa 66 ASUS PJS BSis530U66 MB w/AGPSoundAT ASUS P3811394 IEEE Link LayerCoatrogcrATX ASUS K7M Altboa AMDS(ottoaad /w/o sound

Creative AGP 3D Blotter GeFores Pro 31MB (Retail )

$142 $1$5 SZSS Q3802$

~s sStorag

Win!e Brmhw Lnw Ict HII030

iDE Drive

Bmdter loser1stHL1250DX 120Mpi 12ppm4MB EpsonDesk/d Stylus440 120dpi (WindowsOnly) EpsoaDesklct Stylus660/740 Color 1440 dpi EpsoeStylusPhoto 150 720x720 Epnu StylusON /900N

Mzxtor50373U30OGB /54098U40OGB2MB(7200) $ 3 28/409 Inltl Dnksmr JOOCR Ullm ATA (5400) I BMDcshsnrztLOGB/344GB Ultra ATA(72N ) Fujitsu MPC3043 4.3GB Ultra ATA (5410tPm) Fuji(su MPC30S48.4GB UltraATA(5400 rpm) GasntumFircbsgKA205GB/213GB(1200qm )

SM4 QN / 49 9 5145 $16$ 5 29S / 375 51388

SeagueST3182031W I SGBDure 2W((Chcdeh) Q38 SeegstcST 39103I.W 9GB Ultra-2W ((Cbamb) Q28 Stage(aST31$215LW I grin Ultra-2W (Bwrscuds) $648 ()ntum AltosV 91CB/Altos V 182GB U2W(72(gupm) $425/679 ()mhun AltosV 36.7GB(1200) 51338 QsntumAtlas IV 9 IGB / Altos IV 18 2GBU2W (10 0(ghpm)5540/940 IBM Ultmstar ASGBM5N 7200spat(special) $210 IBM Ultmslar 9 IGB 3913012Nrpm Q75

HP $100 /8100N 1200dpi24ppm16MB (llxl1) Lesmark EI I /231 /ZS I Inkjd 1200 dpi LexmsrkOp(re FJIO gppmPoxsnip( lcxmark Oplra MI(0 lzppm IMB USE(Paregal

Hp suresueectuwnter plus8200i IDE4R/4w/htw/sw

Visasccr 6(00 GNs1200dpi, 364dt (whlSQORebate)

Zip Drive 250MB Parallel, SCSI or USB (Retail)

Zip Disks IOOMBSingle Catridpc / 10 Pock Zip Disks230MB Single Gutridge / 3 Pock Jsz Drive2GBSCSI 1st. / Ext. (Ddver onCD) Iec Disks IGB /2GBCnuidge Gas(xeno 30CB lyigual Drive IDE/SCSI kut One(reamSOGBDigital Drive SCSI Int Oasucsm30GB /JOGB Digital Make

$3(B

• •

8 00 • •

•

$559 5NO

Vtun en 7600600x1200dpi. 36.bit Parsnet /USE

$313

ADIMicroScenG700/GT5611'.25mmNILR.

ADI MicroScaaG66 19" 25mmUSB LG 953E IS 600 x 12N.24mm LG795 17 6 00x 1280.24mm F etsctecn Mitsobivhi Diwnond Pm900u 19" .23mm Fletscrccn Miteubishi DiunondPro2(NOu21" 25mm Meg 976FD 11" Triniuen 1280x 1024.25mm RatScrcen Msg X/810 19" 16X x 1200.22mm Msg BNV 19" IIN e 1200.22mm NEC FE700 I'/ lmscrecn 1280 x 1024 25mm Samsungsyncmsua 750S11 .2S/150B17 .26 S amsung Synunuxer 700P+ 17' IIN x 1200.26 (special ) SamsungSyncmsster 1000P21" 1600 x 1200.25 SamcuegSyaemsster Dyasnst 753DF 17" 22mm SamsuagSysemssler Dyaanst TNNS 17" 25mm SamsaagSyacmnaw Dyesnet 900NS 19" Jemm SamsungLCD 530TFT 15 inchLCD Monitor

$448/$54S Sti68 $568

$499

958

$1745 $485 $589 5598 $425 $299/38S $4S S

$1488 $390 5469 $759 51680

3 Com Feu Etbcrhnk XL PCI 3C905C 10/IOOBT (Fcr Desktop) $7 $ 3ComFsu Fthcrunk XLPCI 3C9058 TX 10/IOOB T (For Desktop) 57$ 3Com Fat Etberliak PCI 3COSO TX IO/INST(par Scrvcr ) $17 8 D Liat DFE-530TX PCI Fest Ethernet 10/IOOMB IU45 $32 Intel Pro /\ 00+PILA$460 PCI 10/100MB R/45 (OEM) $78 Intel Pm /100+ PILA8470 PCI 10/IOOMBR/d5 Server 5145 Aopcn ISA / PCI I OBTsndBNC Network Card $28 AopenPCI 10/IOOBTNetwodt Card 532

$149/388 523$/586

SM8 5298 $N 5199

3 Com/Mcgsb«nzPCMCIA 3CXFE575CT 10/100 CardBu s $21 0 3Ccm/Megchenz PCMCIA 3CCFEM556B 10/IOOLsn+NiK Modem$445 D-Liak FCMCIA DEddOCT Ethand IOMBLan $99 D.linkPCMCIA DFEddOTX Sdlt & Bhwnd IOMBlea $299 Intel Proflpu Mobile PCMCIA MBLA32N I(UIOOMBLsn Cordaus5232 XttCom PCMCIA RE-IOBT ReelPou IOMB (Spensl) $119 X uCcm PCMCIA RE-IOOBTX RcelPort Cerdnus 10/IOOMB $22 5

3fuNmefi Speakers Cnativc Combrulgc FPSJSOO5 I Thcsmrspcotnm Ctntivc PCWas Fouqwint sunouadFPS2000 FPS1000 Altec leasingACS48 PowaCube w/Dolby S Sound

AineLousing ACS54 5Speakerw/Solnroofer Ause Learns ACS452 PowaCabeSysnmw/Suhwoofer

$358 $98/ IJS

Altce Leering ACS44PowaCube Syslwn w/Subwoo/cr

AltecLanai agACS33 /ACS93Spnkas System

SIN

Q9$ 5266/138

$189 $125 5109 $79

$76/49

nbcromctbaM.9$N Multimahe Subwoo/er System hecremedia MdIon Mvltimabs SubwoofcrSystem hecromtdis Md 100zwey Speaker Systant

5275 $14/ 135 $29/18 $4N /478 5129/135 M25/$444 $8981 $54/76

$19

$61

soundCard

Soundalaua PCI EnsoaiqAudio(OEM) SoundBluster PCI 128 br( PnP(OEM) SoundBlsstwPCI Live Value(OEM) ScendInes(a Uvc Pie(Num(Ramie Nee Aurcel Vonex2SupwqusdPCI W/I SpbsJXOut (OEM)

538 $5$ 578 SM7

$79

CD /DVD Drive

$118/248 Manse MifleaniumC400 16MB / G(00 32M Dual DisplO$199/218 MsuoxhBKmniumC400 MsxDuel Display 5334 ATI RageFacy Mss (RagePte 128) 6IMB «/e TV SN9 ATI RaaeFary Pre(RagePm 130) QMBw TV $220 ATI RageFary (RoseIzs) 32MB wTV $185

0 88

5149(249/379

Gnus AgfRA 20001'/MOOU I JOMpi w/Photo Ddase Umex ASTRA 2100U /2200U SinglePtess1200dpi USB Ag/aSnepscsn 1212 1200dpiFlatbed /USB Ag/s Sacpscen1236S 1200dPi)Tubed

McuoxMiaamiumG4N 16MB/32M(DEMI

ATI Xput Rage128AGP16MB(OEM) ATI Xput 98AGPOMB/ Xpen®Pier 98OMB

$19$/299 $3N 5558 /818 $14$ /279 Q79/4I5 5135 / 1295 5578 $998 $1 689 / $2198 5 224$ /53140 Q980 / $4390

Gpdquest()95 19 2Nx 1024 23mm (Heriwnusl) $515 ViewSeaicE171 17 /E'173,27mm $328/5425 Vtewsoais PF775 17" .Jsmm Peftc(Fkt (New) $498 Yicwsoak PP79019" 25mmPelrclPkt (New) $7(8 VicwSanicVPI SOIS inch LCD Monitor $1668 Sony MultiscsaCPD-I lOGS 15" 12$0 x 1024 25mm $345 S ony Multisam CPD 2IOGS 17 12N x 1024 .25mm (Duno) $3 90 Sony MuhiscsaCPD-210GS 17 12$0 x 1024 25mm $488 Sony MaldcceaCPD K200 17" 1600 • 120024mn Ozotscrcco $558 S ony Mullisam CPD E400 19" I(NO x12(N.25mn(in slack) $1$ 9 S onyMulligan CPD4)IN(9' 1800 x 144024mn(in stock) 5 8 35 Sony Mulascsa GDMF4N IO" 1600 x 1200.22mn(in sleek) $ 1545 Sony MuluscenGDM-F500 21" 1800 x 1440 22mm(instock) $2835 ADI MicroScenViewpoiat IS" .28mm NJ LR. $235

PCMCIA Cards

HP SureS(ore CD Wri n Plus$210e61V4WUSB .w/SW SNO HP SureStmeCD Wriuc Plus 9110i IDE OR/4W/ Ia(w/SW $399 HP SmeStore CD.Wdter Plas 9210SCSISIVIW ute/JW /Oct $399 / $545 Pkstor Wden FXdMZOTI20R/SXGX SCSI (Rema) $556 Pin(or wrilcr wNJTH 32IUQ(/4x IDE (Re(NB 54N Vamsha CRWN24S 24R/OX/IRW SCSI lat (Rota(B $425 Vsnshs CRW8424K24N&X/4RW IDE las (Becca) Q85 Muaemi 4804TBE24XIIXIX IDE iat (Ogltl) $179 Suey CRX120724X/4X/4X IDE Int.(OEM)w/ SoRwme Q79

Scay 104SIOi 32X/OX/4X IDE Int. (OEM) Zip 100MB ktemel IDE (OEM) / Parallel (Retail) Zip DriveJNMB IDE (OKIN)

$399 54S9 $559

si4s

HP DmkJcl OIOC/QOC Color HP DesbJetOIOC /89$C Cokr HP Desk/et 2000C /2000CN Pro/essioael HP laser/et 1100 600dpt Sppm2MB HP Laser/et 2100 INdpi lpppm4MB HP 4050 4MB /4050N 1200dpi 17ppm8MB HP 5090 IMB / 3000N 1200dpi 16ppmOMB(I lx I 7)

SCSI Drive SesgeteSTI 50176LW JOGBUhta-2W ((Cheetah)

Brother Laser Jet HL1240DX 600dpi 12ppmJMB '

Mssler 9NIIUJ R1CB/9IM9U 186GB Ulua 46 2MB 5159/SIN Master 9174IU 172GB /OZONU 20 ICE Ultra 66 JMB SJN /QIS Msxlor 93073U 30.0GB (3400 tPm) $308 Msxtor91366U 136GB2MB/ 9204$U 202GB(7200 ) $19 9/278

()pdq uest()71 17" 1280x1024.21m m

Creative 52X CD ROM

Cnativc PCDVD RAI(l 52GB 1st (Rdaa) ToshibsXM6502B 4$X EIDE Inl Pioaeer DVD IOXDVD(Brive Osly) / Got Load ToshibsMI302 DVD.SX IDE 1st.(Ddve Galy) ToshibsXM6402 40X CD ROMSCSI 1st. Plaster UlusplcsWide SCSI lnt. Extnnsl Casefer CDROM SCSI /IDE

$129 $$2/119

•

I I

•I'

•

5425

$96 Siysnm SISS SISS $1$9 $18/98

10 BaseT Hob Aopca 3Pen IOBT Hub $49 NetgereNE104 4Port I OMHub(Rasil) $58 NetgereFcl 04 4Port 10/IOOM+ JLm Kit (Relail) $(38 D liekDENOSTP5Port /DE 809TCot BNTCOPort Hub $68/78 D-Lick DE.$12TP 12Pmt / DE416TP 16 Port Hub $198/238 Intel IneusinessHub SHIOTS5-Pod / SH IOTS 8.Port 5 72/ $258

1(X)MB or (0/100 MB Dual Speed Hub 3ComO&iccConacmTP4003CI6723 4Pon IOOBese TX 3Com (uliceCcanen TPNO3CI6122 OPou100asse-TX 3ComOEiccConncat TPI 200 3CI6721 12Port lupnsse TX 3ComSupnstcck n 3C166 10Duel SpccdHub 500 12Peu 3ComSupaSmck K 3C16611 Duel Spaxl Hub 500 24 Pon D.l.ialt DSH-5 5 PonHub10/IOOMB Deal Speed D.Link DSHII 8 Port Hub10/IOOMB Dual Speed D.Liak DSH-16 16Pen Hub 10/IOOMBDod Speed liakSys EthcrFest10/IOOMBAuto Sensing 5Pon Hub

~ A d t ers

AdeP(ecPCI2930UW(Rdail)

$15$ $239 $404 5935 $1310 5158 5235 $306 $145

5 165 AdsptccPCI 2940 U2-W (OEM) $3 IS AdcptccPCI 3940 Duel SCSI-n 5CALL AdsptccPCI ARO-1130/ $410 AdeptceSlimSCSI ANA (480 16bit PCMCIA to Fut SCSI-H $245 TckRua PCI 310 Ulna SCSI Cnd $64 TekacmPCI 390FGibe Wide/390U2W Ultm 2Wide $14$/216

•I I

•

AND Ke/K1 Systems AMD K68/IB 400/450/500/550/600 CPU AsusPS/VK7MMotherboard 64MBPC100SDRAM Fujitsu 13GBUDMAHard Drive

3090-8888 Odiin Crescent,Richmond B.C.V6X 318

ATI Rage03D Acceloiatgd AGPVideo. BMB

56K V90Int Voice FaxModem Panasonic 1.44 MBFloppy Drue Windows 90Keyboard

MON-SAT'10:00-6:00

17" Nl SVGAColor Monitor, 27mm

16" TowerCasew/ CSAApproved P/5 Acer 40Xfnt CDROMDrwe 16bit 30 StereoSound Card S1349 12OWAmpii6ed Stereo Speakers KTON Microsoft Trekker24)noon Mouse SS$15 ' SSSB $94S Kmivaoo $1199 KWWOO

KP 888

Intel 1SSMHz Bus

Perfermance Systems IntelPol533/600/667/733 MHz CPU 64MBPC133SDRAM Fujitsu 13GBUDNIA(7200rpm) HD 53Savage4 30 Accelerated Video,16I NB 56KV90 Int Voi ce Fax Modem Panasonic 1.44 MBRoppy Drive $1525 Window 98Keyboard 17"Nl SVGA1280x1024 Monitor, .25mm

16" ATXTower Casew/230W P/5 AcerBOXUDMACDROM Drive 168it 3DStereo SoundCard $ 'SSSS 12OWAmplilied Speakers Microsoft Trekker 2-button Mouse $ 1159 . $13 5 9 . Piii 608

Pili 936

Intel Pentium III Business Systems PRI500/533/550/600/650MHz CPU AsusPSBF440BXChipset Motherboard 64 MBPCIOOSDRAM Memory Fujilsu DGBUDMAHard Drive S u 99 RiveTNT23DAGPVideo, 32MB ViewsonicE77117" Color Monitor 27mm Panasonic 1.44 MBRoppy Drive Windows 08Keyboard $1499

16" 250W Deluxe Tower Case PniOoe

Acer 40XUDMACDROMDrive Sound BlasterPCI128Sound Card LSOW Amplilied Speakers Miuosaft Trekker2-button Mouse $ 1399 SS4 1 9 S1 4 2 S Pili 888

pin 888

Piu ON

a •

Intel Pentium nl Deluxe Systems IntelPgl500/533/550/600/650 MHz CPU AsusP3C2000i820 Chipset Motherboard 128 MBPC100 SDRAIN Memory Fujgsu20GBUDMA Hard Dnve $1549d All Expert 2000AGP1/ideo, 32MBNil ~l PanasonicTA4 MBFloppy Drive Fujitsu 0725WindowsKeyboard 16" OO line Tower Case,Logged) Whod Maine

CreaBve52XInt CDROI)it Drive Sound Blaster UveValue SoundCard Delux eSpeakersW /Subwoofer

$1449

S1349 SSS69 pni ON

• Iil ON

pv »sm $1519 Pili 580

ops onsi o 544uung 700TFT,.20 S459 o' Vmwvohc E77l .27 QN 19' Viowiowic P5798.25 5695

• • 4

550 Ij/IHz SystemIpoOII[l

Intel 440Chipset AGPM/8

Intel Pentium III SSO MHECPU m200 Intel 44OBXChipset AGPM/8 ~g~ 64 MBPCloo 5DRAM

64MB PCIOOSDRAM

$599

Fujitsu 6AGBUDINA Hard Drive DiamondSpeedstar AGPVideo, BMB Panasonic 1.44MBFloppy Drive 107KeyWindows 08 Keyboard

Intel Celeron500 jNINIS stem Intel 44OChipset AGPINotherboard.

intel Pentium III

QyecElm ll

2OGBUDMAHard Drive

32MB PCIOOSDRAM, IA4MB Floppy Fufdsu6.4GBUOMAHard Drive lntei 810 3DAccelerated AGPVideo, 4MB

10/IOONetwork interface Card

5wavSPe56K tnt VoiceFaxModem V.BO

53 SavageaSDAccelerated Video, 161)IB Panasoni c L44INB Floppy Dri ve Samsung 17"75Qs1280x1024 Monitor,.27inm Windows SB Keyboard 14" ATXTower Casew/23OWP/S 17" Nl SVGA1280x1024 Monitor, 25mm Acer 4OXUDMACDROM Drive 14' ATXCSAApproved P/5Tower Case 168it SDStereo Sound Card 56K Int. VoiceFaxModem V.BO Acer4OX UOMA CDROM Drwe 12OWAmplified Speakers 168it 30 StereoSoundCard/ 12OWSpeakers INicrosoft Trekker 2-button INouse

8 Lotus SmartSuite 2000 + $29 g MSWindows98 +$135 MS WorkSuite 2000 +$129

32X Int. CDROMDrive 16-bit 3DStdreo Sound Card Speakers,2-Button Mouse 5 Video Output, Keyboard 2USBPort ' ~399 Mini TowerCase(12"xll "x3.5 j '

Microsoh Trekker 2-button Mouse 8 56K V.90Int.VoiceFaxMori om + Q9 I 64MB upgradeto 128INB +585 mm17"Yiewsonic DTI, 27mm + Q9

COMsc905 NOIIIC . , $69 "mu6.4GBUDMAHviri Dmi».: .: . „7 : :SUO ' viiivulOGUDMAHiidoilvv , i 2 ,' , Q I S BM2oc{7Moipm) Hard ' ., :Qss '

. '

Monitor Pimrivw IT"/l9" 5269 /439 AmvrivwAevtr)vv/Cms)m/279/799 S vwmmg Il TNIFT28 $4 63 $533 piiquvviQss VwwmnicCtii QOS VwwsanicE773/PETIT QBO/4N VivwvanicPST?5 $479 Viev wonicE798/Py)98 $495/649 Pavivm SETS/SNS SSOS/WS sonyGTN/G488 . 5475/835 Sony E406 i;:;,-.;, $735 NECA570/FE78 0 Q2$ /399

Scanner

MACColor nvi Beri Cieaw638U Avw 328U/62OU HP 33NC HP 6300U HP OQOC/639OC

$83 Q65 SIIS/69 $175 3323

$645/nvs

tlpcvnde epeansl 64M8-IXBMB +$79 QTM I3G72Ni am +QO NECFETN 17' +$N QTNI 2OGHard Orivv +QS

•

Celeron 466 System

SUN DAY CLOSED

Ivtt) Printer

Hard DrlVe

- Ba cltu et/ice Arvr QGUCirior Scanner<ARwsvvRebate). gw'%5

Q39 Mwriwi 6.4/8,4GB si39/745 Aiwi 8432Coevwritw nuvlor )3.6/)74GB $1Ã / 285 smiy8432Cori ivwri u v 5345 QTS M@rioi28.)9228GB $ 2)9/323 HP siioi CD4uvwilv r QuantumTOGO5460vpm Q 25 ybmvha8424IDECOnmwilw Q75 CDRMedia IOPK SM.OO Qvwnvm13/2OGB720iiym$229/273 I BM7248rpm 2OG B $25 3 2)P Drive IN/25OMBIALIDE579/)43 IBM 4$CBU2W$G I $249 ZIPOmv234us ec wrihl/ICSI 5259 I BIN9.0/18GBU2W5Csl $409/545 ZIP DivblOOMB sw niihiv 6.4/IOGB $739 /)39 Pwmvmri<Lsilo QIMB Dmv 599 nriam )3/28GB SQ9/ 213 Ls)28 Dhb $15 ' Q85 Puiiivv 27CB72NvPm $Q5 HP Svvmlvm 14GEAL svvgvi vcbvvve vlw scsiv.iG 5739 HP sbievibib 5GIALTaye DriVe.$239 smgviv owvwbUlw scil 'iiQG$)499 S ony24CEALDAT . $)2 6 9 svbgnv OwmmrivUlw scsi 9.1G$459 Svvgvi e ~ um scn mlcSIIN QvbmumAilw Wiilw SCSI 9.1G Q99 NetBI/ork Quvmummhi N UlW SCSI i426$849 3COM3C985 IO/IOONK $N Inlvl IO/IOONIC $N Aevi IOBTNIC $79 O.UARIO/IOONK Qs

g Modem

USR34KV34IVLPCI (Wiv)

$69

USR56KV98Inc KI Oiviriwvie)$95 USR36KVN IAL ISA(nvidvmv) ' $)OS 56KPci Vaivv/rm V98 $29 Aevi 56KVO OPCI INT. Voice/FaxQ9 DiamondSupra 36K IALVoice $$9

Bwrihw HL'ileri)X

$N9 $645 Bm gvwHL)25ODX Wmhw MFC<33O MC Q49 BrmherMFC-7)58C 5929 CvwvwBIC ION/2OOOSE $65'/IN sllg CanonBJCSIOO. QW' Cwmv BIC6IN Epiaesiyiui448/668 SIIS'/I IOv EPion si)hw 758 Qss HP 6)OCColor $)45 HPOIOC Ccr ivv 5229 HPOBO CCvrivr Q95 HP QXO CN 5669 HP Ibvain IIOO/IINA QN/72$ HP Lvmrin 2IN $)828 $)425 HP Lvieiivi 2)OO TN HP Lvvviiei 485ON QO99 $8S" Lmmlih Zi I $)23' Lcvvmh 3288 $245 LmmaihTsi Cvbi ~AberRviwiv

'IBMOGuzwscst Hviri Dmv Aavszou CuwSr I $2 4)whmj.'.:.$93

Ijjiultimedia Aevi Nx CD-RamDrive $55 Arvi QX CD4IOMOmv sm Crevbvv 32XCD4IOM Driv $69 Ctvilivv OVD6X Driv e $M9 Creagw Eniwv OVD6XKIT $Q S Tovhi hbDVD OX Dri v Q43 P ioneerDVDIOXOm w 5)6 5 Tvri vtm Dvo.3Krf . Q69 $8 CmnpbblrieSound Card. . $7 9 $8 128PCISOund Car d $49 SoundBlbiiw live Value $79 044rivv Vcwvrivbvr iic w/vvvfvi$189 Alle rAcs452 spK w/svbwoiivr5N yvmvhaMzg w/svbwaoivv $128 GNTSNOA$PK w/Subwbvfvr 558 Pair of 12OW Spvbkwv $12

Video Card ATI xpvti vv(OK)/iviviB AGP$N/89 A TIXPvii )28l16) AGP : si 25 A ll XPvii 2489, sling $74 3 Annvgv Fury3 2MAGP Q O S ATIASbvwvvrivr QB, INIB Q23 ATI ~

)28 AGP, 32MO Q23

ATIROgefwy Mac OIMB ... Qss ' $789 CwwbveRivi TNT 16M Cvvb)bm GeymceAGP,32INB Q73 3Db Voodoo3NO IRviwl) $199 LEADTEKCiyviieAGP,32MB QOS MabmCINO/HMNIB', - Qss

VivwvwrivET/i )7 SVGAMonitor.27. g' Q O S . Q85 Sbmwm g7385n" M onaor.27 36KVBObvc.yvice Pei Mvriav . '. Q9 U5RSsx VN )PLPO Vaivv Fax Mvri viw $39 :Alibi LbimngACS432 $89 Pioneer)ox ovo Rolu orivv 5165 Lvvmwb zll colm priiiivv (AbvissvRvbbw) $83 lcmmvb3280 In printer IAllvi $54Rvbviv) $123 Epvmv668 Calvr Priv)O(Aaw374Rvbriv) si)9 Mvlvvv Millwmvm G488AGP32M B Q39 CieabveAnxihilbior Pro Video 32M B QTS Brother )238 DXlaser $545 Brogiw Q48 DXlaser, 12ppm 5449 Brvihw ')278Nlaser, )2ppm Q33

Notebook ISN IN28C437/328VIOC/242/36K/ll.lTET .4 2,NO i)421 C466/32M/6.OG /24X/SIK/lsHP/b 32~ II540C433/64M/4.8C/242/36K/)2.1TET. $2449 398XCIN/64M/48G/24X/SIK/IZI TET 398x plllsN/648y)2.8G/24x/ssx/isTIT.M658 INX PIII658/64M/QG/Dvo/SOK/133TP145,938

Tesbiba 26ioDvDc433/64/I/Dvo/sslvlz.)TIT„'

s2,'Iss

44OOCD5C366/64/43/24X/SIK/)33O$%,Q449 426ON)VDPI9438/64/Iz/DVD/3NV)41WTQ338 4278XDVDCsm/64/I/DVD/36K/)4.ITPT 44,193 OINDvoPul650/128/IB/Dvo/$6K/)4!TTT$3,493 s)TIEPION)/6ee/&IG/24X/suu)salyf ~ 386OXC435/32W466/24)vsm/12 THPA L SI,NI S)4TXVC466/64AVOC/DVD/INVPLIWT Qsm 7l31XVPilisnv6449QIM/56IVPLITRQ,sss

Pidnue Es)NC433/64M/64C/242/ssg/I33TTT .W 499 E6QO PIIBN/Q8lg)OC/DVD/56K/OL)TTT$4495

Meth egtsoard ASUSPIA/PSAB

AsusNB-r ASU5P284/PTBO

AsusP28-5/P284$ Agfr BH6/BE6u

$)25/IIO

sfi9

$735/383 $448/SIS $739/283

IIPgrade SPedals Intel 440Chipsot Mog)ciamrd 32MBPC)DOSDRAM• 14"Alx Tower Case 3O AGP VideoCard,4MB intel Celoron400/433 ...... 3295/309 Intel Coloron466/500 ........5329/365

Limited quowthy. prices are cash discounted and subiou io change without woucmcall for the current prices.

HOIISlON TE HNOI.OGI S

,'c.. w

ggQ ~g r

lbe abaaccdBeans of gwPCI33 VIA Ayogo ym systna Baenl iaeluds Sapyon 3450-750ahb ~ 50t b750abr, PH 233450mbzh Criemn2dd-533mhz CPUSwhb ~ at N /IOWI33ada ia skt II nnhet 370for Brirf Al' Fam Driar Pnnddcs3x Dudbk gn PC133SDRAM memorymodahnsadceynukbk up lo768nda 3s PCLla ISA nri is AGP 3D PCISoaadPmm hoed, measPC!ig Sysc„HRTFPwhiaael Audin •ayporleMS. Dhori Seaad 3D sadhonnl'e A3Doampsgbk hnwbonw/4 charnel syeskr am

acr

Intri H/d AGPch)eer

Cslncn 266-50$MHz 4 66/100Mtk Maohl Fanaa Sspportbath Slot I sadSorirst 370 Praccsum fer Ikxklc CPUselsakn Pmvihn 2xDB6Msfer SDRAM memory,upto 512MB

AudiompyonsMSDiect 3D cadAacal'c A3D heafan, w/4 Dighrihabohmrkes (SPDH) BOUUT mlh24MI Saeo, BundledGaamthnkdcsMpl Sncodcri Dccahu

beri gio rimwLlbamm vsse Idcmrsy ~

r sc

OgQiQ --.====

, cput

aadVoicespplicatioa; McdisRiegTali for lataau PhoaeCamaamicaims B/I OSrrt 10 Br/re Til N Bsm TX LAN • ndANSI X3212TP-PMDsaarisnk

(~(r gJ( Lm Q~Ã [QQ pavidmATX yawercoeoscm apyora vaian faecSan sf ATX power • ab asSuspcad, ghatdoam Wagem LAN, Wabcm modem.Wahcaa &tenn, imarayt Wshcap &amlaybmny amass, eal KeybaeniPowxOaOFP SaNuaa PC98Cekr aaecaw for seep ~ ofp aiykml dcriecx PmvidceTmri 3&ao 'e Ckyhwaf Vhm ari OCigiam (Ogld) fer Wiadnsrc 9548 aul lrnwaa earn ttatariao

Mricehmndm/5N/INBN/ONISBOubkn). ~ /2 70/INBSOHIO haslPcabmSl650/NOHHL — S htg/SIS hdelPsnlhmSINO//NHHS ~ ISIS

ItkslCriam 4NIROIINBN BOHBR(nb ha). ~ /2 10/ANNO/4N lsklpmgua51550IONHHr .A438518 M riyergtmBSNI887//KRISS . .~ IHB /880 I/4slPagan OINO//N GN BOONIS = - - — 5$IS gltIION 0 IIHD

Ifaedwaunriihaaseraf ric PC/35GFXuri symar hsanf ierinfnrr

4 Fhn A FXwhhfmri H IF&C00rrapcrtyuri

Supyonyb450- 750mia, ~

soviet 370supponsmsfollowing pmcecsas: Cckma PPGAeries pnwaner

500- '/50mbr, PB 233450mla

h Cclaea 266-533mh z CPUSwhbScgamcf at 66/IGVNlada k sha II sochct 370 fre BabyAT Fam Scan Pmvhks 2xDlbms kr FCI33 SDRAM mcmay modalsseel cxyaakhls up lo IGB 2 x PCI, sadynwidcsash-DB&d ria, supyonsde DhplsyCachecad ortheVuko Ihirhtceddoncnri far NtSC/PAL TV auput, Dighal LCDmagor w Sccoadwf

CRTMcnhw(cpgoasl) Iggh yrfamssm l lech 3DAGPGaphiu Accriaaw wnh 64mb(mss) fame bumr aabeddcdia Natb Bridge, apm 1920x 1200. ION mmhnirmAGP Rcv.2& Spec. 3DPC ISoariymtabead,naca PC98 Spec HRTFyurigam Aabo suypalsMS-DhwaSooad 3D endAareal'c A3D ccmpagm iaaece, w/4 chsaacl cpahcr aa; eelhaa Wwosabk ~ end Dbplal AaSo intafisee(SDHF) la/OUT whh 2446L 10/loNBA FastSmarm LANm beeuLeappons15558023 aad 8023u naaknk, ari fidly amygsmANSI x3263 lp-PMD pbfaal sablayer 56K Fes/Mcdm ca beachsapyaa 05mFss/ Modes asaknl fnr

Next Gcncnuien ofPPGACPU - FC-POA proccarm Pmvidss2 xDIMMSkr PC133 SDRAM mcmwymodrissead csyeakblc upto312nda lx PCI slots, TV an/LCD Pawl Unh Riser Inal C2810 4 S2NIAA ehipsa- GmphicsCcatmuer HUB(GMCHEL

5QG (KliUQ )KKQ(

VO ~ Hee GCHI A 6mnvac HUB(FWHI withfallowing Bstmcs: ktognecdDepkc awuelkr with 4MB displsf Cscbc. 3D Pcl scuadPmoa bosnLmws Pc98 spcs.. HRIF ce'nienal Aago suppretsMS- Dinct Souad3D sadAumsf sA3D coeeraibk ktabcc, w/ 4 chsllocl spcsicr old; solhvclc Wave.tclllc ~

eod Digital Audioincr&os (SDPB) ki OUT with24.bit, 48KHz sanple atc eed mamecd 128dvsudioqesitf ICINet DM9102LAN cbipsetauhecnL crgoem IRSN023 md N23a saaknk, md Ibgyaanpban ANOIril263 Tp-pMD phyacal sub.layer 4MB FinnwaeHubm head, pnwida complea Advance~

Pasar iauaDce(ACPDaal lzgao PMU; hgy oamPSan whbPC97and PC98Sacs. 56K Fsx/Modes cabeanL suypaa b.90psx/Modem nsadad ferIataacc

liriB HcsbROM ca bead, pnwiks vampire hdvcosnlCcn6meerim Pswsrhanfeco(&CPUari Legacy PMU, Uka DMA 66, idly ~ whb PC97 h PC98 Spec. Pnwida ATX powercoancaw supyonsvarious fiacfims ofATX yowcr suchcoSusyeaL ~ Wale m LAN, Walrsmmodan, Weheca Aboa, aanept Wageupeem IwfboanVmans. andKayboad Poweros/OFP. SepyonsPC98Cokr aaoenw far easy ~ ofya iphaal dcviccx Pmvida Tang h&ao.'s QdpAwayVina sad PCCiSls98 (OBM ) fcr Wmdwa 95/N ari Iacma vins prouxrirm

2MB FleshROM ca bead, pmvidceceaylao Advsaccd~

poaw hm rbee (ACpi) ari Iagacy pMU, lunaDMA66. &rgycampliaa web PC97 sal PC98Spec.

PmridesATX yowcrconacaw mpponovsrioaa Sac&a ofhTX power •ucbssSaspcerh Shadewm Wale m LAN, Warm modem,Wahe m Akaa, isumuptweheup eaa haybosnv mmss, sadKcybanl power OeIUFF

lrielCehmneNMIB33I5N/60NHt(n/oint) S I N /2NI360HIO/40 IntelPenhmgl5NIINHHa. .. . . ........-.WS/538 I rialPwdkml6633/BGilgHS B ~ I/30/N O InklPsrdumB8N/INI/N/NHNL.- . — . AI OSI$38/ION/ISN

ytovid m llendh&ao'cQdyAwsy Vhes aal PCCggam (ORM )fsr Wiahws 951Neadhmmctvinaptetmthm Mslcahmndm/5N/533I5N/SNNR(n/ohn) .~ BIO/SIOHSO/450 kmpanbmHNOIONHHS . M 7 0ifiN I risl Parian SINS INT I73BNI= — ~ GN II BO BMPmmmglNOGN//60/NNHI =~ BN /IO N/1320

'ie~' 1®888+221+0644 I WWW.HOUSTONTECHNOLOGYnCOIN m

M M

based on suggested releg pridng, endyour deal dealer mey change prlceg wghoutnogce. AS pining tt bgreboeni or bundled wigt proceeoor only, &nd does not Include coogn deutceS. Hf

PIHluttnl III

a OOF-CON

Dlglfnl devises 90 nu nniursl Continuedfram page23

training as to what those numbers mean."

Shopping Spat going to happen in the future. The majority Whenbuyiog a weather monitor, lookfor: will sense a trend in changesover a certain • ease ofuse. • enough memory to anafymsugcfent datafor a reliperiod —six to 24 hours depending on the modd — by storing the information and anaable paltern. lyzing it. The Suunto Vector, for example. will record what's happened over the previous few hours and display it on a graph. But it is up to you to interpnt it. Having a weather monitor doesn't instantly make you a meteorologist. You should have some education and

• BccurBcy.

Digital rangefinder Price range:$400-$5.000 Useful for: hiking, mountaineering, god.sunrsying,

foresuy.hunting.

HONE +

As the name suggests, you point these devic«s it is. at an object and they tell you how

ba«k to the source the way laser does.

The mostconunon models,and most likely to be of use tooutdoorsytypes, uselaser light to

whetherlaser or ultrasonic, have a shorter

faraw ay

determine distance. The most immediate limitation, of course, is that a clear line of sight to the target is required. Professionals might use the alternative ultrasonic impulse technology becauseitcan penetrate dense vegetation.The problem with the latter, however. is that it requires a transponder (receiving unit) to give a reading becausesound waves do not bounce

Paradoxic ally, some higher-end models, range than cheaper examples. One $5,0M semi-professional example has a maximum range under ideal conditions of about 500 m

(545 yd.), whde a much cheaper, consumeroriented model reads up to l,000 m (1,090 yd.). The difference is accuracy. The professional model will calculate distance to within 3 cm (1.17 in.), but the cheaper machine can be

off by I m (39.36 in.). One of the more prominent limitations of range6ndersin general is that they are most

accurate when taking a levd reading. Taking measurements up or down hill renders them ineffectiv within limits speciged for each spe-

cific model. Other variables of these devices include format (the consumer models tend to look like binoculars while the higher-end units are look

more like scopes), size, weight. day/night usability, and, as always, battery life. What Rolf says: "If you' re shooting on a slope you' re going to get the distance along that slope, not the horizontal distancealthough the higher-end modds allow you to adjust for slope. Also, with the laser type, you haveto have a 6rm surface to shoot to.It'svery inefFective to shoot at dirt, or turf because these types of materials just absorb the laser instead of reflecting it. Trees are very effective targets, as are buildings, cars, rocks, and things of that nature. Also, the doser to a 90-degree angle you are to the target, the more accurate your rcargng will be."

Shopping Spat Whenbuyinga rangegnder, look for: + Bccuracfs • wealherproogng,

• smgeWlerernm orcomhensauon. m

rm Nighivlelnn ghtsses Pucemnge:$500-$4,000 Useful for:mwle bugsalreadyImowwhat nlghhlslml glassesare for—spying andsniping. Wildlife typesuso glml lo obsennalgmbolmsloulu ol Bahlnls. Nightvision glassescan bc had in the form of binoculars orscopesand come in twodifferent Bavourminfrared (which reeds ambient heat), and the kind we' re more used to seeing in thc

movies,which magnify ambient light andyield a monochrome image The ability of these lat•

I I

•

ter devices isquite remarkable as it is possible

•

to see quite dearly even in the darkest conditions —a la Silenceof theLambs.Cheaper rnodels tend to generate image distortion, while the higher priced units offer crystal dear images. W hat Rolfonym "You can't use these for hunting because it's illegal to hunt at night. But researchytypesdegnitely have a use forthem."

•

Shopping tips:

When buyingnightdsion glasses, look lor:

• a feaWre set tosuit yourbudget andapplication. I

I •

Ampgged listening deviues Pucerange:$250 $400 Useful lor:Whoknows? Hunung maybe(with gunor

I I

cenlela ) oz Perhaps, smrch Boll IBscUB. Sort of a cross between a hearing aid and the

Bionic Woman, thesedevicesare worn like the former to give you the audio sensitivity of the latter. The most sensitive models can amplify ambient sound up to six times, which could be usefulfor locating gem* The bauer examples a

I I a

•

: I I

I s

•I

'$$

•

will have the ability to adjust frequency response to reduce the amount of annoying "white noise." Some models have a dampener to block the ampligcation of sudden noises Continued on page 44

Store Hours: M r F 10am-8pm Sat:

10amr 5

VNSI

12 y

410 Willingdon Avenue

Phone: (604) 291-1558

Burnaby, BC V5C 5G4 http:Ilwww.phase-1.corn

Fax: (604) 296-5126 Email: info@phase-1.corn

Total Commitment Program t ag', Personalized Technical Support To Top Quality O Commitment And Service. Components And Configurations.

In telligent,Affordable Network

ed@ Ask About Our Five Star O

Yo ur Satisfaction Is Guaranteed I:With Our EXCLUSIVE 30-day

"NOPENALTY" UpgradeProgram.

Ask your Sales Rep for details.

and Internet Solutions.

5-Y ear Canada-WideWarranty (5-year labour l 3-year parts)

Horizon Systems include Five-Year Labour/Orree-Year Parts Canada-Wide Warranty. •

•

Hori zonS stems S rin 3

•

i als

• •

•

• •

Inlel Celeron 433MHz DFI CB60-V3 Via AGP MB 32MB SDRAM Memory Fujitsu 6.4GB Hard Drive Sony 48x IDE CD-ROM S3 Trio 8MB AGP Video 56k v.90 PCI Voice Modem A-Open 16-bit 3D Sound 60-Watt Stereo Speakers 16 Mid-Tower 200w Case Fujitsu 8725 PS/2 Keyboard A-Open PS/2 Mouse w/Pad MS Windows '98 SE CD 15 s TTX 1556 .28 Monitor

Intel Celeron 466MHz DFI CB60-V3 AGP ATX MB 64MB SDRAM Memory Fujitsu 8.4GB Hard Drive Sony 48x IDE CD-ROM Tl Xper(98 8MB AGP Video 56k v.90 PCI Voice Modem Sound Blaster PCI-128 60-Watt Stereo Speakers 16" Mid-Tower 200w Case Fujitsu 8725 PS/2 Keyboard A-Open PS/2 Mouse w/Pad MS Windows '98 SE CD 15 TTX 1556.28 Monitor

Intel Pentium III 500E ASUS P3BF1 )440BX AGP 64MB SDRAM Memory Fujitsu 10.2GB Hard Drive Sony 48x IDE CD-ROM ATI Xpert '98 8MB AGP 56k v.90 PCI Voice Modem Sound Blaster Uve! Value 60-Watt Stereo Speakers 19" Mid-Tower ATX Case Fujitsu 8725 PS/2 Keyboard A-Open PS/2 Mouse w/Pad MS Windows '98 SE CD 15 TTX 1556 .28 Monitor

AMD Atblon K7 5 Hz Gigabyte 71X Mainboard 64MB SDRAM SDRAM Fujitsu 13.6GB Hard Drive Sony 48x IDE CD-ROM ATI 128 Xpeft '99 8MB AGP 56k V.90 PCI Voice Modem Sound Blaster Live! Value 60-Watt Stereo Speakers 19 Mid-Tower ATX Case Fujitsu 8725 PS/2 Keyboard A-Open PS/2 Mouse w/Pad MS Windows '98 SE CD 15" TTX 1556 .28 Monitor

'$$130$ =:. @$1840 =-.

01290=,.

•

Intel Pentium III 600MHz ASUS P3BF1 i440BX AGP 128MB SDRAM Memory Fujitsu 17,0GB Hard Drive

Panasonic sx DVD-ROM Voodoo3 2000 16MB AGP 56k V.90 PCI Voice Modem Sound Blaster Live! Value restive FPS1000 Speakers 19 Mid-Tower ATX Case Fujitsu 8725 PS/2 Keyboard MicrosoR PS/2 IntelliMouse MS Windows '98 SE CD 15" TTX 1556 .28 Monitor

g1849 =:. =-","$2440 td)

P C I SS uamcty: Ize

Iniaf Csfcfcn SSSWHt CPU: ISS

Peasvm ui Szeuns CPul 8128

All Horizon S stems areISO-9002/72K/GEMS/CSA Cert//fed. Governmentand Co 4

and

ksaaawlmallaraaadsn w al 2%anlbearsaaaa ill a w dw s l w rescD heaam slmlar slawr fw us w aw ami m cD sfb i aaasealhea masas saaaha fhtwclear rwaa sin ar e asdaaaadam sls « d a r laa cue hhlim

Su er

Acdffe Msblx Display

iijlulthmedka y h With Alonhtor- 4 ,

hhow Only$f

~ir9il, or just 646/month OAC

Intel Celeron 466MHz CPU w/Cooler 1A4MB 3.5a Floppy Disk Drive 128k Cache Memory Integrated 10/100Mpbs 16etwork 64MB PC100 SDRAM Memory 15" Micro-ATX 150 Watt Case Fujitsu 8.4GB Hard Drive Win98 1074fey PS/2 Keyboard 48x Max IDE CD-ROM Drive Win98 24)uaon PS/2Mouse

Outboard 644)it AGP 2.0 Video M i crosoft Windows '98 CD4TOM lup to 8MB shared memory) 15a TTX1556 28 1024x768 Monitor Dri v er Disks/Manuals/User Guides Software Bundle including: Wordperfect Suite 8, PC&glin, MediaRing Talk, Super-Voice, Gamut, AMI Desktop Manager.

Stereo Computer Speakers Ports: Parallel, Serial, Keyboard, 2xUSB, Monitor,

Mousea Game. ~

One-Year Partsa Labour Warranty.

Sf mscfcne SsffcrSushsss Thfcfish Tfw sssaf scs svmsv Rss. Numbsf 12423

pffambs ssaac as Dstiaas lit casts cfalflslcl sasx CDIIL

Ass zsh for psisms Dsfsm cr usataamaL press ba aihlad fa Chiesasweat nasa

Member ~ Since

19M

Act/ veMsnbf Display

164xI 3D Stereo Sound tiel 164NI 3D Stereo Sound

Com letel confi uredwith the followln features

Integrated 56k v.90 Modem Integrated 164)it 3D Sound

SM A R T BOOK3100C 14.1s TFTsvGA ( d m us

Intel Ceferon 433IIHz Intel Celeton 433IDIz 32MB SDRAIN128k Cecie 64 M B SDRAhv128k Cache 4.2GB Hard Disk Drive ~ 43 GB Hsnl Disk Drive mTj 4MB S3 AGP Video ~~ SMB ATI 2xAGP Video b' 24x Teec CD-ROM Dfkfe Vr 6x DVD4IOM Drive 56k PCMCIA Modem fte se56k PCMCIA Modem

I ntel Celero S stem. .

BB pj

flee wfm mc trcrthct rafa behsmm newer mid prtse. Vhfs has always been ecr peficy aad ahrays wfff be.

SMARTBOOK 5100C 12.1" TFT svGA

eciai-

rate bid s am welcome.

at phase t s y s tems. we'I e a m m i tted rs hetpfao yare dcsSsa the trsrtcct sys hah by ffctmaflls le yaralr needs aad plerhnao

As pri cas • Ressst2.eÃ, Yll cash ohseunt ~

faalchlscshaa sa aaiiachss esf alaipsv. s h aadss is Dssss aa iaaaahlaw baf sahiact ts aast sfs kcrfs Oasesa ~ eu ap ply ls Sasaaae accfaaas

TouchPad Device at e Windows '98 SE CD-ROIN U-km (-3houf) S-Bsiimy USB/S-Video Oui

$$379 14.1" TFT XGA Active Matrix Display A

Touc hPed Device Wi ndows '98 SE CD-ROM Uih ium-ion (-3hf) SBesefy USB/S Video Oui

jan+ $ 3O99""

frifsrh .

Ne o n.

15.1s TFT XGA 15.1a TFT XGA cih fe Msnrx Display A cl hre Msuix Display

Intel Penuum SI 550MH z Inte l Celeton433IIhz Pent ium S 408MHz CPU 64MB SDRAM/512k Cache 64 MB SDRAM/512k Cache 64MB SDRAIW512kcsche 6.4GB Hard Disk Driv ~~ 6 4G B Herl Disk Driv e 6.4 GB Hard Disk Drive ATI 8MB 2xAGP Video All 8MB 28AGP Video ATI 8MB 2xAGP Video 6x DVD4IOM Drive ~ 24x Teec CD-ROM Drive 24 x Teec CO4IOM Omfe 56k v.90 Iniemel Mode m 56k v.90 PCMCIA Modem 5 6 k v.90 PCMCIA Modem 164rif 3D SI8feo Soundsty i 16-Oil 3D Stereo Sound prrk 164fri 3D SI8feo Sound TouchPsdD TouchPed Device t7 Tou chPed Device ( Windows 98 SE CD-ROM Windows '98 SE Cth nokmwrs Vindows '98 SE CD-ROM Liihium-lon (-3hf) Belief/ Lii hium-km (-3hf) Beumy L i thium-lon (-3hf) Beuefy S-Video Oui, USB Port

83540=": 83499="L3r0."0= ,

CaN us ky detailed in/ofmsiionSnd custom conzsum5anson SNSmsrtbook Notebooks

pentlumn lll

RMUM7 KIRIL '7

usnmwnnsnnnnems smm

IUISCasrsts mreossassrOSEBSSh • HQ Styyt¹d Iy'¹ma0r Hidas HerdIhtw

ttdSStlfuestaouprcoss sarO SEESh

sxstsytsIHHI

~aMI

ATE ¹S ASP Wso HEtatdSsssm da af Sehdh SphL

gus

If'~

rehh asaspaf TV¹ar TVT~ V W soCsphns

TV SheT~ Vvtdw Caphse

Cess®WIHS4ahtdSOSwdao

CsusSNsapshhs¹oasedtae

• I I

Stts¹pertdasaaprcossaae¹p ISh

Inh¹ Pewyunto IEumoeetor OSSSulh

su¹ssHAH

gyS

yy'uaasr SHS HealSew Teshhudd¹I SUMQI I COIIEI sddtdeTHIE 2¹¹ Atss Wso

I dea SehsaderarSetsasSPIHL Zshhasaspal TV Ihs raw sf Ww Ovutau Cea¹uarpthho¹stdtaEOBO

2 AG PWau I PoInt Saluund afSdtorotdh TVmmTuner af Weo Capture

CureSWordperleotSCaoeESSO

. KYl(lQ $$$

HollynoodSurround

QR$

ZoHrinUSBCemern

UPGRADEPACKAGE1t

UPGINDE PACKAGE1s

UPGRADEPACINGE 1t

UPORAOEPACKAGE 1

17GBHenlNve

47$

ill' Nmsnr

UPGRADEPACINGE 2 27GBHard Cthro

znlnixUSBComers

ter monitor

UPGRADEPACKAGE2:

UPGRADEPACINGE 2

ntrdh TH722US AGPtndeo

Q$$

UPGINOE PACKAGE 2: IIIUB RNI

rotkb USBCamera

032$

~ sI

' • I

'•s

$12$ , !

All systemsabove include: 5OKV.OOIlodem • 2oltrix Noose • Windows Keyboard • Windows$8 (wl CD) CoreS WordPerfecSQIoa OO OO: Wordpertect • Outho Pro • Pyeoentettonm9 • CoretCSITIIILm 9 • 'tone ot GN pert, dante, ondphotoSrophe '

or vlslt us at www.tyo~atres.soya

X-TREICEPEIHTIHG HP694Csokmr prier .

..........................St 49 ...............2739 HP640C toker printer .. . . . .. . ... .. . ........2309 HP930C mbur prier E pnm5tfheeeosotmrprinta..„,„, „ „ . . . , , SI 59 EpsonStfhts 660rnhnr printer,. Epson5tlhe 740solar pintsr.......,,.....„.. .

. .

X-TRENE IIIGITAL Csun FS.330P CnnmF863$I tP-3300tL.

EpumPhotoPC650..

Civilization: AEall to Power......,.......,.

Ir 2dl lhasa..................,................,.....,..„..„„3279 j.........9169

19'PtkttetonHotitor....................................... J559

X.TINE CAESINO M5NHLFever 2000; MSunks 2000 EASportsEar6T..........................

Ir pti t tctnnlkmta..................................,..... j...,...,.t309

3199

X-TRENENP3 I a mon~rlPH oP50064HB...........,............,...,...,..j,... 9389 Creadv elabsNomad64HB...................,....„.„.....,..........34I9 X-TRENEENTERTAIINENT NBRlohbtlV/FH1 6L .........................................,....379

5579 2969

Epsnnshorn-PC75tL

&t 79 5199 ..tzt9

X-TRENEVINNrs

X-TkENE STRATEGY SIMf3N 3000; Ageof Empires B

latIsieshthhHpadRsBammsBtsslsksahadctambokskeakelIesacspafapmatwm4aBmmaHsdbda6poBsdnss skudamaebtustnsetfssdcmshaptasmtvsthssskdsrsshrekdsspps hel aheasdsyeaeeeteimishopalaldunplomakthlpedvmehohfaced sndsdhhesaeKcrlshhsbsspsaNsphaaesehohopaysbshapehkmuaasyuesssdashspednt BssbcEIo~ c sn aks dadoed snskksdhspshdoeys,asmssdahaaeymylmsptmeekasaneseadstfytolsmlhshmtsenhomahousyhbsshsadttthnesnsenames phsosmamVksdvmhwraebtkaas essbnssh'sdstsuothttiasm aasynnhhdhihsaBteasmeahhhNehrawnafm1Nisssaothdiasss9hshsansIhIbRskdosesR2abyedessaeskesspaahdynhtRraaNmekn,eatmmsslshissadddsslnas wekadaoetkesnha •noesis htsmtgmha sg adsm"cusumsrlsa ms b mkohb pcc fuushcense oa mns fardeals.

iinkng e P850NAL IPO...1NEPOPULAROANARIANRRANII

MID QT 0I'flj32 IIIHBU Wj)lwm

mme

l".".t".-'ill

' 2 I ZZJjr er. Inlets Celeronrwprocessor 500IIHz

Inlets Celeronvuprocessor 533MHz

64MB SCRAM I T Monitor 6.4GB Hard Drive 40X CDROM Amplified Speakers ZoKrix Gamepad Goree WordPerfect8 Family Pack

Intel® Penliums HI processor 533MHz

64MB SDRAM IT Monitor 10.2GB Hard Drive 48X CD ROM 300W Subwoofer wf Satelite Spkrs. Zoltrix Gamepad Corel8 WordPertect8 Family Pack

64MB SDRAM IT Monitor

UPGflADEPACKAGE 1: Zoririx UBBCamera

UPGRADEPACKAGE1: Zuiirix USBCamera 128MBRAM

UPGRAOEPACKAGE1: 128MBRAM Zoltrix USBCamera

I ISO

soew SpeakerswrSub-woofer IIPGRADEPACKAGE 2: 128MBRAM

17GBHard Drive

$7$ QI

4 rr r

•

Intel® Penllume DIprocessor 6678IHz 128MBSDRAM I T Monitor

Iyt:D.RW

450 ercrli Satelite Spkrs. Z oltri epa d Corel8 WordPerfect8 Family Pack

600 W S fer Z oltri epa d Carel® WordPerfecl8 Family Pack

if PGRAOEPACKAGE 1: 12SMBRAM

UPGRABEPACKAGE1: 20GB Hard Drive Zoirrix UBBCamera

17GeHardDrive UPGRADEPACKAGE 2:

18'Moniicr

gQQ

+QQ

$22$

UPGRADEPACKAGE2: 2T Hitacni Tvr YGA

crvssve4 Pcini surround speakers

88K V,OOModem Zoltrfx Mouse

WindowsKeyboard IIOndowe88<wfCn>

gI f l p pC D RW

17GBHard Drive Toshiba444 D

• 'I

Oo r r e v

4 • •

64MB SDRAM IT Monitor 13GB Hard Drive

Toshiba

UPGRABEPACKAGE2:

PCcelSDS&142343

Intel® Pentiums IBprocessor 600MHz

, gg$

e~QQ

sr' 0 0

SCC esfeeerent42 .

Z ollri epa d Corele WordPerfect8 Family Pack

0 0

p' Jll]M-

PE gl

Soow +uhwa0fercriYhtelite spkrs.

soQ

UPGIIAOEPACKAGE 2: 128MBRAM 27GB Hard Drive

agggS

• t.aaetvuv' BXOVOCO

10/IOOLANNetwork Ready

IE ZO ~IIII© ~t>

M I5

MechWarrior Phlllps Free speech

0'l1$

83$ $

WOn l o n

8C iptp

MI I LY ISi@05 CoreSWcfdperktcSS

—IEe

CofeSQUEE rcSPID8

CoreaPireHctste™Mac 4 CGIESphtaoHousem3

0 0 0

CIEISEB R'selnhtfttc5ve ~

1888

MavisBeaconTeachesTypbtytf8 1

e owaa • wwwv ervv

ulttam v • w enmwww • vva 6

rml ~ vnnu

uo r m

•t gm • mvmvvwl&

2$0.882.3%88 6M $ 0 1 .0328

For Your Complete Demonstration Or To Orde Please Visit Your Local PC'Centre Itr4tybe

E, O BO

•

Mother board

9 : O O - 6 :3 0 :30 - 6 : OO

RQCK SPECIAL SYSTEM

IBM 20.5GB IDE-ATA66 7200RPM

Hard Dr)a)(h

(

Intel Csleron 433MHx CPU SIS638 FC-PGA/SOCket 370 MOtherbOard 32MS 16apin PC108 SDRAM 1.44MB 3 1/2 Floppy Drive 6.4GB IDE-ATA56 Herd Drive SMS 530 Chipset AGP Video 10 AT/ATX Tower Case/250W Power Supply 104 Wln'98 P/S2 Keyboard 3B P/S2 Mouse 56K V.90 Integrated Voice/Fax Modem 16 Bit 3D Sound w/Wavetsble 40X IDE CD-ROM Drive 120W Stereo Speaker PC Works 2000 Plus Sfotware Bundle One Month Internet Free Full warranty

ts" SVGJLColor Monitor $ 17 9

lyf

)

g ICE

th'

etwortt" Card

ATI 32MB Ag-In-Wonder 128 AGP Video Card ATI 32MB Fury Rage128 AGP2X PC2TV Video Card ATI SMB SRAM Xper$9 AGP Video Card Creative Anninilator GeForce 32MB PRO (DDR) Matrox 32M Millennium G400 Dual Head Video Card Oxygen 32M VXI AGP Video Card

Video Card

y stam

onito .

F ax:($04)07~ 0 4 0

Tel:(604) 87%8642 ~

$336 .00 $426 .00 $3 7 6.00 $130.00 $119.00

CanonFB630UColor Scanner Epxon lae U I artecrcn 120OUScanner MicrcTekScanner X6/ USB MicroTekX6ELScmnw wilh SCSICard

$109.00 $329 00

tarinter

Fax:(804)41(56000

Tel:(604) 4184 828 Mlmaway

Uk' Imperial SL

Repeate

IS~ NF C

MAG 17" 786FDColor Monitor NEC 17" AS70 SVGA Color Monitor NEC 17" EF700 SVGA Color Monitor Samsung 19" 900NF SVGA Color Monitor SONY 15' 110GS SVGA Color Monitor SONY 17" 210GS SVGA Color Monitor

BrotherHL-1020LarerJst Printe r Bmlher HL.1040DXLsterJsl Printer Brother MFC.197CMC LaaarJst Printe Caen BJC-2000SEinkJet Color Printer EPSON660InhJslCcbrPri nter

vss

0150 - 5172 Kingsway Surnaby, B. C.

Quantum 20GB FireballKXU-IDE 7200RPM Quantum 27.6GB Fireball KXU-IDE 7200RPM

Supporting Better Business through the Better Business Bureau

$179.N 3'159.00 $259.00 $189.00 $299.00 $370.N $69.00 630.00 880.00 628.00 $2LOS $36.00 $35.00

$249 N

Fax/ Modem

$326.00 $180.N SN.SO $379.00 $239.00 $319.00 $429.00 $310.00 $3N.00 $639.00 $309.00 $479.00

EPSON760 InkJal Color Printe rat

$18 6.00

Um 30 va v m I

Lexmmk3290 InkJst ColorPrinter $149.00 rat c mv m 9 v ml Lexmarh211 InhJel Color Printe $90 .00 Qddala 8WPrinter U68.00 SamsungOL4109Alaser)m Printar $4N.N Acer Priss620U USBScanner Acaf Prim!620UTScmrmr HP4200CScanner UMAx 2000pRalBadScsnnm UMAX2200uScanner

3COM Superstackl 0/1 00 Base T 16Pon HUB Intel Express 100 Base T 12Port HUB OEM SPort Networking Hub 10 Base Stackable OEM SPort Networking Hub 10 Base Stackable Acer 8 Pon Coax/1 oaase Hub D-Unk 12Pon 1 casse Hub D-Unk 9Port IOBase Hub w/UpUnk Porl

USR 56K V90 Internal Voice/Fax Modem (win)

T OSHIBA

3'16rn00

D-Link DFE-538TX 10/1008aae PCI RJ45 Network Card

$9B West Bth Ave, Vancouver, S. C.

Quantum 12.7GB Fireball CXU -IDE 7200RPM

$129.00 $2N.00

aCOM 3C9058-TX-NM Ethernet10/1OO Networking Card GVC Ethernet PCI Combo Network Card Intel Elherxprsss pro 100 plus pCI Network Card Acer Ethernet combo IsA pnp 10Mbps card Aber Ehemet combo pcl pnp 10Mbpa card D-Link DFE-5SOTX 10/100ease PCI RJA5 Network Card

85 .

Elite P6STP-FL SIS630 FC-PGNSocket 370 Motherboard ASUS K7M AMD K7 Athion Slot A Motherboard ASUS MEZ S370 PCI 33 Motherboard ATX ASUS P3B-F Pantium-gl Motherboard ATX(6P) ASUS PSVPX PantiumlNB PCI 33 Motherboard ATX

U FS

o n .-.fr i

Acer (AOpen) SSK V.90 int Voice/Fax Modem/PCI

Acer (AOpen) 56K V.90 int Voice/Fax Modem/PCI Acer (AOpen) 56K V.90 int Voice/Fax Modem/ISA

$1 40.00 $18 9.00 $289.00 $1 29.00 $270. 00

$4S6.00 $1,'l60.00 $49.00 $85.08 658.00 $199.00 $1 06.00

GRANITE SYSTEM intel Ceteron 500EMHz CI U Soaket 370 Motherboard 64MB 168pin PC100 SDRAM 1.44MB 3 1/2' Floppy Drive 6.4GB Flrebaa KA IDE-ATA Jta 7200R PM Hard Drive SIS 6MS 530 Chipset AGP Video Card 10* AT/ATX Tower Case/250W Power Supply 104 Win'98 P/82 Keyboard 28 P/S2 Mouse 56K V.90 InL Voice Fax/Modem Card YINF740 3D PCI Sound 50X IDE CD-ROIN Drive Speakers Juster 450 Wsn w/Subwoofer One Month Internet Free

• w •

FUII watmiity

1T AOC Color Monitor $25 9 «riyk»m .~ GIGABYTE GA-5AX ATX Socket7 M otherboardATX GIGABYTE GAJIVXE+Plll Motherboard ATX GIGABYTE GA-BX2000 PIUPIII Motherboard ATX Aspen AX59Pro Super 7, PC IDD Motherboard 51 2K Shuttie HOT-661 Pantium II/Hl VX Moth«board I

Quantum6.4GB FireballKA IDE-ATA66 7200RPM Quantum 9.1GB Fireball KA U-IDE 7200RPM Fujitsu 6.4GB IDE-ATA66 400rpm/9.5ms/256k Maxtor 17.4GB IDE-ATA66 400rpm/9.5ms/512K

Hard Driv (SCSI)

$149.00 $219 . 00 $139.00 $199.00

Campsg 9 IGQ7200RPMWU SCSI III IBM 9.1GSU2WSCSI 7200RPM Quantum18.DGS AlasUW SCS I QuantumD.IGS Alhs 4UW SCSI

Pine SIS 3D 4MB PCI Video Card PineSIS 3D 8MB AGP Video Card S3 Savage 32M AGP Video Card S3 Tri o 8M DX 3D AGP Video Card ASUS 32MB AGP V6000 AGP

$39 00

SamsungQL405DALean(st Printer Xuox 450CPrinter HP I IDDLaser Pmlsr HP 21 00 Lafw Pnrisr HP 830CDfskkri Pri nlÃ

$58.00 $369 00

$405.00 8566.00 $559.00 $969.00 $299.00

Drive

Maxtor 20.0GB IDE-ATA33 7200rpm/gms/516K $266.00 Maxtor 8.7GB IDE-ATA66 5400rpm/9.5ms/516K $169.00 WD 13.6GB IDE-ATA66 7200rPml9.5ms/2MB $266.00 WD 30GB IDE-ATA66 400rpm/9.5ms/516K $33 0.00

$58 9 00 $639. 00 $566.00 $396. 00

Fujilsu 9 I SCSI 58pin U2W 7200rpnytoms/256K Seagale18GS Cheetah UIIW SCSI Seagale 50,0GS SCSI.2UW WDIBGS SCS 68pin U2W 7200r cml8msl2MS

$419 00 $800.00 $1,469.00 $726 .00

SPeaker SCambri rg iePCWarks4 PointSumwnd 81 20,QQ Speaker sCambri dgeScvnri w arks4 PointSumwnri $236.00 Speaker sCreari vsSaunri w arkw/Sub»asm $109.00 Dee d »is Juster so.ics subwaalwl so scunri sso.oo Speakers ROCK. UYE, 276A Svbwodw $55.00 Sneezes Yarnaha M328W/Svbwacier $89.00 8peak«s misc Lansing ACMxw $95,00

(Speak e

$859.00 $316.00 $369.00 $479.00 $689.00

Panasonic21" S110 SVGA Color Monitor Proview I IP SVGA Color Monitor Optiquest 17" Q71 SVGA Color Monitor Opbquest 19" Q95 SVGA Color Monitor Arum tr SVGA tkgriat Ctriar Mo st»

$1,080.00 $449.00 $289.00 $479.00 $268.00

S ound/ Card

SoundBlaster AWE PCI 128 Sound Card Saundalaster Ensonig PCI Sound Card Sound(grater Live MP3+ Sound Card SoundBlasterUve Sound Card X-GAME Sound Blaster Uve Value Sound Card

$49.00 $39.00 $139.00 $129.00 $76.00

$1 Jstg.00

Creafivs Labs 8432 CORW Drive $386.00 Sonyox4x24 CDRW int.EIDE Bare Dri ve $366.00 YamahaCRW8424 E-IDEInlsX/4X/24 CD-W Drive $388.00 YamahaCRW8424S InlSCSI CDRW PC lGt $480.00

ComPaqE500/Cs86$64mb/4.39b/24y/11,3lil CompaqM300 ~ 4.39 blt I,38 CompaqPrasari a l694 Notebook Ca«culm CompaqV300Cduo32nW4.3gbl24xt 2.1

D RO

Mic roStarMS-6167K7MotherboardATX $2(g.og ABI T Pantium III BE611 Motherboard ATX $1gg,oo ABI T p ankumlHBF6MotherbaardATX $169.00 Soy o SY-SSSM SuPer 7 Motherboard 512K $129.00 QDI Advene 9-133 VIA Apollo Chipset PIUPIII $12g.gg

Sgg.oo

SONY 19 420GS SVGA Color Monitor Viewsonic 17" E771 SVGAColor Monitor Viewsonic Ir E773 SVGA Color Monitor Viewsonic 17 E775 SVGA Color Monitor Vmwsfmic 19 E790 SVGA Color Monitor Viewsonic 21' P810 SVGA Col«Monitor

0 Writ

$109.00 $109.00 $159.00 $11$.00 $139.00

Creative Labs 52x CD.ROMDrive Toshiba 48x IDE CDROMDrive Afreery 50x IDE CD-ROMDrive Della 48t IDE CD.ROM Drive Acer 50x UJXNAIDE CD ROM Drive

$69.00 $96.00

$60.00 $59.00 $00.00

$3,000 $2,766 $2,999 $2,219

YamahaCRW8424S IntSCSI CDRW Panasonic CW7585 (8x4x32ICDRW HP 8200i inL IDE CD.ReWriter Drive HP 9210 1(8x4x32) CD. ReWriter Drive

IBM 1452Natoaak C56664«b/4.8gb/I4.1to IBM 1540~ 4.89 b/24xt 2. tll I Tashib aTsua 8000PII3668 31/544mb/14.Ilk Acar 512T Natoaak CN365,32/4.0gb24X,56K Acar 513TNaoaak Cet400,64/4.8gb24X,56K

$549.00 $319.00 $2 89.00 $276.00

$3,200 $2.633 $4/959 $2,249 $2t366

Piansw IDXDYDixL IDEDrive 8'179.00 Ranssr IDXDYDixt. IDE Drive (104S) $186.00 Pioneer IDXDYDin( Tnqrisss IDEDrxe $190.00 L G Gsdnncqx DYDktL IOEOxvs $159.00

RUBY SYSTEM Intel Pentium III 550MHz/PC100 512K CPU GAUIVXE+Ptll Motherboard 64NIS 16epin PC100 SDRAM 1.44MB 3 1/2" Floppy Drhre 13.6GB IDE-ATA66 Hard Drive S3 Savage 32INB AGP Video Card 18' AT/ATX Tower Case/26OW Power Supply 104 Win 96 P/S2 Keyboard 28 P/S2 Mouse 56K V SDInL Votes Fax/Made« Card Soundalsster Ensonig PCI Sound Card 52X IOE CO-ROM Drive 3D-105 Subwoofer/3D Sound PCWorks 2000 Plus Sfotware Bundle

;,'„.",.„. $1 5098 Intel Pentium III 600EMHz/PC100 266K CPU P38-F Pentlum Hl Motherboanl 64MS 16apin PC100 SDRAM 1.44MS 3 1/2* Floppy Drive 20.5GB IDE-ATAJI6 72ODRPM Sms 2MS Hard Drive ATI 32MS Rage 126 AGP2X PC2TV Video Card 10 AT/ATX Tower Case/25DW Power Supply 104 Win'98 P/$2 Keyboard

28 P/S2 Mouse 56K V.90 Int. Voice Fex/Nlodem Card Soundalsster AWE PCI 128 Sound Card 52X IDE CD-ROM Drive Speakers 30-105 Subwoofer/3D Sound PCWorks 2000 Plus Stotwsre Buridle

AMD K7 Athlon 600MHz CPU GA-71XE AMD K7 SlotA Mothetboanl 12SINB 16apin PC100 SDRAM 1.44MB 3 t/2' Floppy Drive WD 30GB IDE-ATA68 Hard Drive ATI 32MS Rage 128 AGP2X PC2TV Video Card

17 ATX Asoo Tower Case/23DW Power Supply MS Natural Elite P/S2 Keyboard MS Inteligent Mouse 56K V.ec int. Voice FexlModem Card Soundalaster Live Value Sound Card SpeakersAltec Lansing ACS54W Pioneer 10X DVD Int, IDE Drive MHlennium Edition Sfotwere Bundle

•

Putting the Easy in E-commerce! We pltnride you with the tools you need to track your web sales with

thNstcs end profnote your web site tn the world with Web Market)ng tools and Web Management tools. See our great packages below!

All Eaoyffeatfngl acfnsenta lncruder

• Free Webslte Creation Software • Sts Domain ttetgstratlon • Microsoft Frontffage Extensions • Webslte ManagementTools E<ommerceSolngonsAvailable nrenae~ sss.ssz~w • 20 mega Of Web SpaCe• WWWyourname.COme 5 SmartMaill aCCOunta • EC- Builder - SOHO acwwofws

curer ccrr srsasrmawc • 40 mega of wab space• www.ycumame.corn lhttp://www.youmame.corn) • 15 smartMail! accounts• 15 consgurable mail forwarding options • ECOn!sr Desk -complete order and inquiry management tool.

.OO

<oe snesecs sg crcccJ

netd massa/~ • 60 megs of web space • www.youmame.corn (http: //www.youmame.corn) • 30 SmartMaill accounts • 30 Concgurable mall forwarding options • ECOnler Desk ~mplete order and inquiry management tool. Nne wu 58cc heNooccf

It's never been this easy lo make a name tor your business on the Intenlet! I

Hosti n

L o o k C o a a n • leo t l o e e I • e. C o m p a n y 'w5 ace shl Ja Tlwe eentallafchaye

c OOT-CON

HONE u

Revisiting the family network A yearago, TCPlookedat a relatively newnetworking technologythat allowedyou to build a networkathome by plugging intoexisting telephonecabling.Thattechnology,HomePNA, conti nuestoadvance,with fasterspeedsand USB optionsforthis"no new wires"networksolution By Rod Lamlrand

means you can talk on the telephone while products available via the Internet. However, Installing data Bowsbetween your computers simultanemy research turned up five companies in I have tried two of thesepackages and found fyou arelikeme ,upgradingto anew com- ously and on the same line. Canada that offer this type of product in retail setup was pretty simple. If you can install a puter createsa small dilemma: I would like PCI card, this won't be a problem for you. The The speciTication that allows this to occur stores: to sdl the old computer but it isn't worth was developed by the HomePNA (Home • HomeConnect, from 3Com Corp. only difficultie you might experienceare with much and the demand for computer time in Phone)inc Networking Alliance), a U.s. organthe internet sharing software. On a number of htttz/twww .scow.corn my home is high enough to warrant a second ization of more than 113 technology compaoccasions, one machine or the other has Home PCLink, from BestData Produms machine. However, no one will want to use the nies (you can End out more about it and its htttz/lwww.hsstdata.con bumped the sharing software off, and it has old computer if it doesn't have an Internet members athdp:I/www.homepna,orp). Network in a Box,from D-Link Canada had to be re-instagwL Not a big deal. Also, you connection and the ability to print. It would ln the May 1999 issue, The Computer Paper htlpdhwm.dlinh,ca need to put some thought into how you set up also be great if people didn't have to interrupt reviewed two HomePNA network kits (Home • HomeFrec Phone Network, fmm Diamond the network You have to designate one PC as one another to get at a document or other Ele PC Link Kit, from Best Data; and HomeFree Multimedia Systems the host, and it has to be on for the other PC to &am the new PC. Phoneline, from Diamond Multimedia). Both hltpyhwm.dianondmm.corn surf or access the printer. Overall, it's quite The"network"ideaforms in myhead,butat products came with two network interface AnyPoint Home Network, fmm Intel Corp. simple.

about the same time, so does a very small cards (NICs), a couple of phone cables, and headache. Phrases like "network configura- software. Both were also HomePNA 1.0 prodtion" and "server address"vie for my attention, while images of me crawling under the house,

ucts, and thus had maximum data transfer

htlpyiwww .intel,corn The fuhuu AB of these kits, with the exception of Best Internationagy, the HomePNA is making Data Products' Home PC Link, are available advances. The alliance recently announced cer-

rates of I Mbps. In December 1999, thesecond or in the attic, with a drill in one hand and version of the spedgcation, HomePNA 2.0, in second-generation, HomePNA 2.0, verEther net cable in the other,send me looking was released with the maximum data transfer sions. Intel's, 10 Mbps AnyPoint Home foraspirin orbeer,or both. rate jumping to 10 Mbps.This changepropels Network should be available by the time you One home networking option that is very

appealing isa phoneline network As thename implies, you use your existing phone plugs. The network uses two Ethernet-like cards and a data communication frequency that doesn't

tification of the original I Mbps standard in

Europe. Nineteen countries there have started manufacturing HomePNA products. These a phone line network into data communi«a- read this. The three remaining products are differ from North American HomePNA prodtion speeds similar to business networks already in retail stores. These kits contain two ucts due to the different tdephony standards, (Ethernet, for example,ope rates at 10 Mbps). cards and are usuaUypriced at around $200, but their adoption bodes well for the technolwith an individual card (for connecting a ogy over alL

What's avtdlable a(feet your regular tdephone functions. This Thereare a number of phone line network

third PC to a network) priced at about half that.

On this side of the Atlantic, Diamond Conrinmd onpagedd

OlK

ucent • •

•

Are you looking for reliable, scalable, cost-effective networking solutions?Then look no further. As a Lucent Data Networking Partner, we can offer Lucent's full range of Ethernet, Gigabit Ethernet, ATM and multifunction switches —from sophisticated, stackable units serving desktops to high-performance backbone chassisable to move vast amounts of data traffic quickly and easily. All are scalable. All are reliable. And all protect your investment in networking technology and infrastructure. Whether you' re in the market for faulttolerant LAN switching, remote accesssolutions, IP applications, carrier applications, or world+lass service and support, we' re your direct link to Lucent. Call us today.

Co) 0 1.321.676.7647 1.888.765.8226 suw.salmettsa • stlssNsolnnsl.esto • 15Bgohsrl L CsnboBhd,Sle.llg • Pain gsI, II 32005

www.caadacemnvies.cern MECOMPUIERPAPEABGEDmott APRILzncn ag

~+ •

- 40,000+ Products with REAL-TIME Pricing

Pne $tPP Internet t;PNPUter $tPre

FOR THE LATEST pRICES CHECK OUT OUR ONLINE STORE

TRYOUR FASTONLINE SYSTEM QUOTATION.

"WORKGROUP SERVER

AOPEN 2000

OFFICE WORKSTATION HOME ENTERTAINMENT

LNTELPENTIUM 533B

INTEL PENTIUM 533B

INTEL CELERON500MMX

• Aopen AXdSC Pll/RI • 40BX.USB. 512K • dlMB PC100 fns SDRAM • FUJRS 0 10.2GS UDMAdd Hard Drive • 3.5" 1.44MB Floppy Disk Drive • ATIXPERT IMO AGP X2 32MB SDRAM • Opliquest Qf I 17" Monitor .27mm 1280x1024

• Microstar dl63Pro 4408X.USB.128K ' dlMB PC100 SDRAM. 128K, • Maxtor ISGS UDMA33 Hard Drive 3.5" I.llMB Floppy Disk Drive Snper2 TNI2 M64 32MB AGP W/DVD SW TVOUT • IS" Monitor N.I.L.R. Digital Control 1280x1024,.28 dp, PnP • 19" Med-Tower case ATX 250W CSA • Microsoft 38 InlelliMouse • 104 Windows 95/98 Keyboard • BX DVD-ROM Diive • Acer AW37 30 SW Wavetable GA • Juster 3D-FX I 450W /Subwoofer ik Mic • Motorola 5dK PCIvoice/f AX Modem

• Edle P6SET-ML DUAL, AIX. AGP Video. ASD ~ . S dk8 HC ' 32M 8 PC 100 SDRAM • drGB UDM Add hard Chive ' 3.S IN4MB floppy disk drive • 648il AGP BM 3D Video Accelerator supporting lull screen MPEG • 15 Abl Mini-tower case 230W • 28 Mini Mouse 8 Pad • 104 Win98 Keyboard • SOX UDMA CD-ROM Drive • 100W Multimedia Speaken • 5dK V.90 Voice/FAX Modem • 10/100 Mbps NelCard TGHOME /ADSL

www.ncix.t:om

NETLINKCOMPUTERS INC.

INTEL CELERON 400MMX

- Secure On-Line Order - Processed On The Same Day For Most Products Ordered Betore 2:00PM

Sapp o rting Boner Business through the Baue r Business Bumau

• Aopen 17" Med-Tower case ATX 230W CSA • Aopen 28 PS/2 NelMouse • Aopen Spill-resistant PS/2 WIN98 Keyboard ' Aopen SOX UDMA CD-ROM • Acer AW37 3D Wavelable 64 Voice Sound • Juster 3D-FX I 450W /Subwoofer 1 Mic • Acer 56K PCI voice/fA X Modem V.90 Ready • 2 Years Parts and 3 year labour Wananly

• Microstar 6163Pro. 440BX. USS ' 128MB PCI33 5DRAM • UIM Deskitm 20.3GS 5408RPM Hard Drive • 3.5" IN4MB FIOppy DiSL Drive • S3 Trio3D 4MB AGP

• Aopen Spill Resistant PS/2 Keyboard • Logitech 28 PS/2 Mini mouse • Nellink 19" ATX Case 250W • Acer 48X CD-ROM • Intel EtherExpress Pro/100 PCI 10/100mbps ' 2 Years Parts and 3 year Labour We~runty

• 2 Years Parts and 3 year Labour Warranty

Ready)

• 2 Years Paris and 3 year labour Warranty

/Monitor Extra/ S

• Gigabyte FIXSLOT.A. USB. UDMA6d ' 128MB PCIOO SDRAM • ISM Destrier 20.SB UDMAdd. 7200RPM • 3.5" I N4MB Floppy Disk Drive •ASUS V6d00 Geforce 256 Deluxe w/ TV-OUT. 3D Globes 1 Asus Soltware • Optiquest Q95 19" Monitor .23mm 1600x1280

• Microilar mdsfio 440SX, USe.SIIL • li4MB PC100 SDRAM.

• Maxtor I SGB 5400rpm Hard Drive • 3.5" 1.44MB FloPPy Disk Drive • Arcade RIVA TNT2 M64 Video Card 32MB • Opliquest QF I 17" Monitor .2/mm 1280xl024 • 19" Med-Tower case ATX 250W CSA • Logitech 28 NetMouse w/scroll • 104 Windows 98 Keyboard • Acer 48X UDMA CD-ROM Drive • Acer AW230PCI Crystal 3D Sound • Acer PCI 56K V.90 Voice/Fax Int. • Juster 3D-FX1450W /Subwooter 8 Mic • 2 Years Parts and 3 year labour Wananly

• 19" Med-Tower case Afx 250w CSA Acer 56K v.90 Voice/fax Modem ' Logitech 28 NetMouse w/scroll • Fujitsu 8725 Keyboard PS/2 • Panasonic SR-8585 Bx DvD Drive • Sound Starter Uve v2.0 Value w/ Digital Out • Juster 3D-FX I 450W /Subwooier 1 Mic • 2 Years Parts and 3 year Labour Warranty

inet/IttfaqfpmfecfDTSM20OL, $44 rt5 FR EE ~ B $239 Cord/WmdperfemSuitey $5 95

tmadoaaSSSEFutlymsian , NndosNh Saddfadw 4 9 ~ MSNomeBundle

3.5 I.l4MB Floppy Disk Drive Creative Blasler Savagel 32MB AGP 15" Monitor N.I.L.R.1280x1024..28mm 17 Med-Tower case ATX 250W CSA Logilech 28 PS/2 Mouse 104 Windovn 98 Keyboard 50X UDMA CD-ROM Drive Aces AW37 3D SW Wavetable ISA 100w Muaimedia Speakers Motorola SSKPCI Voice/FAX Modem 2 Years Parts and 3 year Labour Warranty

$279 ~

fySD Sofhaam ~ t tR W ~ u nuxRedha161/09en2S

$88

• Microstar d163Pro 4408X. USS. 512K 64MB PCIOO SDRAM Maxtor 15GB 5400RPM liard Drive 3 5" I 44MS Floppy Disk Drive • 3DFX Voodoo3 3000 16MS w/ TV Out • Optiquesl QOS 19" Monitor .23dpi 1600x1280 • 17" Med-Tower case AIX 250W CSA • Logilech 28 HetMouse PS/2 • 104 Windows 98 Keyboard • Acer 50X UltraDMA CD-ROM Driive

• Aureal vortex2 Superouad fDigital I/Oi A3D 2.0 • Juster 3D.FX I 450W /Subwoofer 8 Mic • 5dK PCI Voice/FAX Modem • 2 Years Parts and 3 year Labour Warranty

s1$67

s958

s2998

s1532

INTEL PENTIUM 533B

• Microstar MS5169ALI ATX 512k, USB ' 32MB PC100 SDRAM • M axlor8.7GB UDMAdd Hard Driv e

• • • • • • • • • • •

1 222

GAME BUSTER

AMD K6-III 400 MMX

AMD ATHLON 750

INTEL PENTIUM 533B

/Moililor Exhaf s

UPER 7SUPERDEAL

HLON SUPER STATION

OME 8 OFFICE PLUS

' 30Daysinternet ~ u

s1528

s130$

592

Ieanufacture

Mo de l

CPU

MEM

08 900 Pll 400 6 4M B

Tosliiha

7$000

HDD

Display

Mo dem Price

.Ram kmfrifrI , SSOT~ p m460~ 9 , BG s L Sdff 12.1 TFT SSHdx i 82946.94 $35 38.17 Asar 342f PB IGOO 64M B 9G S 24 X 12 .1 TFT 66H Ca m ~ ' '~ ' NGG SSI td M B GrdGG ~ TFT ~ . $36 0ILTSr

$2 5 ' • $59 / 69

Teahddi ~

802 00$9 ' ~

64M B

:% OS N 40$

$3402.ST=

12 TFT

6 4GS

6 GS ~

/ Sfk eTFT ~

2 4X

$29$ 1 72 $2173.00

SI X 7 9 7

pd rat Nimfrrer lriwl fin)

dmtam~

M m Uem ~ ~

6 JRTS PTTCK lSCB2840IIW/284OFI~NLd89~$

ttmsmfsssmfc~

SBGCTSERPm ECP/EPPPri raNPWI

RTEIOUBIPC I 3!0/Stmt/3!OU/39068fiddSf ~ TGIRANPCI390FSCSI3allraWub40$6 5

smxu lie ne

Slid 4229

9/SI S9 589

v BI/ N f/ITB/277 •

5 FROIGSE M$66SSFIS

alta

PROMISEFASITINXS6IOERrie Cnal

M35

Tf 5

9211

s sm s t id

M c fc IOOsaaxu BCamafctm cnswretafcxm

SIN

m R~

BN d m 47 7 lm.emSMIMP~v ~ t

ariaw d ~

8$ N mSmda comm

nn~

10/100$lesPCIO-Uxk5381X/ACER320ALH320 t SCERCrxdd 5/t/Pfg/SCERddttaklUi ~ ' ~

ssaii6 Ita

sin iir arias

slip

INIELaaherharwafrete 109 I

GA M~

889

IIPIOB Ink IDE

• u a au aSSIRSSME/Eata8$/SCMEXT /058 SISS/I CASLEWNDORB2 208 Im/DR 'a

2 3 4/280

7288/294

• CmnagNONSRSIMTSIKHMML•v

SSP. 552

• amiSSKtakkdiiaaeSWumtSS/RCI/ ~ 8

74/ 4 0 /104 f

COUSTARPCIESS 56X InkV 90/X2Hiss/fm

• WISSKSSartttdigmkthfmhSIISOOEMraym~~ m s I HfiGEAR 108T8 Part

sit u

s sm alÃ sml aqa Nm

Ha s

UHKSTSSw'tdml Nelisork Idi 10/100$ aln

Nx 9

( > l~

•

830/30 0/SS SBS

alai

xmfxsaHI ~

1 3 40 SISS/198 5119/275

SuaxrDlskLS.IIOIIOHBftaaakprkelnl/Ba ' • SBMGLTD98sf/856 '

SIM

pd 4 slaia2 fn aeuasqsas)

reenl ii leis

strsfgsmgscoiplaaSeh0122468Es b..Rtiihdikstsa'risff~ 8

st f

t w )

581 5167

USR SSX VSO Yalci/FaxExL

•n

MOIOROIA56tiv 90 Dale/Fn/mim PO

/ 10 5 5288

530

All Prices are Cash Discounted Object'to Change ill t P lotice . IfE '

U A NTITY"'

Canada'5 Authorized

mrna~ Re- Seller for CORSA1IR CORSAIR MEMORY

• 'Aw nrr fr • rrwf/fff/2/rufAo

PN 4400XPro ATX. 32MS PC100,18 ATX Tower. AGP Vi deo.3D Sound,SSH Modem, NelCard

$313

2 Pc//3 ffA/uoMAAA/3onnfoo

ff62 30 400 w 30 Road sure r 1 100MHE Geant,32MS Pcloo,15 ATK

3COM OFFtCECONNECT id SWITCH , /A Pot/luff///fwrorw/fcff/fc/fmM3PI

GtGA BYTE 6XV-4X MOTHERBOARD

QUAN TUM /KA 6.4GB HARD DRIVE

, 7n ~ IQ ~

EfDEa ULTRADAFAHD FNLNsu

6AGS 10ms 5 4 00 2S$K UDMA33 $15D

Eral<a ~

N4M . .Sms ":54M 258K,M UD A33 SEN, I

Fui ltsu

412 00 9m s

IYVIHFN~ A l

54 M 256K UDMA66 $171

f a . 'Sms ~

R2K BTNEA BE'. 8280 .I

Wsltem$elaI 43GS 9.5ms 5 4 M $ 2 K UDMAN $ 150

I wspHfotNg fMLtWS „115ai r-'35400,gffftM~

WldlemDlgNal102GS 9.5ms 5400 R2K NDMAN $179

It¹NS~M. NTEkffNS" ~ ~ WeslmaBEIN 20AGS

sm s

Oiialhufl

9/l w

fWsem ~

gG tRRRWTDM/WW

CtLt fOMfgtIBNKI

Omudwh

13 .6GS 0.5ms 7200512K KNUOINA68$23S '

Oaduflf

21.3GS0.5ms 7200 512 1 IM UUWA66 5370

MK KB/

I t 83GM~ B

20.5

IBM

34GS

sm s

0.700

9m s 540 0 512K UDMA66 $166

I GNEf I ~ Malar

I MaNr~ Medor

I Mgff a ~ Mada r

Master

I IENSIO P.~

•

BR ~

9M S 7 2 M 2MS UDMAGS SEN

2M~

'TNNfltN~'NNIII

RI~

O STELINMQftRAQRSII I I

12 00 23IS UDOIA$5 $19S

' OIS MPEaEBEI efEE'.YT OMANE:.NTB © I

373 8 9

9m s

. w /o/

OVD10XPIOHEEHTray load/Bot.Lead

TM G 2MB UDMA6$ $210

2088 AEENHL'~2ON-'2$$8:-'NNFA IGIfi' $2TTLH 30GS 9m s 72 M 23IS UDMA56 «40 " ~/ ' M N. S I

$7 20

AN M S mgfffftMM LMNHNmrdah~f g « 1

PHIU PS PCA460RW CDRW

I ANMIONIMOIWB tfsstnoh' asu302aIsnsoalsc5mw/mn 5530 ill • 14$$ NNMROIBNI¹nLMBIGIOI233ACNPAM '.I Blok~e A%Spam/Polfnstw/sollllow osaouo 5250/la f AEINXINNNNiaocn NMNMIa affleuma n slo.rmmlr UolNas 5237 t MSNNMsadosapNMNNIMGNaaymtOBX FATRCNN3$ ~ l« I INll Naa sacolr2 Pa/lll 233.500W/0 ANNO

HlmosMws3103iso Ah

SM3

$7$tggspefR84RRRFBF EMNIBR4$ mlcaoslawoamarwmaomtalhNlasmteme233ACNMM If RRRSINMGSIRAsdN suyoalcaolraNas/NpIMNHPNCI3ma

Scanner

M adel

4' gl ~

f g t20~~

Artcc 42tec

1236P 123605 0 AM12EPhs

f A/lac

Col o r Nemh son ., Nahf 36 36 36

soh 12N

6$h1 2N BN N1200

arse 51 st a33

•

550/02

2EFXIEO/Q03 $45 • RAMOMA SNTTRaYIffotjf3$OG/SOTOMNNftagfsoetfNE M~ I

M - r

5160

1$D/2«

CAFAM/ETHI232MBAGpUNM

5267

wnp w f f w M w w w ~

GUNLBN OTXentortHI232MSUXra

$279

$ 143/1$I

CNEA R/E308hlternnnlhlstar/PNOOD032MSoeyme $37S/$300 • NNLENOTMAMGAMMSDPNOPHETBEMBGeywce= ~ $$ 37 Pmm/Cnhrsntperttog M6432MSNaut $140

526 20/39

RLOMP 3l%jier38$,

82W'.1 5253

ONMONDIHooMP3MMP3 PNPN32MS

CDWRITERgftNED/A

awwwooofrurwoowm ~ PANA SOHICR/LCM w/EEBD SCSI

ow'

$345 $$30=1 $287

ECRMIJIG4347BNK

MRSUMI 4i/43/242IDE CDXW

w '/AW/AW/fuu /WAI W m ~

'I NI /

NoNNNECML14hln 1/10 pack

$2.30/17.95

I$4$500MN/ Submmhr CAMBXIDGEsoundwwlwSlmakws E CNNMOGEOHNM~ CAMBAIDGE 4PolntFP510M/FP520N YAMAINMS/M15/M20/MS2$5pealwm

BONN~P Bothe r Snuhw Grolher

Epson

H L30M~ 8 $IDP I ~ HL1040DX 600 DPI HL1050DX U30 1 2 00DPI 16« E 1200DPI RC 10M 72M60 GIC50 72OG N SIC80 38OGN 01C51N 144h720 SICNSO 144h720 SIC TNO 12IHH6M Sly haalo "72027M Nyle 460 144h720

EPO M

Sty lus 740

Hlf HIP HIP

6100 0100 7100 7220 SBOC050 11MA

Ceaon Conan Canon Canon Canon Canon

r$238/DD I 1$2 233

. BSG.I

Epsd n

$157

«35/262 $5S/$2/89/96

ModelDPI

Bpcn Epsen

OTTE @ ~ 73 3$hf02$~

lboaferdoaI

!7 %

7p ba 020 32 $bt0~24 2".'SXNAN O

17" 19'

Ml Nl

37*

5P 0.2 0 12 $ h1024 GOS 0.28 IMNh1280 79 5Ffr 0.24 1« 0 212N

17'

775Ff 2 4

12 80X1024 «Il.M

O Psftues l Oasoudl OpXNu es t Opsques l 0354ues l

15" 17' 17 17 19'

V5 5 Oy l V73 Vys 079 0

0.2$ 1 0 .28 0. 2 6 G26 tk 2$

2$ h 1024 N SG .N 1 28lh102l 5310.00 12 $h1024 54 50.00 1$ B al200 $4 1100 14 $h1200 $1 27.00

Pwwwwh '

\ 15'

$ 75

0.21

12 1033024

• MhobhfN~ 2 ~

fslLN

Swnsu

$1$LM $153.00 $11000

scepbo Sceplff!

17' 1$' .

17'

15 11

NM ,;~

0.20 027 026

1 2 $ hl024 $1 97.00 1 280a1024 $2 $6.M 1 600sl200 $4 S9.M

700 NF 0.25 I B Nh1200

544 000

D54 0. 2 0 D7 3 4 0 .25

$290.N 34 65.00

0$$ 7,;02N .~

17' 11' 17 37' 19 19

lrr

'.' 5

7 10 7

•

529 0.00 556 6.00 1 376.00

fk 7-

$50 4.M

4 6.5 6 8/ 4

$1 42.00 5 225.00 52 30.00 $349 .00

$3 $0.00 37 36.00

St49 .00

15 6 S

. 4MrNG 6 «36M 1200DPI .

514 6 0 0 1 518 9 .00 5 3730 0

.6 . 44 99AS

Says.OO

.12

$ 4N.GD.

8 ,

.tXr l

344 9,00i

$29 9.00

19 /17 /19" AIXTowerCsee

$40/60/15

ee a m a a NMNGGBLTF /8$20473LXB G ~

04/333/23EN

10 MXToneroaseSldeopenw/2KC.Fan

$130

jttn GTNOO.

12 80al024 12 80a1024

~%&~~ I I N~ M ~ " ~ ~ dansante Vlwwonlc Nawsonlc Neasonle Nswsonl c Newsonlc

L-510M ~

IO/Nf

$494.00 $3$ 3.00 $ 233.00 $3« . 00 S MB.OD '515400 5 « 9 8.00 I

8/5 MHhsoo 0 200dat MR S

22$ E TIIIBBSO NIN

22M320 2 ~

S. s/2 4.S/2 5 8/5 5/ 3 . 5

6 $h600 lel 3200 120lhl200 let 5 710Phalo 1 2$ h l 200

OpusFstp

$51 700

10 4365 .00. 10 3 429.M 10 $ 533.N tf 5 3,256iM 4/ 1 $119.00

$$hdM B HH60 0 BHhso o

zft ; . 3~ 1 I eltt M

m leonsfk rk

53 78.00 $ $36.00

144th720 144h720 14402720 344BITM ~ r MNh600 MHh600

Stylus 900 Photo 100

He solusen

IA ~

Newsonlc

tore Hours'

$310 2 0 2/157/240 $325 /357 $160/113 AU $405 542/42 $14lt/99 $376

ERMEE NENA2052482$8f/ts/MposhN,NYm

DNMOND sanlc ImpactPCI30 Soimd590

Pda!

S1OS.OO

$380

ONMDHOVliwr27703HI2OBN32MG

• CNENF OEENNi@Maftfoosto54$1/TETLHSsttff~4

Pnnlew Fforhr FroW cw

]

MPOMOI/nrcrrwMII

MATNOXAGP MaweltV RIS

3202 aas

CREAT IVE LABS ANNIHILATOR PRO

• OMMONDSt pMcTTDTHFENN0N32MS/Ukmh ~ $

acNMIYEsound8taslerP01.320/POII533 frow 0$1

slm asf/5PII/I• 233 5amlfr P3aa/Psms

$329

IMSNKMA OPGOM ERR/BIRR/32¹LOROM/MANSL72/tM/ESS/3M CHFANVE Safwhee lBHSHelsNAGP Sss AM fl' ~ $149 / t ldl/310 ETOOD OMATEP 2050/ ~

BDUHDCARD .

AlTECLANSIXG INNNCube IMS AMTO MN305

512K Sanaeuda

$439 95

SA MSUNG 1-5100A LASER PRINTER aPPM/fwrnP//'IMP

53rugs4bl0 PCI/AGP

$334

IX'tDMiAHENRsroroutNAC344/ACSOS ~~ Seaaal ellgw 9.100 Sms 72DD

1/ Puwnwr 3 .23MM/ Meeff/2w

• fBOTH MAGPSMBRNennhimG2M/G200LE

EPEA/fgffEEA

305$2 ULTRAWIDE HD

I saagdaI~

srs

5195/199

• fw OAfMfmum wfwmf ~ O

7 2N 2 M S UDMAN B N O

$379 $P

SAMS UNG SYNCMASTER 700NF

ASUStMNOGERNCE OELTLEEW/TVKNIV300 ~ Atl ala WonderPHDSMSPCI /AGP/ Wonder120 $ IAHAGPLSMSXPBR12$/XPEN72000 ~h 2 ~ ANFury32MSAGPOEM/IV Wonder PCILOelals • ARNAG ERIWMRXtOUAXAOPSOMSO M E ~

SN/$4/69

"- ~

W WAW- ~

BTM o n s 73IMOE 3$$5 TN 'NEAII. SNG&

13. 6GS 9m s

CD IIOMBdemalCaseParallel PwtToIDE

ACBtpCIWarelableAVGT/AW230/AW320

80F KIIF200.3LEKhtEB4 AN ~

ISM

I' B ~

ACBI 4$I/483/50XCD.ROM

• fpwu m

5400 2MS UDMMI6 $399

C4fuodmN.~MOD A'ENN~ ~ II

$] 49

CNBHWE PCBVD 6XEncore Ihu2 DaisyAC.3

720 0 R2 K XAUOMA66 $159 PA/EE EINENH GIIEOgfEt 3' dfsm ~ ~ 8 322L Ouanbl /ll 1 3GS 9m s 54 M 5 12K CXUDMA66 $106

EO~

• CREN fDETAN52$

27 G S Gms 4$R200 2$90 'INN'.. 44N I

6400

A/Oaf frwwuf/WMAW

CfbaotN aDVDDRIVE

20$ DANN''5400 RML UNEASE $23OAI

I httNm ~ 4

33333/Af/133MA fuff oof.f

o/P

Cit a l

$325

AGP 4M

$493

pi ~ I NTEL PENTIUM St - 533MHX CPU

$220

PEHTTUFAff 400 BFSDf PN 4400XProATX,32$0 PC100, 15 ATX Tower, AGP Vi deo,3D Sound,56K Modem, Netcafd

/L ~ - ~

IA L~

$ 297 95 ,

ASU S K7M ATHLON MOTHERBOARD , ' '7

tff

FIFELCELERDH366A MibfN

HEWLETTPACKARD 6250i CDRW

5773 02 5 12M 21024 $ 39 0 N 0773 02 6 12$ h1024 $ 45 S.SO PF77 5 D25 1 6 0021280 5 48 0.00 PS7 75 025 3 $N hlMO $ 50 7,00 V95 026 1$Nhl200 $5 80.00 PS 790025 3$ Nhl200 $7 0S.OO

PF7 90 I125 1 $ Xhl200

«34.00

HDDCooler/I.SIDAM 0 'NEWI

Sia/40 $25/ 35/32 I

• DMSBSGWASNS$44NIBapdc MVoaeok ~ SOCIMT3«TO SIOT1CaiwwterHONSION

$10

IELNXtgf/NII LIE10istMISINR '

IOGNECH20 Mouls/30MouseMsn 40 PUB

BNITSN0125/4725/Focus2M1

a f

~ ~

Etfo 300 T~ l

523/68/4$

I EI LB$63 I 54D/133

/AW WWP/m ~l r n t u

ONIDNIcPs/1 / Ps/2/Inlwnet

•

522/32/78

SNSRWWfftiieiIRLsta MICR05DFT lnlaaaouse Golaw PS/2/USS • lOltttfsps/LIFB/gt+05/NttGEfmd ~ ItffBWNEO NERINMKKWSi ~~ LooflECH Internal/ConXessDesktop

$1S/10/I2

Toll Free: I-SSS-IVCI-9888 51-8682

•

x 6

) 5X- 8611 ,.45i-:@SO

5 EaW s Broadway Vancouver, BC Canada, VST 1V4

One of the Top 100 System Builder in North America [system suilde/Summit'99, Intel st MS)

Tel: r604) 875-8859 P"fxmyr604j 875-8611 Tech: r6041 879-6800 .. E-133ail: Sales®atic.ca

One listed in the book

"International Who's Who" Since I989

( Professional '97)

www .atic.ca

Business Hours: MIIII.- Sat.: 9130am - 6100IIm (Sun. tSHoliday Closed)

8xl4x/32x Panasoec CD-RW........$280 0!

s . Abit VA6, PC(33, ATX

. 12SMBSDUAMDIMM PC)Op • I)GB Ulna(66VIDE - )A4MB Floppy • sox FADECD-ROM • Cmativc Isbs SBPCI 128 • Spcakcm w / Subweof«r •ssk int,voicefsxm eden v90 • ATI FuryAGP 32MB • I 8"AIX Casewith 250W • Fujitsu9725 PS2keyboard ' logitcch mousew / pad

$1 370

f or Intel Pil l - 5 3 3

$1 240 for Celeron -500

$1 450

for Intel Pm-SOO

Nloch series

• Windows'2090 Pmwfcd

Optional:/w/yrsremonly/

.. rslce HsSra'BW (Ventks. Cem NC BNC Pnsm.— .. )IN IS f 17'SVGAI?N2t .... /5IW?n NECIF'ASIO/FEree 21 flaxs)WSW HAO116FD7'?3 liar ...... ...ma Vi«+ac PW FPIW.... .A552ef)N

SickATXloser cec vn ))SW poser$91

NK MO f NK FPs)e...,,+n)mnl soNY04N: Free... . 19)o/Isse

Sh&14AfD Tees)e mackOhsxkTerna CDAcirtss)

Neck4h ss TekibsCOOOMAtm

Shckysdulc DVIX30eveslel SlsckWan 732tc)bead .Sls ShakPs) ense.st) Shak In arsacFr) .. De

Over 1900 hit per day now @

WWW.ATIC. CA On wwwdttie.cn

/Velfrn//yServer on norw>f/C.CA ( IBM4.5 U?W scsi $240, IBM9.1 U2W scsi ...$350) ( IBM 20G/7200 UIDE...$250 IBM 18G U2W ....$540) More on www.Otic.cn

Mmeonwww.otic.cs

sccsoNx Qmi Pili-xcsessocpus I I(x(eoTx I 32x/Dml U2wmd 1024MBECCRAMfAGPV f) s ISG U?W holrwrprbh...$1) 9N

32MB SesSDRAM.DIMM (64M ... *350) 6AMB Visa IDE (IOAGB ............... 340) 4MB SVGA built-ia 1.44 Fujitsu tkppy 3D soundcant built-m md spcakcrs

Intel PIII 480/650/708/750/800 33498/36$0/3750/3990/4260 Dnnl PIII 40$/650/7$0/758/8$0 33890/4150/4458/4950/5400

Intel Ccleron 400/320)o-$600 Intel Celeron 433/320)o $620 Intel Celerun466/320R.....$640 lute) Ca)aron 500/130R ~690 Intel Cekron 533/320k MTSB

Krr-II 3D 400/450.......$5(O580 KQ-II 3D 500....... $500 Opnonel: Weean'9S 64 vn me c4, .....rst?I

Upgrade to: 27GB 7200 ATA66 HD ...+$90 ATI All-in-Wonder AGP 32M ...+$160 Creative Annihilator Pro DDR 32M AGP ...+$195 SoundBlas(sr live! MP3 / Platieum ....+$70)+$190 ViewSonicE773 /PF775 /PF790.....$400/480/700 )4EC FE700 / Fe750/ FP950/FP I350....$390/500/ 870/1350

wf12SMB SDRAM ...+$80, w/20.2G... SN

CllfCTOWCR ClltCRL,. $0 0

opuewat Qt I I Ey/ I IE773... 5295/3 10/420 Rackuve20004 splus+subwoofer,....+$50 MS Windows'OSvers wf cd ...............+$125 MS OUice 2000pro.................,............+5450

IOBTN[Cne ... $20, IWIOOBTMC. +525

:• ' •

' •

intel.

ANDRI

in~

cpU tan nentksn / psipm ....................$7/I Dr)5 S370ockcner v1.0/ v I. 1(chxg )............515/25 Duo)psifan/Ourn K7 Rm...........................$20

ATX Cense WB w/ZM AGP. uuko, ecdna....tll5 Seem 7 ATX «i/bAGP4M,Auns ATX .............A)Is AsusK7M f MSI 6191(sr AMDAnlm A)I-.. $??)ON Gipbps Modudesd fsr AMD Aeloe A))........,5199 (etc) 4490X Goats ATX, AGP ...................3)23 BOOK-PC2NO: ccrc/12xrVidce/Awbs/MK/tAN....32)e K(WN!L Tooer.QusKPUrsctux Vxhe IAN..~

3DFx Vmdoo3 359016MAGPw/Tvm R Tvout $320

72pin 16/32/64M(12SM EDO. $49/85/IW(550 Peity 72pia 32 / 64/12$M...................595/20W)90 SDRAM 32M I 64M PCIOO................S45/75

0• 8I)300$tp Fujitsu 8.4/13.3/20G.................S(55/1$0/230 Quantum CX 13.3/20G$.......$195/250 Quantum KX 13G/206 .......... $225/280 WD ATA66 8.4/13.5/20G........,S)55/190/240 WD Expert 13.3/ 20G/27G ......$220/270/335 Msxtor VIDE 8.7/I 3,6/17/20G.$155/I 85/200/230 IBM 20G/72N I Smgatc ?SG/7200......$255/320 Quanosn AtlasA U2W 9(VIB/36G. SMW540rl090 . $340/530 IBM U2W91S DDRS9G/ISG. IBM U2W ZX 9G/HN?(1024rpm).... . W50950 Scagat c arraguda 9/ISG U2W .................$420650 sesgat eShena 9/182/SOG U2W ........$450/69(VI290 Renovahle HD kit EIDBSCSI/U2Wsmi....$20/25/40 U2WSCSI 4$ay/SBaycseew/power........$150/250 Hot swapblc HD: HP/CompaqandIBM............ call Adapnc 2940UI UW/U2W................$215/2700 10 . j

AdWWKmpaneauw/?wiuzw.s?)QQSO/330

Toshiha Notebook HD 60G/12G...,....$235/410

'NiMH bar(my....................................$130 • Li-Ion bansry ...........,.......................$240 ocr auto adapter...............................s)00 AC Ssmt whptsr (I (0/2?OV) .....$)10 .Tosklm 2$" 4.0G / 6.0 HD....$22W2SO Tosbiba 2.S"12G HD...............54)0 'Partsbk Pnatcr B)CAW50 .%34V430

S3 Virge 3D 4M AGP.............,..................$30 ATI SMAGPI ATI Xpcnes8M AGP.......-.. $6)nc ATI Xpcnaplay SM PCI/AGP ...................$93/95 ATI xpen'99 AGPBMI PCI 16M .....,,,.,...,.....$9BISS ATI Fmy 32M / Fmy Pm 32M AGP......SI65(215 All Fury MAXX 64M AGP w/)Votre .....„$350 All Ail-io.woadcrl2$ wf 16MAGP/PCI ..$2?W230 ATI all-ia-woeder 12$ w/32M AGP .....,.$325 MstmxG40032m/Deal pans.........-.... ..$210/230 Matrox G400 32M MAX AGP .................$)25 D iamoad Stealth BM A G P . . . . $ 53 Dismoad S3-Savagc4 32M AGP .......SIIS DirmM V770 UltmI Viper B 32M AGP...S? Isr?15 Creative S) Savage4 32M AGP............$115 CrcagveGcywccpro(AeaihilstorPm)32M DDILS)70 3DFX Voadoo3 .2000 16M AGP /PCI ......$155/IN 3DFX Voadoo3 -3MO 16MAGP .........,............$190

Inlet Caiman 46(/SOQI533............$130/I 55/) 05 Inlet Penlmn 11533/550/N0.....$3?WSSWAQG InlelPIS NQ/667/700 .....,...........$55WOS W)30 inlet P III 733/750/800......,,.,,.,...584W930(1160 Inlet XeonPeg55W512k ...........................$1430 Intel Neon PB NIV667 2wny .......... $780 I 950 AMD K644$ /45W475/500....... $75/05/95/I 00 AMD K)SOW55Qf600/650 . S28W30M60/430 AMD Ky70W75WSOOmnz ........... SSBV650/SBO

..... M 91 Ass P30 F 4NBXAGPPllf Pill 2DAN. Asn P)C?ON f P3CWE rs?4.......... ..$2?e f 294 Ass PSA ATXI P)A.B Al Inmbr. AGP....$140(39

Ans V660WO NDctuu6800...................$)MGS(r)80 Mim 3D+.................... ...$1120 .

SDRAM 12$M I 256M PC(OS...............S140/300 SDRAM 64W 12SW 256M PC(33... SWI65")15 ECC.SDRAM PC(00 64/128/2ar......S90/)70/320 ECC-SDRAM PCI33 64'12W256 ....S95((75/340 SGI Video RAM 512)/IM...........................,..SIO/$20 SG.DIMM 72p S/16/32M,...................360/N/150 SG.DIMM 144p32/64/128MSDRAM.....STN)30/270 SG.DIMM 144p 32/M/12S EDO......,....SW/160/330 RAMsforprie(os ..........................................available Tosbiba /IBM Dell aotdeok RAM ... SATIC.CA

.I/ • 0 < i

'Potable Printer HP340 .............5320

PCMCIAscrial port/duau$250/310 Fmh RAM card player...............$100 • D-t?nkSdkf 10.100....................$12S PCMCIA S6k fsx nmdsm..........SN PCMCIA Ssk/INBTRmlPme....se?0 . Mck PCMCIA drivcw/4014dish... SSM

i/0< • t SVGAIS /17" .27 fit" .26..................$(9W265/)SS

17" .25 Moaiter Special .............S)30 CTX 17" Fiat .25 Trieitroa ......542(l MAG XISO OT.25 15" / 186FD Fhu.25 17".3250/420 NEC AS70 17' I A590 19"..,......................$320/520

NEC FE700.25 Flatr FE754 ISN Flat.....$424()4) NEC FE950 /FP950 17" Fhu......................$7)Mt70 NEC FEI250 /FPI350 ...........................$112IV1350 Paoasoorc SMYO/PL10/SL95.......3390/SN/630

Paucs onrc Pt)0 21" Innx lac 23,........,...$1(W Sony E200/220GS.(17")...........5490/590 Soay G400 71st .23 19".........,......$950 M Soay74(n Fbu 17" f FSO OFhu 21" ... ..$149W?O Vicweuic Q)lf E771/ E773 $5 ... $300/33W420 Viewsooic PF775/ PF)90 /Pgls .. $50W/00/1280

36k Voiec Fax meden int. V90 ISA/ PC)....$25 USR 56k.v90 fax modem int PCI .....$55 USRSpoota v.90 PCI(29764L Hardware) ...595 Supe 56k v.90 Voice PCI/ISA ............$45/IIO 3COM-USR 56kv90cst/voice ............SI93/255 Ascend 7220 Router ............................$2780 Cisco 250CH + IP Drive ...................$2370 PCMCIA 56k v.90/with INST ........$7WI25 PCMCIAIOBTcombo/ 10 INST ..... ...$7W)00 Xircom 56k Res)Port modem ...$250

IBM 4.SG/6G 2.5" HD. ...Q • PCMCIA IOBT/Coxal comb...$ • PCMCIAIOOBT sard ........$10

•

eeirom @EQUI Ciii5

iree(PSMMX-233................................,.........$00 In(s) Ca(aron 3&VAO W433.....,.........$05/95/I )0

Anr BF6 (Sle.l) f BE/vE 4(SOXATX Pli .. $(af195 Abir VA6 I BP6 ATX AGF PIV PUI......31302W late) CCS20 I CCS29 w/soead...........llz)/219 Ieul SE4NBX2I SE4NBXPAPU/Pm ATX -..SIWI60 (eccl RC4400X-SM.sodiof SR449...5224/22e Srpnnice P6DSU4NBX Dad PRIPIUU2Wscsi...5550 SspcrMioo P6DBE4(OBX Deal PU/PUI UIDEi...aa S~ ia o P)KD rfl)0 Pll I'EI 233 NO... .,.51W N Scprawo P60GUI SNGU4NGS.Xse .... ..SWOO Supnema P)DMEI P)D)U rs?ODml IU?W..MNYW Ass P20DS4NBXDual Pl) U?Wrei ATX.- ........)6)e

n•0

Intel i820 basedmorbeboard 12SMBSDRAM PCI )3mle 20G ATA66, 1200 Ulna IDE ATI Fury 32M AGPw/IVvua Slh CD-Rob%1.44FD SoundBlastcr L(vc! va)ue USR 568voice ax madam leadman 2N ATX w/?SOWw/CASE FAN 104 Fuprsu 872Skeyboard bficneolt Intel)i mousew/wheat aodpad Windows2000Pro Em ver. with cd

Iatel Pill-533/550 $1620/1640 Iatel PIII-600/650.....$1690/1020 Iatel PIII-700/733.....$1970/2090 latel PIII-750/000.....$2230/2490

Optional:

13 I IT' SVGA 12Nsl(U4,...+5IWHS Epos 444 r BIC?999.......... r5199/I)e Coloreds NOPrmaer. (Aber rebec)$)9 NECA579IT -, +ale

32M(64M/12SMSDRAM....S)WI 30/245

All listed prices (refract 30A cash discount), quantities and specifications are subject to change without notice.

PS2 104 KBaad PS2 Mouse sex cd-mmside, 3D Sound included 561 voicefwunodcmv.90, INWspeakcr

IS" Hi(eve( towercasew/230 power 104 win9S KBandMouse, MassePsd 56kvoice fsa m odem v.90 int.

0•

Windows?000Pro wlsysfem $19$

ATX tower casearid ATX pair et

Sex CD.ROM iax Eide

Intel i820. SupermicroP3DM3, Dual PPI)l, U2/U I60scsi built on board intel 10/IOOBTLAN, Server AGP 32MB Video 512MB ECC-SDRAM 1,44FD, 50xCD-ROM Dual Rcduandant2-in- I 300W x 2ATE power 2x I SGBU2W SCSI HD Fujitsu KBandMimosoti mouse

AGP CeIenePPGAmadmtesrd 64MB 16spmPC100 SDRAM UlrmlDE 15.OGBHD 8MB AGF vidm boih-m 1.44 Fujisu Uoppy

MVP3, lcemhzbus,Super7 socket

Pebml HN Pill Xua )Nebr (NI 141) leIeutnrs?VD(W sit' 32?WO

Pxess IeeePili Nnele (1)n)S) ID)eel)O)?x/04/W naif 31914 Dcskyrc EN (IS)902) Pill-66)/ 13), vr • 9S 52eze Poker NU)mcr rttt )Dada terser/Osaxftatnn edf 3 1 5ee Pokes Htnnel Fnl XcvxWeeks Ill)Wry/mat)U?W evt' stme

VievSoeie E790.........................,.....................$520 Vicwsonie VPISO / VPA150..............,...$1460/1580 Sumssng 700NF 17" Flax........................$4N Sumsaeg 9NNF 19" Flat...................,........$700 Sumssag53ITFT 1024 LCD flat Pmn ....$13SO Sumsang 800TFT 18" ECD Panel....$3650 ' AdsPucAPA1460 siimSCSI kh~

•

-.530 IDEISASuperIfo Dual VIDEATA)3 Kl cause(br .......$60 Dual 02IDE ATA66PCI cue(roller . $85 Myhx UW sm9SO T (29NUW)....$179 My)exU?W sari 95ST(?ONU2W).3?N 'Aesecc 294r/94IUW —....~tn70 Ahern 29N 02W/ 02W MLANG)O Adaue29INU?Wscsi/Kh $33NW AdsytmAAAI31 /AAA)33 hits)98/990

/uhpccAPA1490 she (ceees)A?W

. Adwuc 3940DualscsbB—.--...SSW Adnmc394WW Ded I/Wsmi. SIS9 ' Adapnc 3950U?W Dual U?Wi..SNS • AdaptccSMSHorceaacct.........ds?e ' Adspus 9949Fiber /930..$HN/I IW

)sxPCMCIA toSCSI 8 whpuus ISO

• Im Peal(s) ra SCSI.II uavdor$75

smiI Uw scsi /U2W Npi a /VIDESepia c • hie •

• t oc k

VER4900hit perDay W .AT I C . C A with Daily prices Daily market news Leadiag Technology ,'Leading performance products

AIID-10hX CPIl hit the market, MSaw illbethebislory Intel doesnI want fe mark nsIfomhzCPUlnwi 'Nock/pat make/bead MSNsnusl KBsadMS Inteilimauc Intel PHISN SoombzCPU. PCI OND3bus ni I IG/u eratJfAh/f SS/L//made if 128MBSDRAMPCI33 w HD ATA66Ports )bac yssa isker md nxsycw with /840andDualPI/I 730 maderhe ~, . „ 52„ m„ /enuron the iopline.InteIServerwidi ngl f L„., dvreonCPUshas beensold over /0 uni/s USRfhk voice fss modan

ISS gel Pill-SS3/SSQ/600/ 6SQ S1690 / 1 7 2 6 / 1 790/ 1 9 6 0

IIZC@nineplaf Ckfhnrmee//m/h koouooATA66HD

lSSgel pik '$00/ASS/gSQ/QQQ top, krkeover the Viewronics aarkef. ATI Fury 32M w/TVvruf Plea/echeckthe Fanroumr ho//mf lych; ReckLive subweoferw/4 sunounds bs S2 120 / S 22 40 / 2 3 6 0 / 2 6 6 9

WW W .atiC.Ca Tel:875-8859 Fax: 875-8611 Supporl:879-6800 Giga K7ix AGP,ATX. ATA66 128MB PC100 SDRAM DIMM 1.44MB Eoppy drive I SOBATA66 HD 32MB AGP videosard Ill" ATX towercase Panasonic40xCDROM 56k voice fax modem Fujitsu 104Keyboard Lan 10/I OOBTNIC Microsog latellimousew/pad SoundCard and Speakers • AMD K7 500/550/600.%1150/1170/1190 'AMD KT 650/700/750.%1230/1300/1440 •AMD K'7800/850/900. $1650/1950/2190 • AMD KT 950/1000.. S1MO/2480 Optional: with.23 17" Fiat CRT .........+$420 with .26 1 7' / NEC AS70......+$320

3DH4308406) MMX cpu,512kcache 64MB RAM

Intci PHI430/SOO/$$0/680 CPU, 236ODC

64MB RAM ( 128MB...+$188) 6.1GTosbibsHD( 12.OG....+$280 ) AG P8M Videobuilt-ia RcslPort568voicefaxm odan 144 Hq Py, 2~ CD. ROM(DM...v$238) TFfActivc Tnu color. 1024x768 3Dsrxmrk MicrophoneR spkr built-in Dirk-Silver, USS, infix, Pamllcl, serial, 2 FCMCIA slots,S-Videoout-put Li-lon Bsneryw/ Led ACadapter(I 10-220ano switch), FREEcsnying case

6.1O ToshibsHD

36k VolecffsxmodemBuilt-m I A4 Floypy Jt 24x CD.ROM Built. in TFf Active Tmccolor, Touch Pad, PS/2port 2 PCMCIAslots ( 2 TypeII or One Type RD USB, lnlia, Parallel, serial, Est SVGA 3D sound,MicrophoneR sprskas built-in

NiMH Bsnery, AC-sdpter (110-228v), FREE amyingcase MSWin'98 fuEvcr.2 w/CD snd license All drivca preload and wie cd

Win' 98 fidl vcr. With cd

' 5833 ILI" / (35" TIT 3SHAIR $1$5N(958 ' 5N)X 1357TIT 3SHAW4NMI99N2840 '5033X 135vTFI 3DHdW59 .QNNIIN with Car adapter ................+$110 with I OBT comb card ........+$70

with 10/100 BT cad .......+$110 with 56k /8 lo/180 Lan .....+$150 with 96MB ........................+$80

with Panasonic Sx4x32x ......+$280 Upgrade to ATI Fury 32M.....+$70

anticiPated the Present. And you can be Sure we' re

14" TFT Active coior PH/PIE AGP OM3D Video card built-in Silver bodycolor. Ag-inaae 6.2LB onlyl 64MSRAM ( 96M.,+$80/ 128M ..+$1$0) 6.1G Toshibs notebookHD ReslPoA 56k Voice Ibxmodem I A4 Floppy, 24xCthROM (DVD....+$250) 3D munrk Micmp hone /8 spbsbuilt. in VSB. InOs,Pamgcl, serial, SVGA pon PS2„S-Video, Doc-Striae pons 2 PCMCIA slots, M.lon Ssnay ACalaptcr (118-220auto switch), Wle'98 full ver2 with crk FREEcarr/ing anc

ISA"/14 I" TFT Acuve color 1824x768 intelMebilc Cclwon 333/366/400/466/508mbx (AMB RAM(96M..+$80/I28M ..+$150) 6 IGS Toshfbe notebook HD

1.44 Floppy,24xCD-ROM (DVD.....+$250) 3Dsounrk Miaophone Rspeakersbuilt-in USS, infia, Parallel,serial, Ext. SVGA pon 2 PCMCIA slots

ACadapter (I I 0 220euro switch),

• Hctbae 9180I*i" Trf Pal-SWQ3~9N2QO ' Ncgmek91N 141vTIT Pal-59llkN~ O N • Nribook9IN 14.1"TFf PH(cfn.. QIN

• ILI"TFTCdasa (W(IN500%193NISIN2(N • 135"I Criaen(N/46NNO-QIW22WINO ' 14.1'TITCrisron 4N/45NSNM3N/2358/kuo

As one of the major providers of the notebooks in Vancouver, we had sold over2000 unitsof Nemook in western Canada As thefactety nutboelxed service center,wc provide upgmdc service for Toshibs. IBM, Compaq, Fujitsu, Acer, Asus, Sharp C anon.eWinbook. Netbook,NiCBook, Scepter,andother donee .....

"We Pioneered the Past,

Working on the Future."

Ag driver pmlesdandwith cd

' 14.1" TFf PN400/450.. 525N/2690 . 133» Trf PH1450/500 $2700/2790 • 14I" Trr PNI450/500 $2860/2990

hggns™Wm'Kigtk

Toskiba 407OCDS • Ccl366/64M/4G/133" DSN/W98/56k $2398

2 I48CDS • K6458/32M/4.8G/12.1"DSN/56kAV98 51895 216OCDS K645062M/4.OG/12.1" DSN/56fr/W98 $1895 21$0CDT • K647$/64M/48G/12.1"TFT/56k/W98 $259$ 488OXCDT PID66f64M/6.8G/14. 1"TFT/WinOS $3740

•

i > ! .km

DVD KITS

HP DJ 34OC/ 8)OC ....................$348/288

Hp 6te/ 97nc / tt24c..................steo/330/r)66 Hp2tfeec / Zoeecri .................................,....$868/1458 HP IleeSppm2M /2100SP2M .............,......,$366/1968 HF4838 /4038H/40)OTN......................$1590/2288/24$

HPloss/icosa/GN...............,........,...52344/3368/3688 HP8 IOmf IOOH/8I OO DH........................3 3320/38 38/4399 HPCotwicscr 4380/4SOOH/43NDN ....$3660/4334/3558 HP Cotorksser8308/85NN/8300DN..$$696/9780/12898 HP OJ 725C ceicr pnntcr/copy/scen/fsx...............,.SMr) HP kmr 3tOOXiprinta/copy/scan/fin,8p,.....,,.,5966 HP ColorPlena/ HP accessories ..........www.ATIC.CA

Canon

8/CtNK / OJC20NC/69N„„ „,

A feo/SfJMIO

Lexmafk

....$188/188/309 Op/ra Etle(spcciil)....................................................5)38 Lcumrir Zit/ ZH/ ZJ I ..................

. .

Epson

Sryisi ccersctrfse ................

.....$fcafsa)20 stylus Ils U4484pi)/slsac......................... Stoo/610 . .

. .

Stylus 900/900H .. ... . . . . . . . . ..$684/860

Brother HL. IO4ODX 1 2ppg ........ .......$408 HL- 1248DXr t238DX.......................$563/$694 .

Toner Tnlm/Tn288 ...........................................$35

Okidata OLSW 60odpi tater......., ...........................$370

•

• •

ATI I "/I 9"/23 "csscdpowcr................$40/35/74 ATX 13718"/23" case ttpowcr................,$43/30/78 loWin ATX cise t7" / 24" Apowcr...................SM/tee Server 2.m-t Redundant/ Xcon...............$370/698 Lsadmsrk ATX-299 pfastic. extra fsn.........Silo Luufmsrk le" ATX-202/204with 250W, exes fsn....SS3 Mouse / Logftich 28 / Logitcch28 w/whcct .$1/I 2/18 MS InteliiMcuse / lntcgi Exptorer / VSB......$23/93/88

Logitecb Marble mouse / USB .....................S.96/98 Logitecb IntcmerKB / cordless mouseR KB....$4NI43 184KBrpejfmrs)25 / Fujitsu 4723..........,... $12/20/69 MS Nsturd / TcuchPsdKB.................................SJS/61 MS natural VSS / USOkeyboard....,.....,.......... Z)3 / 30 Black KB / Blue KS ..................................520/20 0'sck mouse / MS black mouse...........................S2/f/23

Scsi cable/ Wide scsi cabte......................SIO/15

over 4dcviccs cable (scsi/UW scsi)...........................$33 Eit. Scsi cable / 25p.HD59p/25p.HD68p ...$25/44/44 ixa scsi conic (any pin ro centranics ).....$40 Rock meuntin8 IDE/SCSI drawer,.............$20/25 Rock mounting UW-scsi ..............,..S43 Priatcr cabics 60/108/2$A......................SS/lo/IS hlodcm cables/Laplink cabtcs....................SIO/15

F t b cr net c a b I c s ....... . . ... I n

s t o ck

Toshibs Ss/32x/ Hitscbi Sx/40a.5198/198

Crcsuvs DVD4Enact x8bt.(wta t)...............,$338 Stock DVD drive ....................SISO Hollywood+ dccordsble card .......$109

SOUND CARD tebit wunf SS PCI 6t r SOPCII21... Sfo)3/43 Ssuadotincr PCILiw! X-Gener r Live' MP3. $141 SO PCI LiveVifur / Live! Pistinum............,...373/231 Diamond Mx)fftf/ MX448 ....... ... Sif/tm .

CD - RO M

B ZX Ini. Qoe .....S65

Creative 52x /Toshrbi 40i

E rdc..$78/75

Atfcry 38x r SlackToibibi O4.. .. ....$60/96 48x scsiPisaeer / Tmhibs49x scsi ........... 5 I39 /136

Backpackt6x pirsttcl slimmed with mund,„...,$2tO

CD W R ITER Panssonicox4x32.......$280

IBINI TikifkkPad

s•

1421HPA Cel466/32M/6G/13"HPA/36k/W98/24x $2193

HP 4G-8G Trsvca...........,/...........$268 Saigate 784 4-SG inricxr .....................$268/JM Scasite DAT4.8G 4mminricxt .................,...$968/1154 SONY DAT3608i 4mm4G-SGdriv.....................$930 HP DAT 4G 90mm / 44G 123mm „.$898f1850 ViPowerPCMCIA Reader iat for desktop...............$90 ZIP INfM int cidc /psrattc1....,...........„.....,.....$9NI33 ZIP JOOMscsi invest/ USE...........,....-....$16M 16/2te Zip 236 Psrstlsy USB ...........................,.$230/230 Zrpdnk /JixdrskIG/Jsi2G,....,. ...513/110/166 JAZnsvcier SCSI rc Paiftel atsptcr ....... .. $10 ORO 2 2G inr EIDE / disir, ........$234mrO . .

ORO 2.2G ext. Pirstfcf with disk ............$350

ORB 2 2G cxt. scsi with disk .. ..$390 Trsvcn TRt/TR3/TR4 ...........................$28IJJ/33 LSsl20 iupa drive int, / disk ................,. .. „$90r43 DAT diskDDS2 /DDS.3 .....,............... ......$25/40 Suck drive PCMCIA w/ 4OMoslr ..................$3W20 .

Cresuve 8432 Rewrite w/pen (remi)......5384

HP 9118i fp4/32 mail kir .....................$378 HP92tei icsi 32x8x4x rasit kit ...................$388 SonyCRX146kn 24x4x4x / wrpcn........5353/396 Yamshs6416sscsi 16s4x4xin /43 ........$295/338 Ysmsha 64I6SX ext . . . ...........$498 Plex/or 8432 rasil kii int. «ide ...........5380 wiiiesble cd-disk /Sony ................51.6/2.8 Rcwriresbte cd-disk/Sony....................$3/8

SPEAKER

I.l> • ts art tsx combtony / iiait pcl comb.............5 teria 32 art PCI re/tnt/OT Prirana...............................ett 0-Link DE-5)OCT tartneuy .. ........,.....,....$2i fnrit PCI Pw fates f Server Pm.....................tei/tin

scorn pcl icom teeny........................................sat Onf r Tirmicarcr/T.............................................SJ

Ceixut fcmtervservtmn............................tsfvr2$OJ

I24W / Subwos/cr48OW..........................St2 I$30 Eastern 4416/Stet . . . . . ..........$63/$93 nockkfve 2SOOSubwoofer w/4 sp4,...,.....,.....,$33

HvbteoT 3 pvnr cpsrl r tspcn.....................s4i/ is/tie Hvs teeny 4 pirr r teoov s earl ..........Iiiltto

Sistern Home Thee/or DA/9400..........$274

Hvu to/too.aport...................

Mcnvpbcne /HcadrcL........,.........,............Sat t

Hub Otficcccnncct JCta764 SP tOOT............., .$1IO H u ofi' rcavrvcrtctsrot tse tons............ .Sita Hvb OtriccCvnaca JC/cite CP farceur............iten Hua Oniicfvnncci t2n ieOOT ....................$4SO Heusen SP-tt ts/tntiny tip JCtootc,........... $8SO Hvb SP-tt tn/teeisp JCtratt...... ...............ststn

Ysmsbs M28 w/Sub kit r M)e..............lttl/tce A liis ACS45.2/34/naae.. ..ssi/ t ) 5/ Ji n criuvc vcwaks sporal toooliocc......site/ite

TITLES furca.nomas« iviromomvf Ms uuri Svi'teen ii fuausaoasMoceri .........A fin Curer WV u/t 2000 ..

.140

tm ormoum sw r svxa suowu ........... Iaameo

.., .....Stiu

nvo Hp teeny 14 evn fryfY timircd) ... ...., Isa/i Hva HP tnrtnenv tiri4nvn ......, .....Sties/te90

COmibau (PmnwioondArmadacarrier/ 128OXUt 02 K6458//32M/SG/I ZVIPA/566AV9IM24x $1898 128OXUI 07 Ke-475//64M/6G/I3"HPA/36k/W9$/24x $2398 Morc On WWW4TIC.CA

• - • 9 • • Modems nad EtherNet (PCMCIA) '

•

56K PCMCIA fas modem v.98 ....................................$80 PCMCIA 10BT Etbeme comb ......................................$60 Xircom foOBT..................................,.......................$218 Xircom IOOBT + 56k fax modem RealPort ..........,.......,,$430 3COM 10/IOOBT PCMCIA ( 3CXFE375BT) cardbus..$220 3COM 37 574-TX 1 0 / 1 00 L A N lob ii . . . . $ 2 1 0 3COM 10BT (3CXES89DT)/IOB Com(3CXE389DC)...$190/260 3COM 3CCM156B 56 K g l obal modem ....S320 3COM MK V 90 Fax modemw/ Casu support (3CXM556)$323 3COM 56K with loflOOBT LAN ........................................$440 3COM 52980 12ffk ISDN PCcard U int................................$530 3COM52903128k ISDN PCcant 5/I' int............................, ..$475 Intel Ethcrcxprce Pro IOOBT PCMCIA 16bit.......$220 Intel Ethergxprcss Pro Plus 10/loo PCMCIA ...$370 Intel EtherExpress Pro loo with 36k v.90 modem ...$490

• But(eries, Sound Corda, nncbnp, SCSI Adaptecl450/1460/1480 SlimScsi......, ...........$140/230/290 cxt. parallel CD-ROM 4ox / with power .............,........$160 ext scsi 4ox CD-ROM with case ..................................$210 32x Backpack cd-rom parallel / with sound ............$300/360 NewMcdia sound / game port............................,......$280/80 NcwMcdia SCSI Db2$ / LAN IOB T . .. . .$125/110 Nogatech PCMCIA T V t u ner . . ...................$385

Carrying case,Targus Notcpac CNOI/20...,......,.........$40/33 Universal cascCVNJ / Lcatbcr case CLNJ............Stoa/120

Platinum Leather case CPI C I/ Traveier CL86......$210/198 Koskin case CKN2/Convcrtiabla case CCB I ..............$80/70 Encore Air Lcaihcr case CELI A ...................................$200 Battery NiMH / Li-ion for Nabook........................S I Io/ISO Bancry for Toshiba/IBM/Compaq/Sharp/Canon......Prcordcr

Hvu tXLaa tuny DENS in / unans Se....i ... SJOIOS

wklyl HP 3)OOC ..... . . . . . . . . . . . . . . . . . .$228 H P 6338C . . . . . . . . . .. . . . . . . . $ 5 38 lohl?fg Psrdiil 3lbit lin bal UMcx 2028p / 2028U..................5173/2)6 Acer 628P / 628S/628U.................$148/168/168 MicmTckX6USE/X6 EPP/X6 EL.........1193/193/)N OEMHS I241 gu ~. . . .................................AIS AGFA Sat/cern 1212P / IDiS/I2 l)U........S 14 8/lgylll Canon scca 328p/623p/638U..............$141/luf ill

nvb u.krak tonyncatt tip/unite tan.. Sinn/sin

Huu tnicf tnnviicca XuteOT /COOTSs,...........,.,$2co Hvu falsi tc8vifncw Pvs tn/teeny Sp ...„...$310 nvvii

f a rci torcrncl vtclicn Stitavpa ...Sscn

Router islet tauma Expressa/eau/os/eton ..sano swruk Hua icomltalct ... urt va www.xvtcca

NT 4.0 Saver 3 rte ..................................$9satxin NT 4.4 Sirvir 25.............................................$23CO Ny • .0 ctfcnt access tmvnarcich ..............,.......145

NT Wcrksuw'on • .0 / ffccmc............,..........„..Stfalce Ms Ocikcoicc scrvcr V2W24....................$2150lltee

MS SMS v.t.2 tel21 usca...........................SJ410/1200 MS Sax A.e ri cv va..................................$1680

kiri P m Mire Dv384PCI/Swdfs 4NPCI.... „,,Ste)or298 Mua DC 38 Pins .....,...........................SJ198 Conan Al Zoom / A508.............$635/73$

KadskDC228 ZOOM/ Dc265Digitsi......5710/I too ATI TV-tuner with FM..................SI38 LoSitec Guican VC / Home /pm......SIIO/fluff M Cimtive WcbCamBI USB .....$118 in spmiaf

UPS Ups tee/soo/sso............, .................. Site/tse/iso VPX xmcn 4saimVtsce .............„....,....53$0/33/V6SO UPS SnunlseOI2200/)mo....................SSIw/290/t990 swecancil pcuca il wist..............................sti/34 svrevxncii pro ir -tct.....................................stir47 swecxncsl Na ir w -ut..................................$4wis

A(andmark thmscrumaomr unit

Ho aarraeumrm Ebnant took

SenorVsnman n

trao OpttanstOpscscfcr pan

amndatg twist fu inc Mfswrn aorrrsra menu rrra!orf of uloi! Iamoi

pans semmrcn ATX-200 19", 250W Extra fan.................................$85 ATX-202 19", 25OW Extra fan.................................$85 ATX-298 19",250W Extra fan.......„...,..„.„.....„..... 083

ATX-299 19", 250W Extra fan.................................g I io ATX-102 24". 300W Extra fan.................................$140 ATX-2080 24". 2x3OOW Redundant PS....................$350

ATX-ioluc 19", 25OW Emra fan.................................$90 ATX-Black 19", 250W Extra fan.................................$90

p c'

717-8000 ••••• • • • • • • • • • • • •

•

•o .

•

• ••

Your PCSpecialists ~

C ..b;.R- d

W e Nake Custom Built Compute~

g sLJLNBT '

1 8 ~ 3 5 1 No.3 Road Kc mond BC V6X 3A7 fax [604) 71'7-8008

Ajdsrbrig 0 W

PC PLANET PC PLANET • PCPLANET PC PLANET PC PLANET

tation

•

tation I

ggP

I Station

pnutfsm tl Rsa4 VZtt Compliant I Bite P68 ATA+Motherboard Cdema , 'I Pgl B133MHzMotherboard I Elite P6Set 100MHzMotherboard Celemn. :I I?'ATX Case 250WP/5 Celemn I ir ATXCa e 250WPIS SN I 17' ATXCase250WP/3 SSO 6 4MB PC100SDRAM 40 8 5799,' I 64MB PCI00SDRAM Celeron Celemn 5549 I 64MB PC100SDRAM L44 floppyDrive 433A : I 1.44 Floppy Drive 9019 4N I Fujltsu6.4GBHD I 1.44 FloppyDrive :I Fujitsu 10GB HD 91059 Cnleron Ceiersn 9509 I Fujitsu 6.4GBHD SISSVGA BM AGP RIVATNT2 16MB I BMB AGPVideo Card0/8 :- I PCI 168it Souadcard0/8 i I CreativeEnsoniq 128Soundcard @99 1 I48X BDECDROM Celeran +3 pii NO I 48X BDECDROM 9'1099 168it 3DSoundCard 0/8 ',I 56KV90Modem 46 MO NA I 40X BDECDRO M PH4 00 56K V90 Modem Pg 400 9099 . 'I I 56K V90Modem0/8 120WSpeaker :.I Juster 3D300WSpeaker 911M Pili 5$0 9049 5030 I 10BT NetworkCard0/8 Azura 15"Monitor Pgl SN i I 17" N4SVGAMonitor I Wln98 KeyboarddrMouse/ 120WSpeaker Win98 PS/2Keyboard 0 Mouse Q 009 ,t I Win98PS/2 Keyboard /5Mo'use 91519 ' ,I 15 N-I SVGAMonitor +8170 Intel CeleronCPU :. I Intel CPU

System:.

lg"Sammsg 900SLShortmbe 0 25 •8519

Bluster

I intel 440BX2Motherboard : I Asus P3BFBX440Motherboard I 17" ATXCase250WP/5 : I 17" ATXCase250WP/5 I ig pg ND Igg lnteffl Mouse .... . . . . . . . . . . . . . ,Sl 91 :I 64MBPC100SDRAM :I 126MBPCIBBSDRAM SSB g300 ' :. I 1.44 MS(NB 2000pzojSBV(OEM)''Sgggj240 ','I. 1.44FIOPPFDrive FloppyDrive MBWlndow2000pro/90'(OEM) .8169/135 91039 PHI , I Maxtor 7200rmp13GBHD SD RAMPC180 84/128MB..;,.... 885/365 ',I Pujitsu 13GBHD P HI 50 0 i I Asus TNT23600 W/32MB p gl ATAUlsn 66 ESS MHiPSB Malnboard.gtlg :.I Rive TNT2 AGPX4 'I . SB Bve Value Card 63 GB Hard Drive, T „..... . . . .., .8139 1 I SB 128 PCISoundCard $151S MM 91079 ..'I Creative 52X CDROM Al'A 66PCI/PCI IJSBContml Card 659/38 .:I DVD Rom 91955 PBI600 19 USRPCI56KV90Modem TamahaSSNSoundCard ..., . . . . . . .922 .' I AOpenV9056KPCI Modem Pig ATI Xpertgg W/SMB. ""," " " " " . 8 6S : I Juster 450W W/Subwooler S109$. ;I PC WorksSubwoofer TN ROGER@ Kame Rit .. z...... . . . . . . S34.95 I 1 7 " N4 SVGA.26 Monitor : I ViewsonicE773 17"dp.25 Monitor 93669 Zip100MDktk...;......,.....,201.09 .'I WIOBBPS/2KeybOardgrWheelMOuSe .'I NaturalPS/2KBtLWheelMOuSe Bare/BASFCDDlsk i... . " * . 8109/Lgg : I I ntelPentiumg/BICPU : I Intel PentiumIg CPU

Ftss 1 monlh Inls'rust Accusewith All System pvrchass • Rogers 48Home the Internet on Cable Avihorixscj Retail Csntsr

• RHIKIL® •

Ablt BEO 20 /BF6..........ST99/175 AINDK641400/450/500.$79/89/99 IS'/ 77'/ TS' 020 .....$U9/269/479 Nl XPmt 90/990MB/20N... EN /N/154 ' AsusKl/PSA.............5209/139 AMD K61$ 4N/430.....5113/B9 ADC ts'/ 17'/l9" .....$179/279/499 Nt Rage12016/32MS Fury..... $125/U9 '0 , AsusPgiBF/ C2000 133MHE.$179/236 AMD Kl IN/330/600 $7mp03/3B Amu tz 020/026..... ... S169/279 ATI TVWonderCard....... . . . . . . ... $99 l GigabyteBX20N..............$159 AMDK7638/IN/ON $411 5430/922 lsnml 17 020/026......$299/339 ADASOPWProaGPO /ttpzusgi79/233p25 Intel colo/74NBK ........ $2N/Ds intel celereu744nufm$01/102/Its Bugs/TIN O' Tlsez1024027 ..... $2M mlx veedeo20N/sompsN $739/1Np39 g , PUI$133MHz/ATAUliram .....$119 MAGXi 500T / X17007....... $230/390 ~ ~ ~ 16 MS.... . . . . . . . . .. $169 /1st/209 snmusu D"DP70/ 19' 079000$os/999 N 7 M uk m d . . . . . . . . . .. $H9 Intel Cdm4a u snu/sn$117 Asm VJONTH72/ Ddute 32MS $11$PTO Intel Pili sm/330/6m$333/399/439 NECAsm/5300/ MIN $279/373PN SdelpM sstt740/730$6B/779/H99 NEC FBN25/ Bss/ P750 $399/649/679 Asas N Bezw/Remote/3D Glasses.$103/49 71 I Intel PiilB3fr%...... $999/12$0 HEC 6900/FP950/ P11505670/099/1399 Fujgsu 64/izl/10/13GB..... 9139/149/169/179 ~ B3 / ~ ' ' ' ' ' " ' +N ~ 095 $539 CresgmTH7232MB/ Ukm $179IB9 .

+ pOG "" " " " 924 p /4N

""'"""" $

panas onk BojPse/B0.5B9/295/323 Crestkm Savage4/31MB ...........S109

Maxhr panasonk$03/pLTO/$1905439/$79/699 creagm Gelerecepro..............5305 i X Kl/ 17/2008 ...... ... 3759pm/249 lomega100MBInt/ EEL.. $99/149 Fmmmk SL110/ P110 .... $W9/1199 Ams Geferece 6600 pure/Deluxe.. $340/410 p 13/ 20/3060 (7200qm) 91N/239P39 Iau 2GB SCSIFm ..........$470 Samsung 75N 2rt750$27...$299/319 Dlamend UBraTHT2 32MB..........5233 5 WmtDlgitd 20/276$ (72N) -9271/389 Iamega gpBrhe ztous U$$SB9 Seal 110G/2106$/BN... $310/479/sm Matrez MigeniumG400 16/31MS . $179/B9 Immgll rusts/ztsun5H9/123/24 Seal 42OGS/ 400G/ 3106. $09VOTOD490 Matrm 887lenium G4N DualHead.... $254 I( tgeusudc Bn/5773/B90 $3N/zm/3B MatrmMiguiiumGsmiuax 3181$ ... $320 tgeusmh P$775/FF715 ..... $515/5N RMATHT2 16MS/32MB ........ $99/145 32/64 Ius PCTOO ......„... 32/64MBPCToo ...........$49/09 ~t M I K I PCI $10/1 9 tsewsmlctcsvstse/™ststol™ $1$62%0MBAGP/51$4M8,.„..$38/39 q 64/110 MSPCI33 ........ . .. 997/trs Acer 10/10NT PCI. $23 iL~ EGG 120/256 MB Pc TN ...,SUO/300 Ater 9 Peit Hub/6 Pert.... $$R/40 16/32 EDD729in ....... . ... 543/N DUnk Hsb tqnees/elen $139pB C m ' 4/ $29/35/rsli Bruher 1020/104NX/1250DX Q59/419/540 Dthtk Hvb3pea ". " " " " $N tmwm~ Ezdtsnger Hm $098 Canon2000/ BIC-1000($20 mb aie) $139/09 z • 4 DEBAR ~ Kg . . . . . . .$159 Msogce97rf,(DEss)",",,.",,",,'$149 Q uc slm/mm($mrebm) QmpB ~ • IDE 48X/ 30X/ Umon4aX . S37/63/63 3Cem 9030 10/1008T/ Inid $79/70 18$ HT 4 OWE$us' (DENS. ... $189 Epson440/6N/760 (UNOres) $154/199/339 m. ...... " " . . . . .... H~ a bl e imvse $0/13/B MS Home B.MIUE,emal, ...$mnls Ep arne/0$0/9N/660,$339/420/620/302 71 ""'" ' " "" arun ON/™I - - - - $ 6 I 9 Hewiesi'arkard Pioneer/Teshi sa40x.......$139/129 010/ ON / N5 / 970.... $135/30$/430/369 8 BXR M B I 100 / 2100/ 2500Lmslez . $569/1045/1tm • Hitatki OX...... . . . ' "" " " $169 Admtec tsktdmm 98/200 0 51 33/ 99 7I Pioneer 6X/ luL...... . . . . . . . .. Call 1303/2906 KSI cTRL ....$60/03 ArcPacsimPly Accemsagv 70... 5149 Sjss/N / """ p MS Dgire 97upgrade....... . ... $139 ~ Dem de Card ........ $119 Pmmsenlc6X ....... . . . . , . . . . ,$159 AsmSCus ........ . . . . . .5163 MSWmksukess/Nus90 ....$09/29 3DSemdCm /TamahasON ...Sttpzz

CHmiK(

, EBJ58jlm

MS Wmd97/Earn(Upglade $59/09

Oeative441 6/6424/8432.$269/%9/389 MS FrontPage98 upgrade.......5139 5 d bbu"pct120/E c .. . 3 9/32 3 A / I I P/Plmmsl " M l s/ 9/4N 56KVN/Aq sskmop0$20ps Msm~ u/I VO(~SB9P99Soundblaster liveValue/312$1 ... 979/73 Vamaha4416IDE101....... . ... $369 ~ FNM~ M~ ~ W in Fax 90....... . . .. . $30 Vmtmlm6416 $CSI/ Btez32 .. $299/399 ~ o ' pimn e a 99/ pauhh Ddme... 559/139 Samdblaster UvePlatinum ........ 926s Bme CD/gatiC D 51 05/199 Robogm US 56KISA /PG 902/59 rj • 1 40W Spe ak er.......... .. ... . $ 999 Cmmn Canddge F X7 / x/3/ON, EN/60/N/N 104K47tmard/ ChineseKerbeard 47tm 4/Ch' e rbe $L7/ts d$L7/ HewlegPadrard tenon a000500W........ . . ."" ... $58 KSXWX...$30uP $6 HPLsswjetAXB)LBLULP /60 ~ M F CISNM jt, atBuu0723/4773Keyboard....519/59 200C/3200CU58.....52693 6 200C/63$0 .......... 9520/637 4 pl Sunmmd FP $10mpNL Mstyzn ~ u M/ O p Re g l..... $26/26/16 20/Logguk18/38Masse .. $0/TO/to pj ... $ 30 , Lngitedt Mousew/wheel......... $15 cases slop/Qu/6200$143/185/tm Iustu 450wSpeake r ~ MS Iatdi 9$20/ USBMouse..... $29/8 hler 620P/SC5VU58 5150/1N/160 Malgmmga480uspester/ssbweeier549

Letters Continuedfram page8 theWeb, you have to exercise a healthydoseof caution. I just wanted to oifer an additional solution to the list of things to do to protect yourself . Instead of paying for Brewall software, your readers should be made aware that really great firewall software exists free for personal and non-progt use from a company

called Zone Labs (hupytww w.zoaeubs.com). Its product, Zone Alarm. offers great 6rewall protection and ease of use. I learned about it from a Brewall and internet security s i te: G ibson R esearch Corporation (Osp://www.grc.corn). I h a ve

RealPlayer running on my system land], lo and behold, Zone Alarm informed me that RealPlayer was trying to accem the Net without my permission (just likejef mentioned in his artide). I' ve now blocked it from doing that. With a product like this, there's no reason that Net users should be running unprotected. By the way. I do not have any afliliation with either company but I believe in giving

credit where credit is due. Gordon Moore

A firut look st Palm's colour hnndhsld Continuedfrom page I 0 Add.one ndd up For both newdevices, there is a host of hardware and software add-ons, most developed by third parties, but some by Palm Oue such

device, the collapsible Palm Portable Keyboard (5149), is a useful alternative to the Graffiti stylus input for entering large amountsof text. In total, the company says more than 500 hardware add-ons have been announced for Palm devices, including a Rand McNally

Global Positioning System (GPS) and sueat map softwarecalled Streetpinder.In February,

Kodak announced the PalmPix (US$179), a device that turns the Palm into a digital camera. It wiB be released by summer, according to Kodak. Moskowitz says Palm has also formed strategic alliances with companies induding

Nokia, Quaicomm, and Sony,and heexpects new digital applianceproducts incorporating Palm technology to be delivered later in 2000. — JeffEvans, Ror/ Earn/mart and Megan Johnston

Rsviaiting the family network Continuedfram page35 Multimedia snd Intel have developed VSB versions of their HomePNA products. This solution not only relieves you of the tedious job of laying cable to build a home network (as do ag other phone line solutions), but it mmns you don't even have to lift the lids on your computers. With the USB kit, you just plug the USB jacks into your PCs and the other end of the lines into the wall plugs and, ba-boom, they' re networked. Not only that but if you have an iMac and a PC you' restill in business! No platform compatibility issues.

Productslike these make usag happy. If you aregetting a newcomputer andhave been thinking that keeping the old onemakes a lot of sense, investigate a phone line network. It allows you to share your Internet account, printers, and other Peripherals.

caveat I will give is the obvious f . StetThethatonly two computers require twice as much

,'Msnsursi Kersesni/ukeduesse$35/19 Azar 310p/320sCSI(600) 999/99 Altulansing Ac5459/40 ... $93/163 • Aepacesav subject to chin o wlmvvt nvuce.

A l l saws weva zsu cmh txscowe.

40 APRIL2000 TNECOMPUTER RIPER BC EDIDON ww w ~

vtes.cern

As bred nenes wvt waravivsv we wsutwvs tothee wvpvolve vwven.

maintenance as one. Other than that small deterrent, it's all positive. You might just have to add the title Network Manager to your business card. 0

5nlnn &5nrvfcn Cnnfrn ~

5/nnn l993

•

' •

•

• •n

••

• n•

• ••

•

n •

•

ftnnfop CelmnmRC

AMD AlMLDN IGF"~

Model TPSK59004C-

Model A(760080C

BMSIOp Pll 400 F MMMBMnr..m Model tpNIIP89400sSC

Asus K7MAGPMotherboard Intel440 Chipset AGP NB 128 MBPC100MHz, 1.44MBFloppy ' 64 MBPC100MHz, 1.44MBFloppy Fujitsu 13GB7200rpm HardDrive ', Fujitsu 6.4GBUDMAHard Drive ' ATI RageII 3DAGPVideo, BMB Riva TNT2 3DAomriRtgd Video, 32NIB ' 17uSVGA 1280x1024 Monitor.27 Acer 17e SVGAMonitor, .25mm 40X Int. CO-ROMDrivg,12QWSpeakers Acer 40XUDMA Int CD-ROMDrive '16-bit , 3D Stereo Sound Card 3D Stereo SoundCard/120WSpks , 14n Tower Case, 104-keyboard 19e ATXCSAApproved300WP/S ' ' 56K Int. Voi ce/ FaxModemV.90 104-keyWindows Keyboard Canon BJC1000Color Printer 56K Int. Voice/ FaxModemV.90

fij

• Sn

•

e 6

Bestop PII~

Model fPeIPBS

Intel 440BXChipset AGPM/8 64 MBPC100MHz, 1.44MBRoppy Fujitsu 13GBUDMAHard Drive Diamond SpesdstarAGPvideo, SMB w;S3 Savage 4 AGPVideo,16MB

Intel 440BXChipset AGP NB 64 MBPC100MHz, 1.44MBFloppy Fujitsu10GUDMA Hard Drive

Samsung17"750SSVGAINoritgr,2hnm Q 1 r' SVGA 1280x1024Monitor .27mm

Acer 40XInt. CD-ROMDrive 16-bit 3DStereo Sound/120WSpks 104-keyboard/16nTowerCase Lexmark3200Color Printer Free Color FlatbedScanner

' Acer 40xUDMACDROMDrive 16-bit 3DStereo Sound/16" TowerCase

104-keyboard, 120WSpeakers 56K lnt Voice FaxModem, V90

L.on@tSN3

AQl/6IM ssNm'

Tte

M,QS~

All Sys temscomeswith: Free IntBI PIIMRB .

I19tjwtPllt4iSO:

Intel Pll~ Modsd 4%IIPS Asus P3BF 440BXChip86tAGPM/8

Model IPIBIPBBI S4

Model fPSIPB

119tjSN Pllt667 C

133MHzBus VIA Chipset M/8 Asus P3BF 440BXChipsgtAGPM/8 128 INBPC133 MHz, 1.44MBFloppy 128 MBPC100MHz, 1,44MBFloppy 128 MBPC100MHz,1.44MBFloppy Fujitsu 13GB7200rpm H.D. : ~ Quantum 20GB UDMA Hard Drive Fujitsu 20GBUDMAHard Drive RiveTNT2 3D AGP Video,32MB ATIXpert2000 AGP Video,32MB Asus V8600GeForce Pure, 32INB NFC17" FE700SVGAMonitor.25mm Viswsonic17nE771SVGAMonitor.27mm Creative 52xUDMACDROMDrive Creative 52xUDMACDROMDrive Creative 52xUDMACDROMDrive Viewsonic17nE771SVGAMonitor 27mm

Sound Blaster PCI 128SoundCard

16' CSAApproved P/STower Case 16" CSAApprovedP/STower Case 104-keyboard, 120WSpeakers 104-keyboard, 120WSpeakers

5/ALIBI

n 9 Snstg «%~ C

Is ~ O 5a U

Q/1QQN8Iwpfk Ims ri858 CtQulpuj 7p TV

0 Home Enleflainmsnl O ANordgbl8 Price

Monitor ., ='

104-keyboard, 120WSpeakers

VIA 133MHzBus Motherboard 128MB PC133MHz,1.44MB Floppy IBM 20GB72ccrpmH.D., 2MBcache

ATI RageFury Max4XAGP, 84MB Creative 52x UDMACDROMDrive Sound Blaster LiveValueSoundCard Altsc Lansing45.2 DeluxeSpeakers 16nATXTower Case Microsoft Internet Keyboard

SI,SSS. '"v~~ NIL4fjSS ""sf •

e .rI~

Sound Blaster PCI 128SoundCard 16n CSAApproved P/S Tower Case

Model

IA , M+ , irt

Notebook

Note bookXB55 Netebee

• Intel Cele/on 486 MHZCPU • 32MB SDRAM• 1.44MB Floppy • ~ I ~ ~ ~ • SM886a 488Sp0 • 821IXIRIN • 0.00ILB.• 24X 8060M Intel 81QChipset Video, 4MB • Fujitsu 8.4G Hard Drive • 829250 • 0 0X ma dam • 13eig'I XCFSMk • P in o88r 10X DVD R0 M0IIv8 • Sound SysIem, 8p83k8r5 • Logitech Cordless Internet Keyboard & Mouse• 2 USB Ports ) TF39OXC6N 64MB 4.8G 245 58K 72.TTFT $2,608 • TPI1549 C433 66MB 4.8G 245 56K12.1TFT $2669,- ~ • 1Q/IOQNetwork Card • SSKInl. Voice Fax Modem TPSNX PBI5N64MB 12G 245 56K 15TFT $6,65D • TV Output Connector • Super Iwini Case (12nx11nxs.sn) TP6NX Pxl 65064MB 12G DVD 56K 13.3TFT $5;858':

Hard Drive

Printer

Video Card

Modem

Motherboard

NEC17"AS70, .27mm 9 329 Fujifsu 6XGSUltra DMA $745 53 SSOLXAGF 3 HL124QDX $455 S3 AGPVidsc, 4M B $42 56k Vgginl. Voice/Fax NEC IT FE768, 25mm 8399 Fujifsu IOGB Ultra DMA S IS 5 Brother SSOBXAGP ATI Xysri IZSAGP16MS $12 9 Acer 56k VSOinf. Voice/Fax SSS 8139 Brother HL 1250DX $ 649 Samsung15"550S, .28mm $185 Fujilsu I3GBUlfrs DMA $785 $72 5 $73 9 USR56KPCIVoice Vgg (win) $55 ASUSP5AB,512K Samsung I T 750S,.27mm $288 Fujilsu17.3GS Ultra DMA $288 Brother HLI27QNLaser $729 A TIXysri 200032M S USR56KPCI Inl. Fax V90 879 ASUSP3BFAGPM/8 8185 ATI Rage Fury Msx, SSMS 3399 Brother 1660, 17ppm $1199 SamsungI T 780IFT, .20mm$469 Fujifsu 20GS Ulfrs DMA 3 2 79 ASUS P3C 2000 MI B 9 Attn.Wnndnr I28, I6MB $239 USR58KInl. Vcics V90 $785 Sony I IOGSIr .25mm $299 Fujitsu 17GB 7200rpm $ 2 15 Brother MFCW50MC $555 ATI Asus V6600 GsFcrce, 32MB $339 IBM 4G USW SCSI Herd Drive.............................4245 $ 6 9' SonyG20017".25mm 8 4 79 Fujhsu27GB7200rpm 8 3 29 C anon lggg Color frinnrnorsc 877f 17ms7mmwkmsnr.. '~ . . . ~ 15 SonyGsgg Ifr .25mm $839 Qusnfum13GBKX720gmm 8235 Canon2000SEColor $115' Cfsstivs Annihtnfor Pro, 32M6$379 Vinwncnic PF790 IS .25rnmMcnifcr .......,..........SS49 M sfrm GS00 QIH, szlri8 92 3 9 Viswscnic15' M50 27mm $279 Qusnfum 20GBUlfrs DMA 8229 C sncn 5100 Color $2 7 5 Semmmg fynteusf 27em,frteelfnr.=...mt....m8299 g I/iewsanb IT ET/I 27mm 8388 Quantu m 20GB KX7200rpm $279 Canon610QColo r $289' 3Dk Vccdccs3000AGR16ug $199 Ssmsung 17 7COIFT, .20mrn Monitor..................SSSS Viswscni c1T E773.25mm $389 Quantum27GBKX7200rpm $385 Epson760 Color vfewnanic Eysfb I 9'msnunsucnucr....,.,se.,e4595. $185' 3DFX Vccdnns 3090 AGR 16MB Ireleig........'.....ense Viswscnic 1T PS775.22mm$479 I BM20GB 720grp m $25 9 Epson66QColo r $ 125' sfp sfffc ccxrrprinfnr...:.n.::.............x.......:..Ssss Vlswscnlc IT PF 77525mm$565 Epscn 440Color $7 79' AcsrSOXCD-RO M Lexmnrk 32COCuter prinfnr..........(nfier rebels) SS29' $59 Viswscnic19' E790.26mm $495 Epncn 960 color prsser....: .:..... fewer rebels) SIR% ' HP 6IC Color Pfinfef $745' Viswscnic PF/90.25mm $649 C reative52XCD-ROM $7 5 Brother 12400X Laser printer ..............................5455 H P 8250i sxsxz s $285 HP 61C Color Pfinlef $229 Creative SXDVDROM $129 Vwwscnic I O'PS 790.25mm $679 Bren/mr HL 1270N Network frrimer..:....xn....nxn.:8759 Acsr Sxsx32CDRewrite $345 HP 530Color printer $299 Tcshibs 8XDVDROM MAG Color Flat Bsd Scanner. 600dfri ....................595 87 45 HP9lfgiSxsx32CDRW 9378 Brcsnrt Ccm tsminsmr.„,:,,„„,,.....,.....„..„...,.„.Sssfn HP 210DTNLaser prifrisf$1689 Pioneer IOXDVDROM $769 HP92IOISCSICDRW $389 CreatiVe Annihilatar fvm, 32MB ................,...........8979 HP 4QQ Q Laser printer $1659 SB comp Sound card PCI $22 Acsr 32gu/62guItxcetne>$9r/l18 MS,fn/mdsnmfm.(WISI.Sycfem.fnmsuweefuyl..rn.$135' S ony Sxsx32 CDR W $3 4 9 HP 4DSONLaserpri nfe/$2166 S cundSlsslsr I28 PCI $8 5 Canon830u Ms wlndcwn 2000 lwl system only) ....................8799 $169 CDRMedia IOP k 815.89 HP 3390C/6300U $ 779/529Zip Cm $ 79 e fnf. IDEIcelt tmf $85/I 48 Lexmafk Zl I Color $ 8 9' S cundSIssfsr Livevsbs Intel 440LX chIPset M/B lbtel Celerww.366 S265 HP 6350U/6390U 9849fffsg Zlp Disk 100/250MB $73/23 Lexmsfk Z31Color $ 249 GNT5000A w/Subwccfsf $59 MAGfxricr Flsl Bs d 985 I 20MSsupsr Flopp y $ 9 5 Ss 30 AGP Vld e $99 Lexmsfk 32CCColor $129' A geeLansingACS45.2 n 4MB (eleven 688/433 $299/3 I 5 Epscn 12gguColor Scanner $898 LS 120Disk ' After Rebate Creative 4point speaker $169 $76 14" ATx Tower case C ele ven 466/580$335/369

Bacaa) 08vlpF

canner

Multimedia.,

ww w . ic i c o m p u t e r .corn Ison 303-070$ TECrnteo» 273 9$$0 FAX? icosi 278-$208 et Ve . S Z O 17 SBLES yeL. ey3. ceo ue2E+wv 8I e3'4'8 Fil•w 8043IIHazelbregewaynichmond,Bcv6xsLT suslnessHou r:Mondzcto43esumttd emummu usnm Crsative Gsf ores $2MPin Video Card $878 Linksys EtherFast Cable/DSLRouter $378 Epson080/788Color Printer (&76/46)$$28/2?8 -w/ 4-port 10/I 00 switch 6 Firewall 53 18/390 -one IPArJdress tnr entirenetwork $288 51 5/20 NtC AS70/ FE700 17" Monitor $340

Sony8432 IDE CO-RW kit Plextor 8432 IDE CD-RW Kil

BASF/ Sony CO4I Media (10 pc)

I C I COMPUTERINC.

Pentium III Power User ASUS P3V/8 (MSI 6199) M/8 ts?MHz FSB &UDMA66 Ready 64$8 PCINMHz SDRAM 64MB 102GB Utus66 HDD 10 , 2GB Panasonic 1.44MBFDD 15 NI Lst SVGA Moaner Motnot P4IHi50 Acer 107Win 96 Keyboard 1d128 ATXTower w/J&OWP/S ATI 8M MS Trekker Mouse &Pad Video 44x CD.ROM ~P4u-700

Acer 3Dwnv sieve smne 120W StereoSpeakers

CD-ROM

1578

Pe n tium Ill Dream Machilye ~ Pentium III 3D Theatre i

AcerUSBWheel Mouse

Creahve 5XDVD Driv e 286WStereo Speaken

1878

~P-II I-700

SoundBlasler PCI126 Dvo Sx

q Pentium III CD-Creator L

Intel CC620 (Asus P3V4X)AGPM/8 ASUSP3V/AbltvAOMIB 126 MB 126 MB 15 GB l33 MHZ FSB & UDMA 66 Ready 20 GB ttcuum 133MHZ FSS & UDMA 66 Ready 1?SMBPCIOSSDRAM 126MB PCIOOMHz SORAM NEC IT sx4x?4 15GB Ultra66 HDD IBM?OGBt?ccrpm UDMA66 HDD Mttnitor OVOsx , R ivsTNT232$ AGP Panasonic 144MBFDD 6s8Lm, 8 Rive TNT2 NEC $.27 SVGA Monhor SB Uve RiveTN72 " psimnin$144MBFDD Rive TNT2 32MAGP I ViewsonicE77117" SVGA Monitor Acer 107W90Keybosnl ~ Acer 107W96Keyboard ATXTowerw/250WP/S 1 7 9 8 ATXTower w/ 250WP/S Acer USBWheel Mouse asi/rim Acer USBWheel Mouse Creeve5XOVOtnwe P-III4)50 HP 6200i 4xsx24CD-RW~tx4 SoundSlaster Live IO24 2 0 1 8 2168 SoundBlaster Live 10?4 208 70/mo ONW Spkmn/Suhnooler GNTOMO Spies & Sbwlr 7 mc

ASUS P3V/8 (MSI 6199) M/ 8 ~P-18-550 133 MilzFsB & UDMA66 Ready 1di88 64MB PctcemnzSDRAV 15GB Ultra66 HDO Parmsonic 1.44MB3.5' FDD Rive TNT232?i AGPVideo Riva 17 27dpmLn svun Monitor TNT? 32M ~P4I I+50 Aczr 1st Wn 98Keyboard / Gp 1738 ATXTower w/250W P/5

2228

18 8 8

SB PCI120

All P-III systems come with 5-year service S 2-year parts warranty and one month FREE internet Opfions:WindowsSSSE48738• Acsr10BTEthemetCardvOIO MBWindows2000ProettS8vAcsr56KV90V/F/Modem(HW)+tiOO MSO(fice2000BBE48288 vMBOI(ice200DProvddOO

c ron Net-Surfer . . Celeron WorkHorsea Qthion (K7} Poweraisx, E-Business SERVER,

ECSDual.Stot Mainbosrd Intel Penhum&I CPUxt MS I6153 AGP Mainboard AMD Athlon (K7) CPU Intei L44OGXCServer Board 2888 64MBPCIOOMHz SDRAM Asus(Mcnwiar) ANon M$126MB 1 $ 2 8 133MHz FSB & UD M A66 Ready icvu nm Omm tnl Vum.moSon Cnnlmeml 808 968 smmm 10.2GBUhra66 HDD 6NIB PCIOOMHzSDRAM 12NB PctccmnzSDRAM IMB 126MB PC100ECCSDRAM 1 02GB Unra66 HDD 64 M B 15GB Ulirs66 HDD Panasonic 1.44MBFDD 9.1GBUlna?SCSI7?ccrpmHDOxi 102GB ~~ M 2978 SOOMAGPVMao Panasonic 1.44MBFDD Panaseih 1.44MB3S Foo TNT2 1$88 44X CD-ROM• Panasoriic 1.44MBFDD sum 15. N4 Ldt SVGaMotdtor ATI Rage3OOMAGPVktao 988 Rhra tutu 32MAGP Intel ASTOR0SVR Chassis 0 /mo. zo/nlo KOS IT Monitor IT 27SVGAMonitor Acsr 107Win 08Keyboard 15. IF SVGAMon?or 3138 1008 Kos ™ ' l7" ATXTower si aim • SVGA Cr 008elz 4 Acsr 107Win 98Keyboanl IT ~dr 009efiz , Acer 107Win99Keyboard 17" 27 ~ m t m . u' GVC56KExternal Modem 17" ATXCase w/250W P/S M~gpt ATXTowerw/300W P/S Monitor ~ ' Acer I07Keyboani MSTrekkerMouse+ Pad Mecum 8 8 8 t atm' MS TrekkerMouse+ Pad AcerUSBWheel Mouse 2BMOuzet Pad 'OCOIHD /mmrn 44x CD-ROM 1828 44x U-DMAC(hROM Creshve 52X CDROM 52X CD 3D WaveGenmsouml Opthm: & LAN ™

828

1028

120WStenmSpeakem

9 IS

56KModem & INOO BaseT LAN

Acct 3DWavesternosums ATI OM 1088

SoundBlaster PCI 126 SB PCI128

120WStereo Speakem

?OO WStereoSpeakem

Video

2098 stslmo

AdenineARO.I i?c U2adddt cats $418 Inn/pm/feovSaner Adsptet 0140

stmNIIO

All Celeron S AMD systems come with 3-year service $/ 1-year parts warranty and one month FREE internet Options: Windows9SBEedt 88 • Acer 56KV90V/F/Modem +ISO • Acer IDBTEthernet Card+OtO• Upgrade 15"to 17" Monitor +SOD• MSWindows 2000 Pro 48288

sQrives 8rControllers PCIN SCRAM3?M/64 $ 556 /76 PCIOOSDRAM12N825N $15$326 PC'l 3364M/128hy256M $96/176/350 ECCPCIOOSDRAM 12$8256M $1ONN 72 pin EDONY INI/32M N $ 45$6 72pinRepSM /ION/32M $2$45/88

Es))bm(UDMAN IOE/U2WSCSI) 10261$17/20G

$16 N N 2 N2?8

102/13/20G(7200rpm) $18$?Inner

e.. ~ Printers~

Scanners. ~ Acer 6?OP/620U /620PT $138/14II?46 AGFASnapscant?t?P/ 1212U $13$t48 SIN Canon330Ptsmmsvm) CanonNsptsasl M46 $166 Csrmn 4?out-Izot Epson610/636U/12NU $ 218I278/346 68 NP 42OSCUOS HP 530OCUsb HPN00C/Q560 US B $51 $6$i Visl oneerOnetouch 7NO UOB Siss tnslanaer Coicmdo 16260 068 6129

Acer 66KV.eeYourn/Fax PCI(HW) 650 Mclorols56KV90Voice/Fax PCI(SW)$36 USR56KV.OOV/F/M Inl PCV(HWI 970$9 CrsathmWebcsm Para/USB SIONIS C reedvaWebcam Go US S $19 6 Intel PC Camera (USB)/Pm SI I N 76 LcOiiech QeaomuSnmtmuaa 660 Lcp'lwhQukaoamUSB $110

QQIDLEIIBM?

Canon IONSEI?OO OSEI4ZW4?0)$7NIS

Canon51N/61N(NG?0) $22$2N

E peon44O/Mo (484/5) SII N 2 6 Epson740/745($7$PO) $1 50/250 EPson760/750(-$45I0 ) $21 $3N 2$27G IMNA7?scnm $?6$ ? N EPmm66$OON?cctststtMI 6?OOI510/676 88$LQE B OG/ IOGU2WSCSI $39$636 HP 610$3$0 N N?$2 66/?N K66~ 50$533 $88I98/125 e680t (Ulba66IDE) HP 930$508% $26&/418$66 ' nz 64$55$ N$656 s?6$?9$?ss/?N 102 / 15/ 2OG stsert N/?I 6 .Iapkri Bene/ Ket Cams g". HP 112$122$2000 K77N75sr N$ aso?$57$64NIss 27/30/40G Lmunark211/3200 (-95$.650) 356/t46 13/2$27G t?see m SIN 2 5$308 I(89LDEB MBIEBONBIM22(td? Iewnark Z31/Z51 (-35$-$60) $19$290 $326/436 LCD l DVD I Soun4@) PCI toUSBCwd/ USB4 Pmt Hub $40/55, Cekum 433/46$60$5N $11IV12$16$?N 30/4OGt?mtum L800LE?)ntpz ' P&I 5969/5505/4006 4 3 4$?N436:Q69ISI00 (UDMAOO IDW U2W SCSD $8$8)IN Bmmer to?$ tosoox Issml $29NN P.6165$7N//5 0 $5N/ / 6$988 KX 13/20/27Gt?mtum l ? a t?969 Amr 40x/40x/52x CO-ROM $55/6$/0 12OW/26OW 615SI Brother 124ODX/1250DX $4 48/540, Creative 52x /Toshha 40 x $7 0 /N P-lli 5338i667f/33 8OOW Sell GNT5060Ss t 84$6 0 : ..Brother 4350/8300MF C .' Aazs IV 9.1/10.2GU2WSCSI $366/626 659 0/730: CreativeDVD(5x) $138 AltecACS33/4$5840 $68/98/108/178 .;, Btoswr 240OC/2400CNColor?266$3190QONSO(U2WSCSI) Aliec ACS AD& 305/O N $2 35/3N I 8 HPMO&/?IN?IOOTN $550$7N376 .-: Bwr 9/18G U2WSCS I $5 30/1030 PioneerIcx IDE/6xSCSI 0VD $1N/198 Cressve 4point FPS160$2099$126/269 -~+ SigmaDVDContmller PC I $118 8 Cheetah 9/ IOGU2WSCSI $828/1418 HP I IN&/3100CMF C $N &ION: m K6 CreaihnTheaba5.1 $380 HP 3150 $828 Acer 3DWave PnP Soun d $16 Asus P5A 8(AT)/ POA(ATX) $12$128L •)fis&IO ILQl I SBOUU-DMAIDE) HP4050/N $1598/2068 $110 ymnsha MS30 spealnt/subwccht $90 AslmK7?6(AMDKt) N18 10/13/ 20G $178/198I?46 DiamondMX300 Vsmatmm?sspedwr &stsmxmhr SSS HP 4050TN N266, 15/20/27G 7200tpm N I 8/30$398 SoumtBkmer Etucniql 128 PCI $36/50 $8IBM$ , GI0abyleGA-7IX(AND K? ) SI N HP 5000/N ?2090)2986 Mmrostzt$ 34195 (AMOK7) $ 1N SoundBlsster PCI 51 5 Uve I 024 8/0//8 LoOllech28/38/wheel mouse $1$16I20 HP 5NOGN $3738 soummtashu Lhm plHlmmr MN &dstds& (scsl Adapter) tsBmouse/US B $28 /32 HP 8NVN Bob)ISIILBILMM8$8068) 2930U / 293002 513N26 SoundBlas ierIhm XSames SI 36 MS In $296$36N ABII BF$ 0564VVAO $175/?SN?e AcsrUSBwheel mouse Nl $4330 2940U2W/ U2W Kl t $32$389 HP 8000DN r Asus P2-99/ P3B F $145 /185 ~K HPOIGVN 637$v4t9s MRR$310/390F SCSI tukczw $6$1N Acer107/Fuywu872 5 $13I 20 HPOINDN AsusP30.20NPOCEPuuraus) N2$270 $4848 CcneessKSa Whmammse St?6 Znt INMlOE/Para/ USB SSN4NTO Asus P3C. D ~ SISCSO 656$598 HP 4$ny NCtaor $3538/4198 Asus P?BD/P?BS/PMOS $38$45$6N ZIP?50MIDE/Para/SCSI SIN?4$240 MS NahualHeybxud /USB 636/69 HP 4&N DNCohr 65398 81$25 GkmtnzeOvxE+/svxdx $1 1$168 TacmarIX?oMaxProIOGInz N3N$4N NIS ZIP 100M/25OMDisc HP 8500/ NCoicf Inlet CASIOEA/CA610EAL $19$246 Oneeam NGIDE/SCSI Inz $3NBN JAZ 2GSCSI Inl/ Exl $448 f450 AT IF/tstoase&250WP/S $3$48 HP 8500DNCotw $11998 JAZ IG/2G tnsc SIIN?0 m mtCCO?ONA/CCN O SIN I9 6 Onslream30GPat4$CSI Exz 655$/N ATX IT/IV Case &250W P/8 $5$60 lnnnwkoplra INS ts?5N $145N828 $69 Ramov abh HDDDrawer SN Iaxauuk Qplra1855/ t655N $156$2028 Intel SE4400X2 $1N OnsbaamSO GOhc(34mdd $1 38 JAZ SCSI lo Psralhl Adapte r l HDO/CDRomHolder S N LS120SuperFDDInL/Exl. N$ 228 Externa intel N440BX/L440GX(server) 8/N750 Ssa0ate 8GSTR4 InL10$$$ 8?NON Sanmmg SIOOA/606 0 $3! N470 LS120 Disc $13 Sat pan/HDDFan 81$16 Swnsun045000 MFC $428 MkzoSIWMSI619$8153 $12 $128 Ssagats4/SGBDATSCSIInl N?8//N 9.1/ IOAGU2WSCSI

e a (7?NrpmIDWU2WSCM)

$348 $48

r35etbe~r rdsz

RAPk4AZ-khan2OW

• nxmsu bases on ssmunih, 10% huyouz• Aspaces Ieiieci 2Ã cash discount ans ars sub)emto cnanae without peur rmzca • Ail imsemarus ara the pmpeny ot their respective ownem

TELEPHONE:

Ikul wmNwvrolh r~ e

@i Iipp)I pg ~ ~ I~

2 73- 13 6 8

Intel Ceieren 466NHz CPU

Auth oriaeli Solution

prrwraer TV OUt Iueeumddvdwf

For asoo

212X2ISx$2IIHB

14LESIIeoe)303410S TECH:Iooe)213 a9SSO

FAX: Ieoe)21$-526$

ILqa

2 u Z

IC/e porker stere

Web:www.icicomputer.corn email: icilicicomputer.corn

rl ers Plextor

HEWLETT'

8432 IDE Kit

XE2 CA?3 QM AOG 12.twr 2IX 5 IAG I 1a S

HP 9110i Int. IDE Kit ISX4x32) 3378

I'150 P0466 64M 408 tsaor 24X 41N Pl-366 64M 848 Is.tor 24X 4150 PII466 126M10.1G M.lm WD 4150 PIIIASO 64M 10.1G I • .Iwr WD I 4150 P IISSOO 64M 10.1G Is.tor WD I

HP 9210i InLSCSI IQ (Bx4x32)$378 HP 9210eEXLSCSI IQ (Oxsx32)$488

'msHISA

Creative 6432 lul. IDE lmfsrfrfcf$378

HP 8200i Int. IDE IQ (4x4x24) $278 HP 8250 InLIDE Kit(4x4x24) $288

HP 8210e Ext. USB K d

3COM

PACK

5398

HP 820e Ext. SCSI/ PCMCIA 5498 Panasoni c4x8 InLSCSI CDJI $208 Panaam 8432be.iDECD-RW $350 Rextor Q32 Ink 035CDJIW K95378

Raxtor gx2x20 InkSCSI IGt $835 Sony 8432 Int. IDE CDIIW IGI $348

Sony8432 Int. SCSICD-RW $360 Yamaha8424 InbIDE/ IGt $388/4?8 Yamaha8424 tnt. SCSI/Kit gdtg/468 Ybfnaha 0416Ext. SCSI IGt $498 Ymmha 8424ExLSCSI IQ $$88

Qo4M aw Sgaah BASFISony CDJI (10pc) $1$20 Prhum SXCD-R (1$Wpc) $178/IS? Prbco 80minCD-R(I/10pc) $2.$28 BASF/Sony CD-Rewrheatde $3AS/8

S I K $598 W 1 i15N OI N Q M A OG 12.11eT 24X SOK $25N

SIIN Itl m 04 i a 6 4$ 6AG II . ITFT WD 56K $325I $61N Q O C05 6 6NI 6AG 10AIFT 5 6K $ 25$ O IN 390 X C 460 64M 4.0G 12.11FT 24X 56K$?IN SON 390 X PIII450 6IM 12G 14.11FT 24X 56K $4090 l aiO 3NX P II500 6NI 12G 1 51st 2 4X SSK$45N NOX PIIH50 6OI IG 133lvv 24X 56K $4540 IIN PII560 6ol 12G I 33lfr 24x 56K N290 IOOX P0500 64M 12G 133IVT WD 56K N498 ?tsfxiu KF~IIAV) Xrff 43G 121ciiv ?XX 56K Sf/dd SNX PI%50 64M 12G '13.31st WD SOK $5838 215bm $5475 QM 43G 12.twr 24X 56K $?IN ?diikwo C-433 6IM 68 f k iwi W D 56K t?368 GDOcos C56 Q M 43G tafom 24X 56K 9?IN C90xum CNO 64M 6AG tktfrv WD 56K SION 41NXom POAO O QM 6AG Is.tnr WD 56K NIIO SON ~ ~ I W t at ~ ?I X ~ N 0 42NXomPOIASO651 12G t4.1fvr WD 55l QSO 514f Ca i 6 6 IM I/XII2,ITFT 24X 55( S ? 4N 466 6N I 14. 1 4?N Pul dee 64M i?8 14 frrr Oi/O 56K Qmm 'll 3IOT PIIA506OI 68 12.1 TFT24X SIK SO N OIN PO N S 64M 12G ts,twr mfD 56KNIN 342T Plldf56IM 9G 12.1T FT 24X 56K $3330 OIN PI IH50 1BQ108fotrrr WD SSI Nam 730TXV I'III4506'fl 6G l c iTFT KX'w' dkK.w md 73?TXVPISSOO QM 9G 14.1TFT 6Xmm56Kaa $3538 7341L PIIIQOQM 12G 15TFT 24X SII4uw$4190 E5140 OIN 6 5 l 8 4 G 133wr QX 56K 3?IN 73SIL PSHi50 12Q18G ISIFT ?IX 56Kuar $4588

Aaae s

FU ITKIU

EN20 PIIK45064M 108 133or 24X 56K N598

HP HANPHElP PC HPJornadaSO(1SD

$636

E6530 Pili 12 8M 108 14 iv x c r o K HPJornada5$ tlmemull NO(Nmeml $1 IN/1330 54510 PISAIN 64M 648 1?.firr 24X 56K 53?ed HPdemode8?0osm665 omxlmt $1350

Palmpilot Slo/ lllxaf IIN $

Fa(SFilotVl Vx

228 /38%98

$84$/ESS

5!NAILS SSQ

Adapms1350lfmi SCS Rmdel Rrl Im SOO Adapmc lai0$1480ASlmSCS K l 917 $245 AdepmcUSG?ON USBKl $50 tmelPiet N Wl Canausf nsalporl $20$2N Mml Prolm IANrdIK Modeii Caa0kmnealsorl Q45 Linksys tOSTElnemelPCMCIA lro MoOaHorm?CXFE57487 1$100 $172 MoOaHMMOC CFEMSN SIK mxkm+ianN

VMngSOKPISNXA FaxModem rim Nrcomnealpert56KVOO+liy1OOB T X ircomneslporf 10/I 00Summa Cardbus

NnmmReabmn 55KSoberAccess

$?N 12 10 02N

HP 6?uc IXIX32 CD-RIVPCMCIAGCS I I 496 Nao Soluam Bauam24XCDIIOM $230 Ifiao Sokdon Banmm24X CDwBound 0255 Micro Solution 4X4X?0CO.W ' afualpon Illa/IIS Noylaeb TVTiemr PCMIXA $222

3?/6$ 12SI $8$12$236 IgaoSotubongaskpaatAIINFD Q68 mao SoMionBackpack 6AG Nard DmmPaa. 53/5 IfiaoSokruoa Backpack&AG Had Drum Pore 3426 NM $12/ 1$25GB?5' HDD t3 66/asm%NON Tcsbxm 6If 1?f 1OG O?.5' HDO 636$466/668 Targe NolepacCNOI/CN?0 $41/30

Dialer@ ~. ATI XpnPCI4M/Xpt PCI 8M .........$6858

Aver medi aTV Turner/ATITV Wonder.$108/108 ATI Al-in. Wonder 12816M/ 32MPCI $235/318

3Dhyoodoo320N 16MPCI ..... . . . ..$138

AGP Vilh~ocar 3D LabsOxygen VXI 32M AGP ........$318 Asus 3800TNT232M/ w/3D Glasses $21$278

AOC IT 78ir.26/19' 98lr 26............ $298/460 Aeons/Prov'ow i5 /iT / N .........,$178S7$478 Milsubisli 17' DP72/ 19' DP91............$535/798 Nfilsubishi 17' DP7 1 08 / I If DP900U ....$57$940 NEC IT AS7$ A700+ / E750.........$31$398/628 NECFE700/ FETMN / FE750.......$39$46$528 NECFE950/ FE1250...........................$72$1268 NECFP950/ P1250+ ...........................$91$13N Panasoni c1T E7$ SL75 /PL70 ....$318/398/498 PanasonicSL95 ttrg5/P110 2I'25...$QSI168

Network Interface ~

100Mbps HubsS Switches

?COM3COO58.TX 1$104 PCI Cad 5/3 Acer 101ISAI 201PCI 148sseT Combo 3 15/16 Acer ALN.3?SC1$100 PCI Cad $25 Ddka OFE.530TX1$160 PCICard $25 Inlel PILA S4600 Prolcu 1$160 PCI 370 InmlPIUI8470Servsr Adapter 1$100 $145

3COM3C16750 ~ 8 Rxt 1$'IOOST 33?0 3COM3C16751 ~ 16 P url 1$10087 $465 D-Link OFEef54 Port tfst00 H ~ mc 31 60 DUnk DSHO1$100 8 Rrl Hub $218 Inml luguwsss SHIOO TX44 Port Hub 100 $ 1 48 I ntel I Business SH tOOTXO8 Port Hub100 $5 i o Inlet brBumwssSH101TXO8 Pat Hub 1$100 $288

~ ] 0 BsseT Hubs~

ASIHsh(j)DIRGE

3COM3C16951$941103wikn110012PWI $955 Acei 5 Port Hu b 350 3COM3C'16950 89fl 10 Srdbb 1100 24 Pal $1365 Asus 6600 GeForce 32MPure/Dekue Q48/366 CompexONJIS+ I BNC 0 PortHub $60 3COMOC10951SSX 1003with330012Pat $1695 ATIRage3DBM/Xperl988M .... ...$5$80 KOM ?C19260 5 Port Hub 560 3COM3CININ SKI 100 Siikb 3300 24 Port 326?8 ATIXpert906M/Xpert12816M .....$98/120 3 COM 3CI6440 SS II EnbyHub12 Par t $?2 0 DUnk OLG&Sr I Pat 1$100 Swilcb 3176 ATI Xpert 200032MAGP ....... . . . . ..$160 ? COM 3C16441 SS 5Enlry Hub24 Por t $34 0 IKLink DL.SSO I Port 1$100 Switch 3266 Samsung 5508 15"/ 750S 17" 27. $ 185/295 ', ATIRageFury32MBAGP/OEM....$190/188 3GCM3c16671ASs II Ikdr1024 Pat 01288 Inml InBuskmss38101TX08 Rrt Switc k $3$ Sony210GS/ G200 ................................$496%28 scom3016700 ~ a l po OIN Ail Rage Fury Pm 32MBAGP .... . . . .3236 Iukl Expmm 41 OT 1$1 00BT 16 Port Snack $ 8 86 300$3CI6704 ~ V IPO 970 Ireel EXPmm410T 1$100BT24 Port Sekcn $1 186 ATI OfrHarxQ 128 ISM/32M .....022$310 Sony IO* EIN / GN O $708$N Dkkfk OSIN TP/C 5Port Hub SN i dickeys Eumrsasi Canis/DSL Router Creative Geporce 32M/ Pro 32M....332$376 SonyE500/G500............................. $15I$1598 wrs-keir 1fvf os sworn s Finfwes OIink55009 TC 6 Pat Hub IN S2Q DiamondS540 32M /2200 3?M .... Bt 28/268 DUnk DEAI12TP+ 12 Rrl Hub $205 Malrox Mlkxmium840016M/32M ..$168/198 DUnk DEIIIO TP16 Rxt Hub $226 : Malrox 840032M Dual Heal / Mex $246/206 D-UnkDEANI TP 24 PortHub 3345 , Exabyle Biaet 820 14GInl/Exd $186 52248 Malrox8400TV10M ...... . . . . , . . . ..SSN E 651 1 5 ' 2 8m m 1280x1024 $ 238 Inbd InBusiness SHOT5 Port Hub $72 5 HPBGBIraf Ext(XXTDmm 399$1166 Voodco32000/300?VJSOO16M, .$13IVI 9$2N Q yt 1T 2 7mm 1280x1024 $ 3 18 Inlet IngusinessSNOT 0 PortHub $90 HP 24GBInt I Em OAT Drive $13GV1550 8 73 iT 1SNK1024 $ 398 Liuksys 5Port H ~ cob b Kk $92$3228 SQ HP DLT4088 Ira / Ext Ome Q SN S SeagaleOGS?$4 tak SE/SCS Tape Omm$3?$3N V 75 1T 2 6m m 1600xt280 $ 4 78 N elgearEN104TPV EN100TPPort lka eOGB 4mm DAT kfOErtSCS Ome $788/968 $5$82 Seagal E 771 17 2 7m m 12Ski1021 $ 316 SIC 355T Sf ?NOT8 Purl Hub Sea$de 24GB«nm Dky ld/Exl SCS OdmSIQSI?20 NEO 1525V/1525M15 " $14 28/l578 ir 1600K1280 $376 Seny SDT7000Int/Efd eOGBOAT N7$ 1 1N NEC?ggga/?Stgs tg' $?$78/?8$8 G773 1 T ~ m 1SNX1024 $ 390 Sony SDT9000Int/5524GB DAT $ 131$1500 NEC igr TS"w/Touch Screen $1088 Onskesm ?OGSIOE/SCS Inc Drive sw incr.I?N/550 $2888 GS773 T T 12nx1024 $4IS NT Serverv4.0 CDw5 Cfienb Uc. NT v.4.0 Giant Access Uc. $48 Onslresm 30GOPara/Scm EKLDmmm inct$55$IN NEC 18?01 ig"/2NB I ST $48 88/Sm PF775 17 ' ~ m 1600x1260 3 476 Window?INO Pro I?06 Samsung 530TFT 15" O'I560 P6775 I T XSm m 1600xi280 $ 4 90 Window2000 Senor wf 5 Cbum $1260 TNaom onM VP.IIGG 14" $?288 E 790 19' 26m m 1600x1280 $ 526 W indow2000 Adv. Soma o/25 Clm m $49 98 BackUPS~ $12$13$tN Viewsonic L700 15" 51 368 PF790 19' 2 5m m 1600x1280 3696 BackUPS~ 42$ 5 5 0 ~ IN Roanmnic Wa isg VG?50 ig $?SSSNISS PS?90 1 9' INOX?2N $ 7 38 BsckUPSPro INSIIN $535%80 ViewtonicVPD15015" (fgglfd) 51498 G610 21 SmatUPSSUI?$8UO?$SII000 N 5$ 43S//15 1600x1260 51099 1$IQ BaeeT Crtrm10I?5/Se/tarn N SmarlUPSSUIIOONU?200$INON $93$131$2070 YMNOtmic gal(sir $8728 P810 21' SS mm 1600x1280 $1190 lfy100 BassTCabmBrdf per 0/ per IOONQ/IS/?SC $.3$198 Pmkmdonrt SurgeAfmrt 7/Tfd $4354 V(otmfm(oVPDtteiSSP ig"(tgggte $09S P 015 21' gS mm 1800x1440 $1298 CampingTorti IUM/ BNC $2550 NetworkSurgoAnest 7/Tel

6)ertrer/ Network Tapes ~

INS Windows NT/2000

, APC Power Protection

~Network Cables <

ut/65

no pikes resect?tc caskfsscoumendare subject locnanpe wiomul frfa aoaca. •

Ao oedemam are a» mepenyel mar espeaive owmrs.

< OOT-COM

HOME x

ISB gives LAN high-speed Internet By David Tanaka

P PPoE ( p oint-to-point pr o tocol o v er to-PC communication situations (some

your Internet account, and select the service

Ethernet) is that ISB 2 LAN supports PPPoE, Internet-based chat, conference or gaming fyou have an Ethernet network and want and also dispenses with the access manager. applications, for example) where you need or to connect it to the Internet thmugh a With PPPoE, usersaccessthe Internet through want to reveal your individual computer's IP cable or DSL (digital subscriber line) con- a dialm-like interfacecaUed the access manag- address. Sut otw ICQ continu«s to work as it nection, NexLand's ISB 2 LAN is worth a dose er. Even though it could be scripted into the did before. And ISB 2 LAN does allow you to look The "ISS" stands for Internet Sharing Windows startup routine, many people don' t move one of your compu tersfrom behindthe Box. and the nmnc says it alL In our home like to. Using ISB 2 LAN eliminates the aced 6rewag and expose it, unprotmtetL to the big

(we picked PPPoE, which the Sympatico HSE

ofgcewe created a peer-to-peer network and conneted the LAN (local access network) to the Internet using the ISB 2 LAN. This

to.

The device, which is about the

size of an external modem, has

gave us transparent (and speedy)

two 10Base-T Ethernet ports and a power socket (an AC adapter is included) on the back The Ethernet cable from the cable or DSL

internet access from aU the computers on our network

IBS 2 LAN From:ISBCanada Tel: 877-254-0092. hnpdtwww.isbcanade.oom

modem plugs into one

Suggested retail price 2520 One of the added benegts of the ISB 2 LAN product is that it creates a firewaB between your LAN and the Internet at large. Fmm the out-

side, yow LAN shows up as the single IP address assigned to the ISB devic». On thc inside, the ISB can work as a DHCP (dynamic host coniiguration protorol) server to provide dynamic IP addresses to the computers on the wenvork.

port, and the cable to your Ethernet hub plugs into the other. Once you configure the devtce and type in your u sername and password, each PC on the LAN has fuU (weU, almost) access to the Internet. The "almost" refers to some restrictions you might encounter under some con-

ditions as a consequence of being behind a 6rewaU. This is not a limitation of the device itself, and being behind a fircwaU is generally a

A third benegt for DSL subscribers who use very good thing. However, there may be PC-

servim uses). Hdp and a user manual are included on tiwec diskettes, but wc found the written instructions dear enough to get the devic» up and running in l«ss than 10 minutes. The next stage was to add the second computer to the LAN. This took two steps: bad Net. rnstalin g and con6guring a aetwork card, and then creating the network by adjusting some (nota ration network settings on both computers (e.g., We recentl y added a new computer to our making sure both computers were registered home oiUce, and it was the only one connect- on the same Workgroup). Within a half an ed to Sympatico's HSE DSL service. The old hour, we were two for two. computer is on another desk across the room. The third stage was to add a notebook comWe had intended to build a simple network to puter, which was already conBgured to operate connect the two, and when we received the ISB on an Ethernet LAN at work When we tested 2 LAN to test, it seemed like a good opportu- HomePNA (which usesthe phone line as the network cabling) and wireless HomeRF prodnity to procewl with the project. The DSL modem was connected to the new ucts last year, we found that neither coa sted computer's network interface card (NIC) by a with an Ethernet setup, so we were unable to single piece of network cable. The Erst step in move thenotebook from work to home and the project was to add two devices —thc ISS 2 easily establish a network or Internet connecLAN and a network hub — to the chain. (You tion in one location without breaking the setwiU need separate lengths of Ethernet cable to tings for the other. With our notebook computer, it was a simrun between the DSL modem and the ISB 2 LAN box, the ISB 2 LAN box and the hub, and ple matter of plugging the network card cable into the hub, and booting up the computer. the hub and each computer's NIC.) The "manual," a few pages of letter-size Initially, we rcccivcd a "not online" warning paper stapled together, describes how to set the message in our browser (internet Explorer unit up. Typing in the ISB 2 LAN's IP address 5.0), but hitting the "try again" button was aU in your browser reveals a control panel utility. that was needed to gct onto the Net. We also There, you typeth«username and password of Continued ou page dd

www . ic i c o m p u t e r .cor n

lg I C I COMIPLITKILINC,

LEep uncavm smw onesuuwsw

Intel' In Business

Small Office Network • Increase productgvgty through enhanced commun and resource sharing • Increase productivity and employee collaboration • previde trouble-free maintenance and management • A complete solution including multi-function network appliance, hub andgadapters ' '. 5 port 10BT Hub 8 port 10BT Hub 8 port 108T Hub w/BNC 4 port 10/100BT Hub 8 port I DOSTHub 8 port 10/100BT Hub 4 port IO/I OOBT Switch 8 port 10/I OOBT Switch Print Station

$78

Internet Station

S SU4

E.Mog Stotion Storage Station 12GB Storage Station 2dGB

49gt8

SmallOfhce Net ork

SOB $118 SI SS 426S $288 62 3 3 $3 48

6235

• Figewali

• E-Snail • 8 pert Hub • Engbeded 0$ • Share printer M SR P

$1298 US $ 1 499 (I3eS) ST798 STS rr8

Small Office Network Plus 520ty8

US $ 1999 (2beg)

44 APAL 2000 Tttg Q34PLrKn PAPERSC KrnQN wwwowudaconauus.corn

A Complete Solution The Intel InBusinass Small Office Network is 0 mujg-funcUon network appliance. Simply pul, it combines alj the elements you need for 0 powerful network. You' ll get tzn 8-port hub, 13GB lwU)t an option of an additional 13GB for mirroring) of storage space, POP3 client n.maij, mirroring lopgonal), built-in modem, Nvo natwork adapter cards (sjtippatj with the Small CNica Network), fjrawajj software and embedded oparagng system aji in one convenient box. So instead of a massy, dijficujuo.managa sal of nnivvorjcjng solutions, you ga) one package Ihat meets ajl your needs. It's the most cospejjacgve way 10 gal your office connected.

I n e a CC e S S A e Io w II s

mont

Free: 3 months FREE

free:lasVesas laekale

Free: Voice ever IP Free: Bonus Ellseounts Free: Technical support

'09.$9is tbeoverusemontblxcost of ourannual subscrfntlon. The"3MONTHSfHH" ls

ta aaataontoIts otternnnataaatosaeoaoeroontatorsre aeaa tnSaae. attsaasortaaons g. mnlbe NaldlnfuH,inadvance,andnuetedyrfces donotlnclndeannHcable taxes.

a, Q.g.

< OOT-COM

HOME w

Digital dotdees go nu nntursl Continuedfrompage28 (like a rile shot) while still picking up thc delicate foragingsof your target. Shopping gptn • Nom.

functions (of varying appeal) to be combined The most practical consumer-level hybrids within a single unit, There are rmgegnders show up in the wide variety of wrist computwith built-in dinometers (for measuring ers on the market (I' ve heard tcg of one that slope), for enunplc, and weather monitors has tide tables for 175 beaches around the with built in altimetcrs (to measure and rmord world programmed in).

Pricicr independent units indude such things as altitude and temperature compensatioa circuitry to yield the kind of precision a professional forester, surveyor or biologist might require. The Suunto Voter Altimeter Watch

altitude). The KVH DataScope,for example, is Traditional outdoor equipment maker a pocket-sirrxl monocular with abuilt-in com- Suunto (htl/x/Arww .muatncom/) sells a "watch"

for therestofusyieldsFarlessaccurate read-

Hybrkls Pri cerange:Ospendsoamale,motsaadcsmbiaatica oi iasinmsaia As youmight expect, thedigital nature of these aewoutdoordcviccsallows forawiderangeof

pass, rangdinder and chronometer. GARMIN

that iodudes a barometer, altimeter, digital

(htlp://isrm.gsrm la.mm) even makes a popular ceg phone with a built-in GPSreceiver, but at

compassand trusty dock—combining many devices that would otherwise be purchased

around $1,000 it costs considerably more than separately. As with the Casio GPS watch, howpurchasing two separate devices. ever, the trade og is in instrument accuracy.

ings but can be had Ssr a tidy $275. Pmfessionalscan expect to pay at least $350 for a digital altimeter alone.

What Rolph says: "Hybrids protect the pocketbook for someone who may not be usingsuch devicesevery day.Foronesmaller price you get three, four or gve instruments in one. And there's a wide enough variety of

hybrids on the market that you will Bkdy find a combination of functions that suits your neath. If I was going into the woods, I'd want to take a GPS unit and, if hunting. a laser

rangcgnder. But I'd still be packing my trusty old analoguecom pass."

•

' 81art--

Interest in these digital devices continues to grow among.consumers as their prices contin-

ue to shrink They arc nowlargay regardedas a practica) purchase. "As more people use

It's so Domain Registration Register, Reserve, and Acthfate your Domain Name (yourcompany.corn)

Today!!

• /trna. Sumndng up

to Finish ln Under . R tignt

Blazingly Fasr

Shopping giim:

EASY>

them," Rolph concludes, "they tend to Bnd more uses for them. But it's important to remember that these things don't make you invincible out in the wild... Batteries can go

dead, satellites can go down, signals can be blocked. That's why it's important to still have

all the basic outdoor skigs—aad a traditional

Over SO,SSO

Companlea have registered their Internet Domain Name by using QetDomaln.corn.

compass snd map as a

backup."0

ISS gives LAN high-spood Intortmt ContinuedPempage44 used a simple trick of giving the home Workgmup the same name as the Workgroup at work sowe wouldn't have to keep changing this setting as wemoved between the two locatlolls.

The ISB 2 LAN's only rough spot is the crudely presented documentation. Luke Ippersid, president of ISB Canada, the com-

pany distributing theproducts in Canada (the

Complete, Friendly, and Easy to Use, Hosting Solutions from one of Canada's Largest Hosting Companies! td/f 30 Day Money Back Guarantee

g SameDaySoup v/r Online Hosting Toolkit Management

Easy to use,

7 step process, allowing anyone to reserve their

Domain Name over the Internetl

g Phone andEmail Technical Support , g AutoRgspondsrs, Email Aliases,

Email Radirsctions,WsbDemographics, CGI Tools, INicrosott FrontPags,and muchmuchmorel

QAQ+jS j~~ iH Ti etnc,'7

Best of ail its Fast and Freei

info@getdomain.corn

Try it

1-888-343-INET(4638)

Today!

'Dogsnot include Agency fees.

manugrcturer, NexLand is based in Miami, Fla.) said the product hsd previously been targeted at Internet service providers and telecommunications companies. With the pushto turn it into a retail product, the documentation is being redone, he said.

Summary We are sent many products to review each month, and the acid test of what we truly think about any of them is our own response to the question "would I buy this product for myselg" In the case of the ISB 2 LAN, the answer is "yes." With a suggested retail price of $520,it seems expensive for a home, but less

so for a homeotgce, and degnitely affordable for a small business. If you don't have multiple computers connected already, you' ll also have to consider the expense of building a LAN. This indudes the costofnetwork cards ($30 to $60 each),a hub (less than $70 for a Bvc-port modd), and laying the network cabling. However, if you have an existing LAN (or arc pbnning to install one), and are contemplating gening highspeed Internet access through a cable or DSL connection, ISB 2 LAN is a slick solution. The

ttuoi machines wcusedto testthe product all ran Windows, but ISB 2 LAN will work with

Mac, Linux and other OSes that support TCP/Ip. 0 dg APRIL mo 1HE COM sPVTER %PER SC ED/llON www . ~

es.c ow

Msi

. L ink to the Fufure

iftcRoaTAR INTERNATIONAL

MSI C COmpu te r C OI'p. Maautaaturas a aamprattaasiua

Line of cutting~dge technology products including-motherboards, Net PC and graphic cards. MSI's K7 Pro is called ~ R5 one of the fastest AMD ® Athlon Irongate chipset+ased motherboards on the market. MSI's MS4209E barebone system offers A slim solution for faster time-to-market or for applications thaf Require a small form factor. MSI's high performance AGP graphic cards, NIS4808, a 2D/3D cards with industry leading chip manufacture, (nVIDIA RIVA TNT), powers up your 3D grapltics for faster computers.

gk.-

I K7Pro (MS4195)

MS-6209E Barebone System Net PC Slim

MS4808NVIDIA™ (AGP Graphic Card) I

Intel" 810e Chipset ' AMD ~ Irongate / Slot A ' Slot A for AMD Athlon ~

'133MHz FSB

ATA66 DFP & Coppermine ready

processor. Supports up to 800 Mhz or higher ' 1 AMR, 1 AGP, 6 PCI, 1 ISA

•Dimension:300W/320D/78Hmm

' 3DIMM

• Power

ATX ' Audio: Creative ES1373/ES1375

'Form Factor. LPX Supply: 90w (110-240VAC) 4MB SDRAM display cashe

I ' AGP 4x/2x interface with full sideband support

Fast 32-bit VGA/SVGA support • 128-bit TwiN-Texel architecture

Supports 32MB . High performance implementation of Direct3D and OpenGL Standards

(optional) Top Tech III ™, D-LED m PC Alert m, UDMA66

IInA fofPe Future . , 47800 Fremont Blvd, Fremont, CA 94538

T el: (510) 623-8818

Fax: (510) 623-8585

CNIplltBPPAPER c~ ~ a w

Hands On L ab Test • H a r d w a r e E v a lu ation s • Softw a re 8 C D - R O Nl Revie w s

)i'oC.foxing

Desktop video "' "

so ftwareI" makes

Thoughthe brave and foolish have been trying to editvideo ontheirPCsforyears,thetime has finally come for more cautious consumers to add this capability to their PCtoolsets Premiere is limited. Most video cards with been around for a while. the field is far from capture capabilities include their own softers onal computers and video pmduc- static or stab(f. and you may interpret that ware,a feature you may find useful when tion are finagy starting to make a com- both ways. The feature sets are changing rap- another software package doesn't recognize fortable fit. Processors and hard drives idly, and the combination of new capabilities the capture card. The next step is to assemble the segments are now fast enough to handle the enormous and tasksthatareprocessor,hard drive,and/or data streams, bard drives are finally big video card intensive mean that you' ll be you' ve captured into a movie. Visually, the enough to handle the massive files, and larger restarting a frozen system a linle more often programs covered in this roundup form two monitors with higher resolution video cards than you'4 like. You'U find that one or two fea- distinct camps. Following the lead of MGI finaay provide the on-screen real estate and tures in each of these programs perform in an VideoWave, some look more like a screen simvideo processing power you need. unpredictable way, and although advances in ulation of a high-tech video appliance than a Technology advances like FireWire, iLink or technology mean quality is better than ever, regular Windows application. Premiere and IEEE 1394 ports (three names that refer to the you can still run into your share of inmmpat- Ulead Media Studio fallow a more traditional look, but with many windows, various control same technology), USB video capture devices ibilitirn and problems. and computer graphics cards that also import Continued on page 58 video are lowering costs, improving quality A thumbnail ot the pronean and simplifying the process. The first digital Step one is to take the footage you want to video (DV) and digital gmm camcorders seg- work with from tape and get it onto your hard TCPLab ingforless than $1.000 hav» appeared. drive. Although most of these applications call gets into But enough about hardware. This is a review that capture, ivs really digitizing. Unless you the movie of video editing, a term that hardly does justice have a digital camcorder, you need to convert to the many wonderful things these applica- the analogue signal on the tape into digital business tions allow you to do with moving and still data that your computer can manipulate. with some images, words and sound. We use the term Be aware, as well, that some of these proword processor to describe text-editing soft- grams are pretty finicky about the card you hot new computer-based ware,and the tenn "video processor" may be use. For example, Pinnacle Studio DV only video-editing systems more appropriate than "video editor" for these works with a DV input (FireWire or iLink) piograllls. card. The list of cards supported by Adobe

By Mnarten Heilbron

Money

Although some oF these applications have

sense

After five years, Money and market leader Quicken look more alike than ever By Rod Lamirend ecently, Microsoft released the latest version oF its personal financial pro. ram, Money. Onm a distant second to Intuit's Quicken, Money has long been trying for a coup d'etat and has been edging doserevery year.With the new, rich,and completeMoney 2000, there may be a new sovereign in the personal Financial software kingdom. Money 2000,

Money 2000 Deluxe From: Microsoft CanadaIhC. Tek 800.426-9400

htip.//www.mcirosoft.curn/caoada/muaey Esdmafad slreel puce:$29.95 with $10 mail-ia rfdnfe, $59.95 gleluse) with $15 mail-in rebate.

DeskJet 1220Cxi a capable tabloid inkjet Speed,colour technology,paper capacity putprinternearhead ofthe class HP DeaLfet 1220oxi From: Hawlelt-Pacfnrd (Canada) htlpd/www.hp.cum Price: $699 (maaufacluier's catenated / ske et price)

By David Tanaka

oday, most inkjet printers pr o duce excellent black text and very good to excellent colour.The trade offs made in the interests

Which brings us to the subject of Hew letthave less to do with Packard's l atest print qual i ty tabloid inkjet. When (although it is still an HP Canada announced important variable) and more the 1220Cxi in mid-January the $700 estimatto do with other factors like speed, versatiiity and convenience If your needs are ed street price was around $50 cheaper than

of cost these days BFB'

•

modest. you'B pmbably be satisfied with the competing printers, like Epson's1500 or 1200 print quality of any model that Bts your budg- Photo models. If you' re willing to pay the price et. However, the more you pay, the more you to be able to make big prints, the HP DeskJet gain in overag performance and features . 122 0 C should be on your short list.

Out ot the box Setting up the DeskJet 1220 is straightforward: remove it from the packing, attach the paper output tray, printer cable and power cable and insert the two ink cartridges. Once you go through a Windows printer installation procedure, it's ready to go. The printer has a parallel and USB port and comes with sofiware for Windows (3.x, 9x, and NT 4.0) and Macintosh operating systems. It can also be used on a network, but that requires an optional Ethernet interface card. The lack ofa serialport means thatonly Macs with a USB port or on a network will bc able to print to this Desklet. The printer comes with high-capacity ink cartri dges,butitalso acceptsstandard-capacity cartridges. While HP's Professional series Continued on page 54

M icrosofi Money 2000 is a Web-centric financialorganizer with features and Functionsforeveryone.The newly revised interfacecontinues the HTML, Web page format while re-grouping the difierent functions along the lines of task management. "Thisyear,we've redesigned the interface to focus on a task-based concept, which is really what our customers were telling us that they wanted," says Donna Hindson, pmduct manager with Microsoft Canada. This means that the home page, as the opening screen is now cafied, has links to commonly performed tasks. For example, Set Up Accounts, Get Online Statements, and Find A Transaction are in the form of HTML links to Java script wizards for performing those functions. The benefits of this approach include Continued on page 56

m HANO S O N m

Apple targets video enthusiasts and pros With software, iMac DV and PowerMac G4 are potent digital video solutions By Peter Milbum

player. But this technology is much more. It's a FireWire Just after Steve lobs took overApple'shelm, he or the last 10 years, digital video produc- the core OS and the applications that utilize it. cryptically referral to certain in-house techtion on the PC has been hailed as the As such, it is pivotal, afning as an interpreter nologies as"low-hanging fruit." Looking back, next killer application. For various rea- and arbiter for the manipulation of time- it seems dear that one of those was FireWire. sons —exorbitant hardware costs, onerous based media, such as still images, video, and FireWire is a high-speed serial interface that processing requirements and steep learning sound. Much of what you can accomplish in uses a thin cable and miniature six-pin (and curves—the prediixion has never really come iMovie or Final Cut Pro wouldn't be possible sometimes four-pin) connectors that make to fruition. SCSI and parallel connectors look like bulky without QuickTime. ltmve it to Apple to come up with a suite of l e I h products that realize the druun for both the con-

programming interface that resides between

relics. It is a true peer-to-peer hot-pluggable, self-configuring interfac«whose Erst-generation release runs at a clip of 400 Mbps. Expect the standard to jump to 800 Mbps this spring,

and 1,600 Mbps in early 2001. (As acomparison, USB has a transfer rate of 12 Mbpsmore than 40 times slower than FireWire.) FireWire is ideally suited to tasks where high data throughput is essential, such as

. QII R

sumerandprofessionaLOn theconsumer sideof the equation Apple recendy rdeasedthe iMac DV bundled with iMovie (which is also reviewed in this issue's lab Test). For the professional video pmducer the piece de Iesiltfotre is the PowerMac Gd in concert with Final Cut Pm software. I had the opportunity to do a hands-on appraisal of these products and was immediately struck by how well Apple's hardware and sohwar« technologies work together. In this article, I describe the cast of technologies that combine to make these miraculous video-edit-

ISIS

ing solutionspossible.

:Iglo"

rhea Cl

lu fu

(kuiokame Standardeditiononce: free

Pioedlfioil price: $45 Nearly everybody who uses a Mac or Windows

I uh r I Ufm

U•

PC is Euniliar with QuickTime as a media

FinalCotPro interface

Apple adudaintarlau

t •g

S T O A A B S S O L U T IO N

RH~ries of mobile racks for 3.5 H.D.O, Ia

o I/

~+II B •

Ofm ts Nk h e r iff I h e l ls.ek fmr NNfNe oku INefh h " rr' 0 I N NN s t e t or ffhh lo Of • ffN flail

• ouenfwanhe m l h

' rip

: ~

0 SOCOOIJ

awf. 0(al,

Wheuhhhlewahn

I hm

'mumknenene mammfam

'owfa»n eaf

SO NOT! I

afro ele Ie eahffo Ook fe hehle to e OOIINIO INII olfootf • fo herr Ir • Iteaefsl • N Ihe mf Of I Mffftehef Or • 0 OINf

fo of nm\ ef,al,mmueeNIN oal oealNNelo lolhcfw fealounaualfo loose • fat hotealmmlfo offhtuhh.

Oen 0 I to n Immf e re Newmo NN No hm om art Oe Off • NN N

•

'i g g

'Ifmflml EIIINtkkh(ur

'Inwleol osfhcahwacal ntt lh nlulsuhlzaikohzt ' 0 e ommmtensfnNm ' m onanen therma

himlhNIINNa huid Iih aae NSI INS unluINI hthhro u Iw ha INNll,uu II htshIWI Iilohli Id shsuuf INhNiSNNIhfIN

etnna d INtell. TlhNcoeaid Nnf hwua hohhhnhena d Ilhl auu v wlhhNIl0Nhliui

an tt haht fehiait ' hee eamuneem Neema

oxtEW ' NNNNesacll ' Inlorhnm Imiace ntHN Ifhlhm • 'tu Imeatl aea rma ateekaamemrw ' «nfl a raunlgt, s NNheouw same

f h

'•

' On Ne remowha Imnl e Ne\ uf ee

I N . : ateeow f .e tt o em a o

INIIanfasesr

'htmrahm tato Iraauu uha ' snafu zp tco Inl zp ' swuv •

ReI'mal ttrletde xp wxt ' Far v wu Mr t 'tate 0 ~ a -. a '.law~ I ntsuas Naca Ma

I. I' 1-600 667-7227

Web:www.acp.ca www.lian-li.corn

Dealer Only

P CP MARKETING ¹1 20-13751MayPedPlace,Richmond,B.C.,Canada V6V 2G9 Ph:(604)278-2811 Fax:(604)278-.121+TOII free: 1-800 567-7227 [ wwwcsnhdhccrtuuus.corn THE COMPUTERPAPER ECEDITION APRILZOOO 49

< HA NDS ON w

real-time transfer of digital video. It is an open Digital 8 tapes store only I hour as opposed standard that is gaining serious momentwn to the two hours you get with an analogue with the likes of Sony, Canon. lVC and recording. However, once a program is in digPanasonic, who arc making FircWire interfitccs ital format, it is infinitely reproducible with standard on their digital cameras. Apple's zero quality degradation, a feat impossible PowerMac G4, Powergook G3, and iMac DV with analogue. The TRV caa also dub to and come standard with two built-in dual-channel from VHS tapes through either RCA or Ssix-pin ports that also supply power to periph- video mnnectors. The TRV comes standard with a built-in 4eral devices. Expect the ifiook to join the pin FireWirc port, allowing you to simply conFircWire party in September. nect your Mac to the camera to get full dmk functions (play, rewind, etc.) through Apple's Sony TNV-510 vidm software. Esllmated retail price: $1,800 The magic of iMovie and Final Cut Pro isn' t complete without a digital camera for moving IMec DV images into your Mac. and back out onto tape. Slaadanl price: $1,999 For this task I used the Sony TRV-510, a top- SpecialEdeoaprice; $2,299 of-the-line Digital 8 camera targeted at the Apple is ofiering two tiers of DV modconsumer market. st a ndard Most newer digital motion cameras use dsi mini DV tape, which is a much smaller and and Special Edition (SE). more expensiveform factorthan 8 mnz One

iMovle Bundled with the iMac DV, iMovie is a dramaticagyscaled-down version of Apple's professional video-editing software, Final Cut Pm. It has been simplifiml to the point that you can probably figure it out without referring to thc an-screen tutorial. Of course, the catch is that to use it, you have to have a digital video camera with built-in FireWire (scevendors noted in FireWire section), which can cost from $1300 to $7,000. Dace you have one though, iMovie makes thc seemingly complicated process of shooting, capturing, mhting, com-

Power Macintosh G4 G4/400 141(t price: $2,399 G4/450 Istt price: $3,799

G4/500 tetr price:$5,199

positing and outpuning your finished vidm simpler theo you'd imagine Captured moving or still dips are stored in up to 12 bins, which can be

dragged and dropped onto a simplificd timeline at the bottom of the screen, where they can be reordered and previewed in a monitor window. A convenient

pop-up w indow contains

The SE comes with 6 4 MB more RAM and 3 GB more hard drive space (a total of 128 MB RAM and a13 G 0 hard drive)than the standard iMac DV. Both models are powered by 400 MHz G3 processors, bigger and faster hard of its great features of th» TRV series is its use drives (a must for digital video), faster RAM of 8 mm tapes and its backwards compatibili- aad built-in Rage 128 video accelerators. They ty with analogue tape. With a built-in real- also boast new Harmon Kardon-designed time analogue-to-digital converter you can speakers. However, the most significant addielfortlessly translate your analogue library into tion to these machines is two dual-channel digital data that can immediately be trans- FircWire ports, and the included iMovie consumer video-editing software. ferred into the Mac by FireWirc.

mized Oui«RTime movie for various media such as CD-ROMs or Web pages. (One hint if you want iMovie to successfully print to video: purchase metal partide instead of metal evaporative tapes. The former says MP on the label. and the latter says ME.)

numemus transitions (wipes, dissolves, fades etc.), static and

dynamic tide overlays (mlling credits, zooming, typewriter etc.), and control for audio input — either sound files or selections from CDs. With the iMac DV's built-in microphone, yau can even narrate your own video. You can also down- If you are a professional, or simply a consumer load more sounds. images and transitions who wants to ddve into more sophisticated from th e iM ov i e Web site production techniques involving digital video, then a PowerMac G4 is the fast-track hardware (attp:/twww.apple.cma/Imow '4/). Once you have assembled and previewed ticket. Short of simulating an expanding universe your creation, you can write the finished composition back to tape, or save it as an opti- or nudear explosions, Continued on page 53

YOUR ONE STOP INTERNET SHOP! Digital Dial-in access Online Training Block Hour Packages Online Sign-up (CC required) Newsgroups News Feeds + ~;li

tefaimatiel I6atelay Se rvi c es www.vane.egs.net 700 - 555 West HastlnGs Street, Vancouver, 8C V68 4NS

S ( 6 04) $ $ 1 - 4 'F11 II

I I (60 4 ) $ $ 1 $ 4 4 $

VA NCOUVER 011AWA a 1ORONTO COSOURG HAWRSSURT RITCHENER WA1ERLOO MADAWASKAwPETERBOROUGH

OSHAWA u MIDLAND u RENFREWCOUNTY a SANE o FERTH v SSUTH FALLSo RINGSTON a WINDSOR o SELLEVILLE u CORNWALL

oeeeeee Mffknnfnm Scion 111eeee Miitnmlaml Snini 111 1eee

; Ge/~ J y rlem

Miiinlninm Snfos eeeeee

24 e r gi)arIIscyjajd)a

Chive rSyitcm

Mg/nomsnn Scion «eeee» Miihnninm Sales eeeeeeec, MiiicnninmSalts eeeeeeee

if iiinninmScionseen,csee

%/Si on c jjisfc

lnml peatttm Iil 533MHs AMD Athlon Kyd)50 CPU Ace r-AX63/Abit Motherboard Asus K7M Motherboard 64MB PC100 SD RAM 128M B PCIOO RAM 64MB(PCIOO)SD RAM 64MB PCIOO RAM • Fujitsu 6AGB Hard Drive Fujitsu 6AGB Hwd Dnvc Fujitiu 10.2GB ayASSttms nitvn Mcxtor 13.6GB 77OOHma orion IA4M B anyyy Odoo ; Panasnnic Hoppy Drive panasonic Floppy Drive Panasonic Happy Driv e

• Iatel te Caisson e econ466 CPU AMD K6 II 500 CPU ' PHI(PCIOO) Motherboard SuPcr 7 Motherboard

In t el PcnUum HI 667MHS us P3V tyc)33) Mmsm tmnrg

Fast 128MB (PC133) RAM IBM 20GB 7200 bmd ddvc

h I L440GX MB Dual CPU 128MB ECC Memory, 2GB msx

Quannunhard dnve 186 SCSI 10K ' oppy 'va

IA4MB Floppy Drive o SM 3D Videona.soma SM 3D Video tntcgramd SIS AGP 8M 3D Vide o S3 Savagc4 16M 3D Video Rive Tyfl2 128 video 32MB " sco rn,finn)ament 56K" 56KFnnuosnm+hcctntmcm 48x CD ROM Drive • 44x CD ROM Drive 44 x CD ROM Dove 48x CD ROM Drive e3DSouaatmwsp Ac cr3DSouudgttmwsmd m SBMvcvdm,ONT50008pk' ~N : y~ m; A t~ q' sn~ m~ n )2a wqn Crys S a p ~ 300 WPS h ' „'AIPha 15n Tower Casa AIPha 15 Tower Casa AIPha 16o ATX vowerCaseSyow AIPha 19" ATX Canc 30OW aha 16" ATX Case250W ~ ~ I4 ~ b Win98 Keyboard dt Mouse o Win95 Keyboard a Mouse Wm95 Kcybo~ gt Mo~ W h )98 Keyboard gt Ma)iso W in 98 Keyboard dt M •

ourn

$579.0 0

$57 9.Q Q

$92 9.00

$1189.0 0

$164 9.00 •

179 275

Afrcc CDRcgri/fcr4S4x24x 8259 CanonBJC1000rc Fleer fcgoo70 Ins) 79

4$9

Nag lnnoScan ParallelSdhfa daunlgaa 89

64M->128MB Rdhl PC100 70 o 64hf > 256NB RAM PC/Op 2 70 128N->256NB RitN PC133 22 0

fng M nnnmnm eeeeenmfngmdmmimnmeel)lect ysnsrgnlnfcnnllmii 11111 yan sngnng Ivnifnnm 81111 77m fngomf mon'

6 4->1 0 2GB Fcjifsu hard drive 22 IO 2->13GB Fuji fsu hard dri vc 20 IS-> 2 06 ISM72aarpmhard drivn 66

CPU

MONITORS

CD-ROM

Fujitsu 64/10.2/13/176 13 9/)63/iSS/lsu IBM Oedmtnr13/2077G 72garym 229/255/35$ Maxtor 10/13/17/206 )65/ l ss/ias/im Maxtor 20/30/4OG 209/295/389 Maxtor 13/2N27G 7200tpm 195/259/319 Gnncaim tyi)7/7$24G 195/219i245/3O9 tbtmaua IOt720t)rtm 13.60 219 WD. INI3/IN306 179 / 189/245/325 W.D. 13/2N27G 7200rpm 2 4 9/299/399 SCSI Quantmn 9/ISG 7200tpm 3 49/569 SCSI Qaantem 9/1N33G IOK SOQ/SO Q/1449 SCSI Fujitsu 9.1/18.2G 359/559 SCSI Fuji)su 10K 9.1/18.2/366 4SQ/789/1359 aemovabbHardDrive hit 078/SCS I 72) 29

I ntel MMX 233/Cyrix MX30 0 63/4 3 lnici FacawptOSOO e/Syanaa 7N/ 739/Cis/$29

15" Aeons/Fmvicw/HsciouSnmcca 0.2 8 179 15" Smpne Dragon DSOXw/spesksm 199 15"Sony lIOGS IMag SOOT 0.25dp 299/249 IS" ADIISamsungLCD Pane l 144 9/1299 17n Accus/lmp Iden 0.27dp 275 17" ADI GT56 369 17" AOC 7Glr/Hansol 701P 0.26dp 299/319 tT' Acervisw 6772/Pmview 0.25dp 309/295 17" Galdstm FhunmO.SS775pfne5FI 359/489 17"PaaaSync E70i/PL7NSL75 319/479/389 17" Scspuu D73P/D75A 329 17" Msg 700T 0.25dp 419 17' Soay E200/G200 529/629 17" Opdguest Q71/Q73/E771 309/319/309 17" Vicwsonic PS775/PF775 469 19" AccrQQSVGotdStar910SE 529/549 19" Provicw 0.25dp/Sceptm D98A 4 5 9/569 19" Viswsanic PS79NPFIQO/Q95 699/679/489 19" Psnssync SL9NSany G400.75dp 590/879 19" Samsung900SL 544 21" Vicwsonic Opdqucst Q115 .25dp 959

Acer 52x/50x Asos 50x/40x Crcstive52x Delta 48s/hfmumi 32x CDRW anno/SmyScic CDRW Accr 4432/843 2 CDRW VnmnanScyc CDRW 8432 Ftnntm/Sony

Canon BJCSN85 479/389 Canon Biei )Myasag@nam Sia ma) Ssii is CanonBJC510011 "x17"(nacr 870mb) 2 15 CanonBJC6100(aber giaieb) 329 Epson Stylus44N660tocmusmfoms)ioyl)75 Epson Pboto7601860/900 235/289/489 Lemnsrk 3200/5770 189/379 Lemncrk Zt tigyt/Zii SS/icy/775(oamfOIoimo)

Mater Adsptor

Laser Printers Bmdia HLloce lappm 368 Brother nxt2sa/tsmnfxafa CSS/itgs/14SS FujnnuLmmr Pptav/tct)V/20W 4QQ/599/1039 HP Lsserlct 1100 559 Samseag 5100A/6050/6000 379/439/559

Scanner Acrr370F/SSO USB SQ/iis(sacrUSSSamtnue) Artcc 6P/2000USB 600xl200 dpi 8 9/99 Canon 330P/630U 77 5/tasioaor 7OeSse> Caaoa 1200S 559 Spion610UIPnrfccuoaphoto 1700U 215/449 Mustek Twain Scca I loxl7" 179 Mustek 600USB/1200USB 95/139

CASES 15"/19" Tower Case w/230w 16"/19" ATX Tower w/250w 19"/24o ATX Tower w/300w N Bndgcprt Bowl 1

•.J

tnid Piti )33Mibmimwiiinn yss inyslmsisiy Cclaoc cnmtymevtsm)7 ser i )3/)27/)55/775

AMD K6H 450/50N533 83/93/119 AMD K7 600/650 309/359 AMD K7 700/750/800/850 42S/569/S2S/7)49

MEMORY EDO 72pin 16/32M 48/85 SDBAtd(FClao)32/ss/12SI256M 4sns/l49/349 SORASt(FC133)37/SS/12S/75614 5QISQ/tSQI379

MOTHERBOARDS Siipcr 7 Mattmianmcw/mmes.vicio n mngnm 109 Matsonic Pot 7)42 w/nenes 109 Mationic Pnl 73gi w/video. Icnnd. modem 109 AbitBF6/BE6-2/VA6 168/209/135 Abit BM6/BP6 159/205 Gigabyta6VXE/5SMM 109/109 ASUS P2-99/P3B-F/P3C2000 139/185/239 ASUS PSA Super 7 AT/AT X 119/ 129 ASUS AthlonKIM 215 Gigabyte AWon GA7/HC SDI 1 21 9/219 MicmStsr ATX5169/K7 P m 119 / 199

Ztp/Floppy DRIVE 1.44MB Floppy Drive LS120MB Drive 2x Zip Drive 100MB

ts 85 85

NETW O R K ING 3-COM QOSBPCI 10/10OTX 3-COM 980TX 10/IOOTX Serve r D-Link 530/54OTX PCI Acer/Surccom Ethcma (PClorlSA)

75 129 25/37 1 4 / 16

A cmfginmnm mbmmi Fct ta)00nnmy

22/ 1 9 59

Soho 10 PCMCIA Nctworkcard

Suracom5 ponS pod

33/45 IOM Hub Acsr/Lsnic 5 pod/Lsnics pon37/47 D-Lish 4 Port Heb 100MHx 128 10/100 Hub Accr 8 Port 139 BummerRG5MU45 6'/30'/50'/iaa' 5/12/15/29 Ethernet 8745 1000' ntrnad 99

VIDEO Logitsc VideoCamera USB 69 SIS PCI4M I ATI PCI 4M 39/49 SIS AGP4M/SM/SM TV ou t 39/4 5/55 Asus380077t77M44/IVR/tstm 149/235/265 Asus V6600 Gsforce 32M/Ultm 309 / 365 Acus V6800 Gsfome 32M Pum 365 ATI TV Wonder 99 ATI AS-in-wonder SM 155 ATI AGP AS-ia-wondsr 128 16/32M 225/315 A TI AGP XPBGQNXpsrt 99 B M 69/ S9 ATI AGP Xpert 128 16M/2000 32M 125/139 ATI AGP Fury 32M/MAXX 64M 18 5 /389 Msuox G400 16M/32M 169/229 Matmx 6400 32M nndmeic Sets 249/289 Nvidia 128 TNT2 32M/32MTV 129 / 145

PowaColorGcfotcc32M w/iV S3 SavsgsdPro AGP 16M/IV Savsga4 AGP 32M Voodoo HI200MOON3500

11111 t aningnmf

HARD DRIVES gt Controllers

Inlrjet Printers

• \ ono'

System Upgrade Options: Add

Syetem OpQIOnS (udthSystempmchaseonly)

aces's's'1

$3gg9 QQ

oo o \ o ooomoooooooooooomooooo oooo •

319 79/89

65/63 6SI63 63 53/49 779/SSQ 279/ 3 39 399

399/339 cnaw HFsystuutioi 299/399 Extsraal Sony CDRW 4x2x 6 399 DVD III Pioneer 6x/10x 145/169 DVD IH Sony kit w/decoder aml 259 DVD IH Sony/Cmativc 6x 159 DVD HI SCSI Pioneer 6x 195 TccRam 310 SCSI Adaptor 54

Multimedia 16 bit 3D souad card/AccrAW37 Yamaha16 bit 3D PCI soundcar d

15 /19 19

A maaiVanex I/SupsrQua d

28/ 6 5

SoundBiaucr igipci 12MLlve union 33/44/72 Speatws 120w/500w Subwaofer 11 / 38 SpnnlmmAltnc Iancing Acssss/ACS7784/39 Spsakas: CmstiveCnmbridgn4ut w/Snb 129 Speakas: GNT 5000 53 Miauphonr/Headphone w/mic 9/ 1 0

FAX/MODEMS Motorrda 86K Vd)0 Datapnx Volos 23 A cer 56K V90 Voice PCI/ISA 37/ 6 7 Diamond Sopm56K V.90 Voic e 49 U SR56KVQOPCI/ISA Voic e 59/8 9 External Fmdvlodem56K 89

Keyboard/Mouse Wia95/Fujitsu/IBM Keyboard 11/17/27 Nsnnal Keyboard 19 2bunonMousescttal/PS2IUSB 6 / 6/15 L ogitsch 2 Button/scms Mouse 9/1 7

PS2 mouse(trsasparant)/rrackbaa 8/28 A4 Finger/Wireless Mous e

29/3 7

Misc.

USB 4 Port Hob 39 External CD/Hard Dr. kit parallel 99 1 39/199/329 CDR/CDRW(10pieces) 15/25 Z ip disk/ 120MB Hoppy 12 9/ 10 9

119

021-1 23911(wdtepof/1(d. 1(zhigond ,11.('. V6VIJS I:-

Monthl S ecidd Bmther 1020 Laser Printer I oppm/$299» Quantum &4G UDMA Hard Drive...139 Matrsx G400 16M Video Card........ 169 Creative GeFomeAnnihilator Pm Box/374 Canon BJC1000 Printer(520 Rebate)/79»

Teh (604J2440793 Tech :(60432444793 FEL(604 ) 244-9762

Nesaun»6

. Br/rfgcport Wc wc an the 2nd liner just above the Subway

19" Psnasonic SL95 Short leagth.. 599

IVeh : www.adder.bc.ca

COmyuter InC.

Noa(tatldafa.6pia Fi n a ncing & Leasing

Fujitsu PP16DV Laser Printer 16ppm/689 Acer 620U Scanner (-$30 Rebate)...109 Canon Value Pack...............................29

, Prices are suhiectto change without notlcel System are internet Ready with 1 moath FREE access, 3 years labor & 1 year porta wsrranryl

Premium System PII Norkstdttto00 „.„. ~ ~

„

Athlon System

Home T eater

pentium H 400 0$2 9 Pentlum H 400MHg $1 0 99 P entiumH 400 AM13 K7 Athion CPU: P entium HI 500 $1 6 89 366/433 Peutiumili 533/SSS $1299/1349 Celeron 366/433 $ 7 39/769 550/600MHz 81499/1549 Ceierun P entium IH 550 $17 49 Ceiernn 466/500 PenuumlH600/650 $1439/1569 Celeron 466/500 $ 7 99/049 050/700MHz $1599/1899 PHI 500/550 Penhuml11700/733 $1S39/1079 Pentiuml11500/550 $1049/10S9 PHI 600/650 $1$29/1969 012 39/1309PHI 700/733 $ 2239/2279 750/800MHz $2059/2379 Pm 600/650 Celeron 366/433 $1 019/104 PIII 600/650 Celeron 466/500

$ 1079/1119Pili 700/733

$16 4 9/1609Acus P3VI 33 MB w/ATA66/133FSB Asus K7M MB ATA66/200MHz FSB Intel 810 Cbipset MB. w/UDMA/66

128 MB PC-100 SDRAM 13.6G 7200rpm ATA/66 Hard Drive Panasonic 1.44MB Floppy Drive Psnasonic 1.44MB Floppy Drive 32MB PC-100 SDRAM S3 Savage4 AGP4x 32M Video 6.4G Quantum UDMA Hwd Drive S3 Savsge4 AGP4x 32M Video Creative 52x UDMA CD-ROM Pioneer/Acer I OX/8X DVD ROM Panasonic 1.44MB Floppy Drive lntgrated Ac'97 3D Surmund Sound SB Live w/Digit out Sound Card SIS 3D AGP-2x upto SM Video 132Keys Multimedia Net Keyboard 132 keys Multimedia Net Keyboard 3D Sound w/Digital audio laterface Microsoit Wheel (Net) Mouse dr Pad MicrosoA Wheel (Net) Mouse n Pad 50x Multiread CD-ROM ATX Tower Case w/Power Supply ATX Tower Case w/Power Supply Win98 Enhanced Keyboard 56k V90 Voice Fax Modem 56k V 90 Voice Fax Modem PS2 Mouse Oi Pad Active800w Speakersw/subwoofcr Active800w Speakersw/subwoofer Micro ATX Tower Case 17" SVGA/ Nl/LR/Digital Monitor ' V' w o 56k V.90 Fax Modem Wiib systempumbssconly 120W Amphfied Speakers 120W AmpgnedSpeakers Free Norton Anti-Virus 5.0 Version 10/100 Mb Auto Switch LAN Card Wiadows9$ Sg Full Ver.Cn n Manui/$149 W i ndows 2000 Prc~219 NT 4.0 Worheiaticn /$150 Mg Otg«2 000 Sn/8299 Prc/$410 17" SVGA/Nl/LR/Di 'tsl Monitor 15" Ssmtron 55E Di 'tsi Monitor i ' ' ' I I • i I r I i it i Assr Aopen AX63Pm MB w/Uha DMA66 n uptol 55Mhz FSB 64MB PC-100 SDRAM 6.4G Quaatum UDMA Hard Drive Psnssonic IA4MB Floppy Drivc S3 Savage4 AGP4X 16M Video Creative 52x CD-ROM Soundnlsster PCI 128 Sound Card Windows98 Enhanced Keyboard Logttech PS2 2B Mouse 41Pad ATX Tower Case w/Power Supply 56k V.90 Voice Fax Modem

Pill 440BX-Pro MB w/both Slot I Socket370 on Board IOOMhz FSB

Memory

72 Pia 8/16/32/64/128M EDO..... 28/46/81/168/349 72 Pin 4/8/16/32/64M .............,..... 15/29/49/94/189 PC-100 SDRAM 32/64/128M ............... 54/88/174 PC-133 SDRAM 32/04/328M .......... 69/119/219

viaeo 1 a'rds

Pica 3D PCI 4M/SM..................................... $49/59 S3 AGP-2x 4M/lntel740 SM .......................... 33/48 Asus TNT2 32M 3800TVR ............................. 228 Asus V3800TVR Deiux Ultra w/3D Glasses.... 268 AsusV6600 OcForce256 32M Pere/Delux..3I9/369 VOODOOEI 2000/3000(PC2TV)/3500/139/185/335 Diamond V170 TNT2 32M/Ultra .............. 169/234 Creadvc GeForcc256 Anaihilstcr Pro 32M Box/319 Savsgc4 Fm 16M/32M ............................,...789/109 ATI Ail-in-Wander Pro 8M AGP/FCI .......169/189 ATI All-in-Woader 128 16M AGF/PCI ..... 219/239 ATI All-in-Wonder 128 32M AGP/Box ..... 309/335 ATI Xpwt 98 8M/Play PC2TV........................ 44/89 ATI Xpcn 99 8M/Xpcrt 2000 32M ......,........ 99/I 55 ATI Rsge128 16M /32M Fury(PC2TV)...... 129/119 ATI Ragel28 Fury Manx 64M............................ 379 Zoltrix TV Tuner n Capture Combo ................... 89 Mauox Millenium G400 AGP 16M/32M ....169/199 Maunx Millcnium G400 32M Dual/Msx.... 239/303

$ 9 69 $$$9/$909 $939/$999 $1169/$1229 $13 19/$1449

128MB PC-100 SDRAM 20G Ultra DMA66 Hard Drive

Motherboards

Mat»saic Pill vpto 8M AGP/3D Scend/tek/LAN/Sns GIGABYTE GAAVXE+/GA-6CXC-I ......125/209 ABIT Pll BF6/ZM6................................... 165/145 ABIT VA6/ BE6/BF6(dual) ............... 135/189/195 Accr Aopen AX63Pro w/Norton Anti-Virus.......129 hnpression Marina 810 w/Sictl n Socket370....139 ASUS Pnl MB P2-99/P3B-F/P2B-LS..I35/175/535 ASUSP3VI 33 ATA66/133MHz FSB............... 135 ASUS P3C-E/P3C-2000 .............................268/239 ASUS Pill P20-S/F20-DS/P2B-D.......434/638/368 ASUS K7M AMBK7/ATA66/200Mhz FSSj... 225 Atua 512k CachePSA-8/PSA-A .............. 124/l34 FIC I M Cache VA503+/PA2013 ............... I I 8/138 Matsitpicw/I Cpbr/S gun~p/4( $MA P ....119

rrves

oat r o erg

Fuji tsu/Mentor/sesgste/Ssmsung:

6.4/8.7/10/I 3G .................. $139/I 58/I 65/I 79 17/20/21/36G ...................... 199/239/339/459 Qsstum/Wcstem Digitsk 6 4/I 0 2/I 3/20G ...................145/I 74/I 85/259 QT 7200rpm 9.1/13.6/20.5G..... 189/224/279 Maxtor 7200rpm 13.6/20/27G... 194/268/389 SG Bsmcuds IDE 7200rpm 20/28G.. 289/389 SCSI Driwur QT AtlatlV U2W 9.1/18/36G..$379/639/1239 SG Cheetah 9.1/18/50G............ 6S9/989/I 389

IBM 9LPU2W 9. I/I SG....................369/639

32MB PC-100 SDRAM

6.4G Qusatum UDMA Hard Drive Panssonic 1.44MB Floppy Drive Intel 810 3D Video 4M on board Pioneer/Acer I OX/SX DVD ROM 3D Souad Gud on Board 56k V90 Voice Fax Modem Win98 Enhsaced Keyboard 15" ATX Tower Case w/Power Supply Artek 2B Mouse tk Fad

120W Ampliaed Speakma 15" Samun 55E Di 'tal Monitor MS Mouse2n/Wheel(oet) $12/$19 MS Nstsrst Keyboard 830

CPUS

Intel Pentium MMX 233 ........................... 559 Cyrix M2(MMX) 366/400 ...................... 45/74 AMD K611-3D 450/500,....................... 85/129 AMD K6m-3D 400/450...................... 118/219 AND Athloa K7- 500/550/600..... 289/309/349 AND K7- 650/700/750/800.. 419/699/839/1199 Pll 350/400 Retail Box ....................... 169/I 89 Pentium III 500/550 Retail Box........... 369/469 Pentium Hl 600/650 Retail Box........... 569/669 Pcatium m 700/733 Retail Box......... 979/1029 Intel Celeron 366/433 ............................ 97/117 intel Celcron 466/500 ........................ 139/199

Adaptec Kit 2940UW/2940U2W ......269/379 la0nession 56kModems PCI Voice Fsx/Modem ..... $25 Telusm SCSI Adsptor 310/I IOU(Ultra).54/69 PCI 56k Voice Diamnnd Supra/GVC...... 54/44 3D SoundCard ISA/FCI .................................,.17/ 25 Netvyor 'ng DiamondMonster SoundMX300 .......................... 19 Acer Ethemct Card PCI ........................... $15 Acer 56K Voice V90 FCI/ISA ...,............ 39/69 USR lna 56k V90 Real Modem/Voie..... 89/119 SoundnlasterPCI 3D/PCI 128 .......................... 3 I/44 D-t.mk 530TX 10/100M Wake cn LAN j. 23 USR lnt. 56k V90 PCI Win Modecm......... 52 Socndnlsitcr Live Value/PCI 512 .................... 12/71 3COM 3C905-TX 100MB PCI ................. 67 Sousdniaiter Live Retail Xgsmer/MP3.............159 Ethernet Hub 5/8/16 port ..............34/42/109 56k Voiec Ext Retail Box ............................ 99 3DFXI 500W Speakersw/sabwoofer ................... 34 Cable Asserably 15/25/50S .............. 9/12/19 Cardinal 128K ISDN .................................. 129 Zip Drivers Spesliers 120W ..................,..........,.......................... 8 Tcnninstcr/RJ45 Coanector .................,.....3/I Creative EFSI0004PcintsSunoundSpc .............. 118 USB 4 P ort ................................... 38lomega Zip IDE lOOM lnz/Disk ........... $85/I 3 GNT w/subwoofer 5000/1000.....................,...... 52/75 Printers d(c "'8'c'a'i'i'ne'rs lomega Zip IDE 250M lnt/Disk............ 148/25 Teresa»M03S(w/»nbwceferl ......................,........88 HP 610/8 I 0/$$0/895............ $135/215/338/418 LS 120 (120M) 2nd Generation/Disk .......89/14 Monitors SVGA 15"/17"/19" ........................... $179/259/458 Aliec Lancing ACS45.2/48/54 ................. 88/165/108 Lemnsk ZI I/231/251($50) .... $8»/178»/264» lomcga 2G Jaz Disk/2G Tape .............. 125/25 ADI 17" 5PC+/19" G66.............................. 315/625 KinyoFistPaaelSpeakersw/Snbwcofcr..............59 LexmsrkPrinter2 year extended wcnanty...29 Cases 40$Misc. w/gbwgf~ ............... 39 Canoe nJC 1000»/2000»($20) ............. 79/128 USB Port Contmllcr PCI............................$39 AOC .26mm 1600x I' T' 1GIr/19" 9Glrs ... 289/519 Active $0 Tower Casew/Pg ......................... 29/42 Sony .25mm 11" 210GS ................................... 479 BJC5 100/6000n000...,....218/288/459 15/19" 25" Fug Sizo Tower Casaw/PS ................... 79 KeyboardPS2/AT............................ SlI/12 Canoe Soay 25mm 19"420GS/400PS ................$45/959 Win98 CanonBJC 50/$0 ................................ 469/379 MAG 17" XI770V/XI770T ..................... 349/389 Win98 132 Keys Multimwba Nct KeybosnL..... 19 Brother Portable Printe 2IC/2IDX ....459/529 17/19/25" ATX Tower Case 250w PS..39/48/82 NEC IT'FE700 35um Flat Scrccn .............. 399 Fujitsu KB $725/4125 .................................... 18/58 Epics 440/660/760(345)........... 9$»/144»/274" Powersupply AT/ATX/Power cern ...... 29/39/2 NEC Accusyne 90 1600x1200 36mm ............. 559 Fccm Wuctess Keybcsni/Mouse .................59/29 HP Laser I IOO/2100/3100 ........... 549/948/989 IA4M Floppy Drive Psnascnic ................... 22 Samsung 750B/700IFT/900IFT .........379/459/739 Logitech iTouch CordlessKeyboard ..................72 Brother HLI020/1040/1060DX...3/438/499 Rcmovesblc Hard Drive Rack ..................... 18 ViswSonicl T' Q7 I/Q73/G173 .......... 298/349/428 Attach 520DPI Mouse 2 0/4D(2 Wheels) ...... 6/25 Brother MFC-1970/4350/7150...,329/639/699 5.25" Reck for 33" Device .............................6 ViewSonicl7" E771/0773/PS775 ...... 309/365/488 AOC Finger Trsckbsll Mouse ............................ 29 Fujiun Laser PPIOV/FPI6DV ...,....... 529/729 Hard drive Cooling fsn ................................. 19 Seccndwy CaseCoging Fan/Slots Fsn.... 12/19 ViewSonicPF/75/PF790 ...........................458/66$ Logitech Mome 20/First mouse(wheel mouse).9/I 8 Sumsung M/4500C/SF5800P............479/599 Ball Bearing Cooling Psn K6/PE ............ 10/I 9 ViewSonic 19" Q95/E790/FS790 ...... 495/505/689 CD ROM 49$ CD Writers 5 HP Scanner 4200/5200/6200C j. 259/349/495 AMD K7 Bail Scaring Cooling Fse ............. 20 ViewSonic 21" G810/F815.................. 1019/123$ sox ~ Mitsubisbi IT' Dimond Plus71/72 ........... 519/599 50X Acer/Creative 52x ........,......................... 61/62 Acer 320F/ 320U/620P/620U/99/I 09/I 35/119» Printer Cable/nl~ c donsl ........................ 5/7 600CF/IZOOCU..................,.....89/149 SCSI Hard Drive Cable 3/5 Head ............... 5/8 Aver 112 17" .25mm ....................................... 329 Psassoatc PD Drive w/650M Rewritable disk..139 lgmtek cccrsclics' Penmonic E10/SL75/PL70/SL95..318/408/468/60$ Psnssonic 75850 8x4x32 CD-RW tOE Kit ..... 349 Canen BC-21 Ink/BC-2le Canrigc...,.... 19/59 PS/2 Mouse tk Keyboard Adaptor ................. 5 W n k a & n u k m Sony gx4x32 CD-Rewriter IDE Kit.................. 359 Gunn BC-22 Photo Kit ............................. 59 Switch Box for 2/4 Printers...................... 29/39 Accr513DX ClAOO/4G/IZM/I2.1 TFT/56K/24x/$1899 Cresuve 8432 CD.Rcwritor ex4x24 IDE .......... 409 Epson Ink JctPayer (photoquality) .............15 Switch nox for 2/4 Computers................. 29/39 Aew512DX CL344/4O/32M/12.1"HPA/56K/24x/$11m Ricoh 8432 6x4x24 CD-RW. Kit..............,........ 419 Epson Printer GutrigeBlack/Color ........19/29 LPT2 Printer C n hsnced .................. 17/25 Aew1221TXV PEISS/SG/44M/14"Irf/SSK/DVD$33ee Yamaba 6x4x 16 CD-Rw SCSI Kit................... 319 Brother toner TN-ZOOHL/TN-300HL.... 39/39 boINI/are S»erster Pm»SO /so/t»tt/tt IVT/tcx/t»x ra C»miscast»9 HP CD-Rewriter Kit 9110i/9210i............... 369/379 Reog KitforCsaoaHPJ?peon,Lexmsrk..Cag Corcl Wordperfcct 2000 Suite ...................... 39 Coral Draw 8 ................................................ 99 Fejam 85320/PR34S/teG/ScM/I3.3 IF1/Sss/tsx/stase Acw CD-RW. 6x4x24 Kit w/lots of sothvare)....289 »~z ggagdfa rejiim nstctrCIA33/S.CG/SCM/i33'Trr/sct/24s/$2459 Plcxtor PlcXWRitcr gx4x32 CD-RW .............. 369 Micmscn Work Suit 2000 Retail Box ........ I 19 Lan/c/I rsir/r ser»des /4»nwis, /on Senna»cat ICCCCtnee/1.20/32at/tt" IFT/56$/2»s/ttee Loan SmartSuite Millennium ...................... 29 bsy»cr c»»//nun»V»$ ii avs//aa/». Creative Sx DVD-In ROM w/Dxr3 Kit ............ 229 nmnna»»atlCCCCtnm/420/S»tt/t»"rrr/tax/DVD/se39 Upgrade Special Te»bitnxtecCDSKacee/4082MIIZ"DS/24x/5at/11ee 8X DVD-ROM Toshibs/LG............................... 149 . 4// /i»redpr/re» frc//et»in» cashdoc»neil„' 7»rtn1et ISSCDTK&400/46/S»M/12. I'Trrltex/Sat/Zt re IOX DVD-ROM Accr ...................................... 149 eNocnltcr atutJ/»r»i/I ccccc»ivv s»bj»»r ic . (Free Installation) Kali450+MB+3D Sound+opto $M Video.239 Zd» Herd Drive 6.4/IOG... . , . ... ,. 5359/519 BASF CD w/csee Writabic/Rcwritsbtc......... 1.8/4.9 c/»rcg»wiraavr»»rice. d// rtvlc»l erv f»rfrdccr/ Ssisrr/ Ih/cr dt 144Pia SBRAM 32M/44M/12$M. $129/219/449 Geneva Confaence Kit w/Csptwe Card ........... 99 PII CIA33»440BX Fm MB w/3D SoundCard+ +56K F +n 8 M Video+LAN Card........249 PCMCIA 56KFax/Networldn Card $8$ /79 Lo uuh USB Di 'tal Camus Confwence Kit.....79 a»errScfcre shipping.

IS IIM phere

c HANDS ON n

Apple targets video enthusiasts and pros Continuedfrom page50

Final Cut Pro is targeted squarely at professionalvideo producers burdened by the steep few computational tasks tax a processor as learning curve and high costs of non-linear much as editing digital video. The G4 eases digital video-editing systems such as the Avid mu«h of thispain by incorporating anewded- Media 100. Apple claims that Final Cut Pm icated 128-bit execution unit into the micro- offers about 90 percent of the funmionality of processor. Combine that with a powerful these dedicated systems for about a tenth of instruction set that can be programmed in C the cost. The obvious benefit is that as Apple's language, and you have the world's most pow- hardware offerings scale upwards in performerful digital signal processor. Motorola has for- ance, so does your video-editing solution. mafly branded this technology "Altivez" while Furthermore, Final Cut Pro and the new Apple uses the more dramatic "Velocity Powergook G3 with built-in FireWire are a Engine" trademark potent combination for the mobile video proThere are many types of data manipulation ducer. in digital video editing that are wdl-suited to In essence, Final Cut Pro is really a combi128-bit wide registers in combination with nation digital video editing, compositing and powerful Altivec instructions. As a result, soft- special effects program. The software includes ware mutines optimized to take advantage of more than 140 audio/Alter effects, as well as a thiscan show a speed increase of anywhere scripting language called FX Builder that fmm two to eight times. depending on th« allows you to combine and modify the built-in operation. Of course, musde-bound G4 hard- effects, or create your own from scratch. It also ware is only half of the equation. For the other fully supportsAdobeAfler Effects plug-ins. AU half, we need industrial-strength video-editing compositing is done through an interactive software in the form of Final Cut Pro. proxy-free interface, and motion paths in animations can be specified by either numerical Final Cut Pro input, graphing or direm Bezier curve control. Estimatedretail price $1,499. Common professional power editing tools, Almost a year ago, Final Cut Pro was rdeased such as roll, ripple, slip and slide, are included to rav«reviews, and has since won numerous inFinalCut Pro.The software also haspowerawards from organizations such as DV maga- ful log and capture capabilities that make zine and NAB (National Association of organizing your projects simpler. Add to this Broadcasters). The latest version, 1.2.1 (a free the ability to do match framing, L-cuts and upgrade for owners of Final Cut Pro 1.0), pri- easy audio-frame synchmnization, and you marily adds support for the Velocity Engine begin to appreciate the power and flexibility unit on PowerMac G4s. Benchmarks available Final Cut Pro offers. on the Web show that with this upgrade some Apple has bundled some great utilities with optimized operations are from three to 12 this package. They include Cinema 4D Go (a times faster than they are under version 1.0! completely integrated 3D modeling, rendering

and animation program), Commotion DV (additional editing and animation effects), and Media Cleaner Pro (a utility for creating streaming QuickTime movies for the Web). Because Final Cut Pro offers so much depth of features and sophistication, I' ll be taking a more detailed look at it in a future issue. (Those who feel a linis overwhelmed by this powerful package should consider getting the PowerStart CD-ROM series from Straight Scoop Enterprises. It contains QuickTime tutorials on topics ranging from setup, batch capmre and editing, transitions, effects. and final out put.)

It doesn't take rocket science to see the same trend developing in digital video that took place in the desktop publishing field in the 1980s. At that time, I remember many operators of dedicated typesetter systemsscoffing at

433MHztzntz eius ssstau g1000 466MHzMsitzcime ststsm $000 500MHZttzttzosdno gg100 533MHztantzcsdn 3 I 200

• Maatarbsanh AopaaAXSaapm Na Apoaa Pm Chip Sat,U0MA-60,Alx On aoant 2 Usa puris, t Aap sots. 2 chanaatU0MAIDE,1 channel nappy ariva, 2 Serial Pons, 1 Pnsgal,(SPP/EPP/ECP)Part 04Ma 90RAM taapin PCtao 0IMM (PC-1 SSon Pla. PC-100 oa Ca!aronSysnm) • Maser tsag Ultra DMA416Hard Disk brlva 7200ipm 2MBCache •Paoasooic iA4Ma SS noppy alskarlva • Aspen02X SpeedInternal 00 ROM anva •Aopaa Pn-700 SS Savagae Pro 1Slab 20/SO araphlea AcceleratorASP 4X •Anpan Awsso pcl00 sound Canlw/t28sauceswave tabia synlhaslzar • Aapan06K Iyu-y vga and Ksspkn Internal par/naut/shies Modempcl •Anpan St TowerCasa w/250W CSA Poww SupphiAIX • Aopaa107 KayWlndowasa Enhanced Keyboard Pa/2 Aopoll 2 ButtonMouse w/SomaWheatpa/2 • taouuaxlamal ShieldedCamputw Spealalia Micnnoft windowsassg (00. OEM) Norton Alla-vlflla • naa one Monthlateran Access gly Inflnat communieauonsGroup) . 2 VhwPartsaad LabourWansaiy

Itatgtt gnnstswsynmd Mlcwlcs w N M

l w , % % ygglpa D gyk

• hanstggtgghabhlS SN lgk lfsfrmNN SBtggttg, ssdffarhr R IS Nl gsasRahr Mw

gd ggg,answa ~

gpd gnt tgs,gg'ma $10.Mgma ttts,abt

$4$ PNnstnd gta alkn stan salln gsnssapSS 5'ggl gglg Mnari gta( gaI tp gay gpta ffasan gtpp, ggt IP % ybt thhhrmgpgttsahsrgaa, hznaslttpNtg/ttatg ay Ha ggt/Iyp, gemgsttb Jit 1M/SS/IBR ruhrtutaw PWAggfgtp,gpiia gbtn SNS gdn Mta gIMw gag/IBED gsdda I I Ss/gtgsgshradstwgSIRts/gyg,tmnpnmmgptlata fttuphgmIDf ltgs/

• namghtaaagISg/tammpSISI gtgl ' Firmgzgutsls ssRopaimaadffpgeda

/tarn na/sdtocoiopa pnawmaIbiaeafsd pumsmaaana~

/d plaolislzasmsx oadsmnks nlusxpnmd haannus slaIzopnuis Iuulla rwpseowoallslz

Power Mac G4, some Final Cut Pro effects and filter operations can still chew up a lot of time. Be prepared for the momentum to start swinging in Apple's favour when multi-processor G4, G5 and Gas, paired with Mac OS X, hit the strains.As for the consumer market. w ith an estimated 35 million digital video cameras Apple is poised to ride a new wave of market success. (2

PeterMgburois aconsultant wilh Egto SystemsSupporl located ioCalgary,Aga.

Hecanbereachedatcute.systems@home.corn.

Small Powerful Connected

Ialal Calaraa(BBMHgFBB)

667MHztttahrfgstsstttcsdn tsram 1040 733MHzfl M tauftptaatzcnsiirzaau)gtggfl

to catch Are. Even on prime hardware like the

Tosh!ha of Canada has broadened its popular drive, integrated 24x CD-ROM and floppy Satellite line of notebook PCa with two new drives, built-in V90 data/faxmodsm, and fullmodels aimed at student and homeoNics users. dupisx 16-bit Tosh!ha 3D sound system and In the new Sategits 2100 Series, Toshiba has stereo bass reflex speakers. Battery lite for both adapted features common to ita corporate models ia rated at up to two hours. notebook linofor this more modestly priced Ths Satellite 2140CDS comes with 32 MB series. RAM and a 12.1-!nch Enhanced STN LCD disWsighina in at only 3 ka (6.8 lb.) including play, while the slightly mors power/ul Sateigte battery, internal CD-ROM and floppy drives, the 2180CDT has 64 MB of memory and s TFT Satellite 2140CDS and 2180CDT are sleek, fast Active Matrix 12. I-inch LCD display. notebooks PCa. The models uss AMD Ka-2 Ths 2140CDS and 2180CDT have suggested chips that run at 450 MHz and 475 MHz, list prices of $2,039 and $2,829 respectively. respectively. Both come with a 4.3 GB hard —Ks/th Schsngili-Roberts

ysa:(404) 2294436 gwizen faun: aoa.-hi. 10:30-18:gpSst. 12:tphly:Sg

600MHzliszMlufSStost Iz Cscheta tttthul gt 040

professional desktop digital video really begins

Toshiba rolls out new Satellites

ysh(tat) Pgp~

500MHI Iootsuysptsot tz csanai goohtx gtg00 533MHr Itp am pal otzt 12csds tunas tgflfl

ly, I suspect it wiU take at least a year before

being sold worldwide this year, it looks like Conclusion

10!-I ygdWsagroadvay, uaaaxam,8.C Vtf 112

Inlal paatlamUI

the notion that a computer could ever replace such expensive and high-end solutions. Of course, we aU now know how that played out. As revolutions don't happen instantaneous-

(justlikeyou) hkttttndei

OHazomlssrrarsss'

Eqltflil andInternet

vt euvr iinii

It's small businesseslike yours that are driving thu country, but to big tech companiesyou're usually an afterthought.

Meet NerWinder, the otfice server ihii's built for small business&om ihe gmund up. Fmm one small box, connect everyone in your businessto the Internet ind share files and printers, at work or !lorn home (ii hsssecure remote accesstoo).

s RES I~ ~

~ a

I ,M I s

fled ,

And it's dfordable — to buy, instalL administ erand upgrade.

Visit www rebel corn or call 1-888-391-0549

,r I sv v hs ~ M

N v~

v sa v

www.caadacompuias.corn THECOMPurgnPAPEA acsbinON APRIL2000 Bg

c HA N DS O N e

HP Deejhjeg $000CNI Continuedfrom page40 Desk)et 2000 and 2500 models use individual cartridges for each of the fow inks, the Desk)et 1220 uses the typical two-cartridge arrangement (one cartridge for black and one For cyan, magenta and yellow). The paper tray will accept everything from dx6 inch note cards up to 13x19 inch posters. It also outputs up to I sx44 inch prints on roll paper. Two ease-of use features HP has incorporated on this modd are a cancel-print but-

ton that stops the print job immaliately, and printing common items like documents, an automatic print-cartridge alignment fea- even when they contain patches ofcolour or 'ture. small photos. However, if you are expecting to achieve that

Performence

kind of printing speed with fug-page photo-

HP's published specifications state that the 1 220 prints at a maximum speed of l l pages per minute (ppm) in black and 9.3 ppm colour. You w i l l p r obably never achieve those printing speeds, but in real world conditions this printer is fast enough that speed is not a l i miting issue when

graphs, forget it. Thc fact is, printing large photos on any inkjet takes minutes per page, notpages per minute. When we printed a few test photographs on I lx17 inch photo paper, the printer took several minutes to create the photo.HP claims 0.2 pages per minute for I lx17 photo prints (or one page in five min-

no imn ~

• 0

h t oMPUTER PLUS

AOI 4P15' f$ N/I lg O.N ADI' Ets IT* B 0/I Ig 0.24 Iud TadfD 17 FS O.N Tcihen HICFI750 17" NUBIMVHC0.25 ' NECfP950 19' NULTt-STMC0.25

Cal( usi

Compuer"-"4

OFHeiem 495 10" 0.14 Saemne75in 17' 0.27 12ehloro

Problem s~ 'upgrides

• s. s • •

•

PengnmIII 333g/600$ j)INH

Q 8 Y2K Soluhons

AsucVIA Appollo Pzoau Ceipiei P3fez ii/S

PentimnIII 300/530/600g Mlh

ruppon iiibs ilai/44 wui Moppy canc«lier

•

2al6BO UIRTzemi I pazaiiei ivq 5 RWB GSBI PCIB EORAMup. Io I.OGO

•

pans«meI scqs nap py Drive

•

Air Nid.cones16 ITA w/IBH Powerlot ply

IDS

Shne io ec io'm nnleW AmezIuPPIF

SAMTRON 15' (55E) Fs 0/I lii Neniior

IOM13.IG8Viim MDI Hsni iicim Hie Fni

AOP« psrw viiko cardw/16NDAstzs AdpenCB niiE ni.RDII

SOOT 6400 19'NISHsan 340&3440

Therm& 2773 17' &2$ WmmonicGSBO ly' 0.2S llehleiO %«manicPSTJE 17" ILIS WeasozdcPf790 19' 0.25

dac 561qezV.96 internal f/N/VFn Ous

lzidlloiNiihenallpzadirip«142ulds

•

aaibed Ica

SVITROH13' (3II) 6 ii/I IR SIOniiOr

ICON Palm0 Organizer

5410

ioe ciro BS Nneaeg vae MDEii h Mien«a ihiuei ecriwsni ps/2

scqn trie Inzw/4ND&oaaiac

5 49

~r i eequenm. m wnuheas

AGP3fideo Cards ~

•

ill'll

Aalialee elias 4109

AFCsmg«dweai tees OM60hk aha«nb(aHack SN IDEIhh roue fe liilniiO 51 5 le«i cessfor 2 m SIMO

Sap«See«

$12

Dbhbsck seuiu EE S Pries/Oysu Cha Bsk 5 LN '52N Bxubaghkeffs: rri scaHi.Wri hn•CO'Oluk'L ';63HO '

Pziace 45ige ChOgi& $ 3,5 0 CShbeeqlh(telaboi Seance) SB

WIDT b ales/et«100/pk s

inmates tnntszmme,

Pl'os ivwe 10 0) •

•

Netwoiking Panner

•

Aayen4ln CILSDN...... . . . . . . . . . . . 569 &us402/ 402IOECDMDN " " " ••.549/75 HPOIEOIinL IOEuhge aahaln.. • • . " $345 Niismai eriale BE nigW " • " " • " .. Q19

Me&aha,aws une &knec BHUriu aa loca caane FI.DN elc01$sgw/oskl . •... 5149 Sasy Na aeedzheSn/Sln HIE .... . . . . 5BO Mens Oebyi H4IID««HPu Oeedszw/SW 5115

scendatone Ba pa...... . . . . . . . . . . sds

reed 4lssiszlienVriua..... . . . . . . . . . 574 h l S Allec lusiagEye&ms...... . .. . . . . . . aa 5240 nmaha Nagnalially Shield«ISpeakec..... call

•

A-OyenPGIRS 53Tr io3D 4NO AEP

$36

A%penPAFOO$3 w/14-Na Adta 4

$7S

Aus ViiNO Sefem ON tuse32NAiees $3rd AllEPB T-2000w/32NO Oam A6tni 5145 A uihle suit w/31NOISNMAE P $34 9 AuIhlchay Nam44BI AGF44 Ihyel20 Fe 5450 M&ebasQN 32BI Banlrn& 6th/OM190 ikyccDI200 31NO $3 Semgsselo 00PO2$249

•

m win&ne iir smaze/s riiuh.... $1150

LANtasuc mndowsNT• Wo'aHee H wnh Tour Hatworlr in n •

•

3350

ABS VIB06ehne OUM3nl llN/t ASF4E$379

Osringu lmril SorinemSsme w/I aL. $1950

• Hamil NetWee• Windows fei Wolltgionpz•

3CONPr im In w/BIO IhOerizer

thous Iox lot Dvo line Imftud 3(ONIMR56ihl V.90 internet PCI F/M Minasoil inielii-Momew/Maui pl/I Iounilimicc lie Tahepu+ Tsals m Iizao Iian

Wo supporg and senrion

Il l

1 215

Palm Piioi: ~

Trained

Support

3 10 S

virione«oneloucbTee 3dbii Ino

AB Mid-lower 16' CIA w/234M P/I

•I •

Vhieue Onoloue 7BOBbiltaiaWI

suppwl Oluyae/44 sndMoppy conc«Em ruioliO ingr»risi, I umrri pons 4rc001

yiew sonic PPFI I I 6 nisAHOniiOr

HzisumzIls rey ieybuzd pi/2 IOliiCCafiql e Ps/2 W/ MbeCINsum

Ht4350Cfheelscsan«tesgct/IMO 5450 illa Mriue«0neroo& 4100Peailel

Aze Aliissroi citipei p3(-2ut sedwriari lions pciu Iyosii nv.io i.orl, Isdzstack psnssonic I,CINII iioppy drie

FcghuOAGSNm nw Hsri One Aurpmnf ASPw/SMORSN Video Curd Ao pcs eh BDEceBM Aces561 Fie P90 Internal f/M/v Fn oui Insenic Irs FII AudioQni ebs llanoiidn

VISA

IIP52INN NaiaedScanner Pesllel/ IMO Q49

um «o(jegqwpetrerglg(mns u m

6cN0pci00 IDlwl ezp. Io 1.060 hnmnk LCSNOFloppy Drive Ah iiid.ioaez Id IIA w/25N P/I

51 ,040

3CON/lng Sea 1RN90 tnk Faa/DelePB $79 Aces540 VMOInk fu/Vehs (Pn) 546 lupzaHaaSdls Ink Iud nu Pu 5d9

&ui Iniri csahCbiP Fr w Msezrimsri Pengwd Ill 6000/677/733 MNU Supper 0(uaNN/33 andHoppy OmaoUez

51 .hil

HP4050lsseqe(BNS, lrppe)

n«

Nicnneii inieiii.mousew/Ok«i Pl/1 '

Ntmoouunjectubin4neceee

' $990 Ht 2100isaac)el (4IIO,loppe) HP 1100 les«jet 5559 &baal R etiHI«glqu/Epws/HP C all

in«&ah iioua«ruin/siec hniv Nsmiii '•

$43S 5509 5755

Epsoa SlylzePiete 750 Thbi144Ddpi $379 HP 010CDecide Colas 1149 Ht DsdcDesk)elcolsi 5129 HP 970&e fkeieRelni Priniec $579

3coM VB 561st vao Inienalf/H pu

~&~ fggeffri~d

E S59 $34$

canon03c1000 colasaubkleiel 5110

AOIIP ir BH /Imsnihr ATI IIPBIÃB 'inm Vide w/32iil AGPai Aiui Cdz MOI nl-10H

Celuonyy0237$44(irsgg/533

5 420 5910 44N $ 31 9

P '«

Fu/iisu 0775 • IOC rey layhud Ps/2

iogiieck filii ps/I w/Mkec ileum Iounf 8letn Iis pnsco»oni /ill fine Iph

5415

seiwRlosslr'MUImcAN Oas laos

Ams Iniri OXcbipsci P3DFNsibcrieani liana Niu Isiwi cem Leak Iiz pe ache tauonic LSCMORappy drizc 32 be HOI zsd ihppy conimiiez 2al6510 INRI anni, I «nm pon4 I*ills

FqpmuSMGDoiie nlr Hed once Miheni I os rey keyiluid Ps/I

5149 $30S

II ni ories

SN Windsns eazksiaiisaOei.... . . . . 5 179 IOM alai/27.0GS Tlhnpm IOE $22S/175 NsEebanOescca«w/5 cbenh...... 51225 Fajiha Da/ILNS Seihye ID% $147/2ih Meell H aloes V54 w/S nieris • " . • 51490 3Cem9050 B 10/IOOOI' tu Conf...... 59S Ounhm IL2/20 440 IB IRINqnaIDBlll/Ba 5429 Aaz 10 Oee I 5-PokHeb..... . . . . . . 5eO ikunue RLI40 Ih Ilwqu IOI fnhlEnpmss he 10/10007 tCICant....590 Wuem Oigihl iillm IDE caU 3CONOSOnkenwl Ini«ha 3C19250 ....14P Iaiza/INI«.2 Wide SOSMedusk c nU

scornoucecsnnecc5eii IAH Nodoa Icu4 53rp

3Cen Sn CsaacriSilas IS%Hob ICIcia. $1SS

Boe 0H. cennemetozc Ias neb lc14711. 5209 Ht I rol EahmslPiles rema w/I De Pock3110 Inaaek Nehiel tm I Dd PaintQmez. 5305 Mwoedmhwl Id/IOozsoncombeFcncn BI2

call 8/ la/12MO 500 daNS 12B N sril 32/44/ 110IB PCIN SOIBMBONN cs U 04/ 124/ 154 Nl tCIOOSalnil 140PDIaU

ielsHem10/100 940v wee«le Fc nnh le45 •

RAgg 4BI Smli TOHS30PIN

Nolebook Neeozy(Compaq/MN/toshiba) caU

• I I

R00)0)/gj)le 900km.~

AcesTiuebsale N4T 32402

Inlet Ccieon S46sMHI,5CMO SIIRAN, 4.460

OalheseOB030GODIO.Tapeac. BE Ial 54RS Iud OriznIP Ifr Oisphy. Ica ni-RON, leaaDI BP ION4 IaL IM4I et 5 179 561 VW Nademand Ms Sfindows 90 lomeol Bp250HDIaL peallel pozl/scn 5Ri9 ASIMlBOO/D344 uielaak $2749 5449 le st tecum n iddquz &MOSDRAM. 4.160 Sant lensOs311 faLsm EIISO DiNa Nant di64 lnL/EnL (tmllel) $ 279 oz'ne,13.3' TFTdisplay. rca cd.mil, 561 v.w Nodwnand MsMiiidnns 9$ SgitsLIhvkea~ hsbilatame 42in (PI41IX-IIC52) $S47$ htel P3.500HHc, Ises Slinn, B.06$ lbul Oihe. i iO& oPhoa CI3O DIOilal Ceas e Sl ai i l e.l' Ariice Hsiziz ColourMspiay, ia NO.AOM, Eye& tketepc 630 IHoihi coinee $4 i i 9, SlrNodem snd WindaesIS Ho&k DCRIGIHOilal Comes

IONlhinkPMM3902 (Rd16NOH) SiNO

Inlet P3-500MHI, &MO IOIMH,12.iqiO Hed Olive, 15.0' Ariicc wnm Color Ohpfst,

Epsen4SORDlyasl Csea«

5500 SI,N4

ru CO-BM and541 Modem.WindowsIS '

utes), and our prints emerged within a minute or so of that estimate. The HP 1220Cxi was faster than our workhorse Xerox DocuPrint C20, also a tabloid inkjet printer (with a printerengine from Iaxmark). In terms of colour gde)jty and resolution, we were very pleased with the test prints. Printing a photographic image on tabloid-size photo paper tests the printer's ability to evenly distribute the inks over a large area, and for the most part, on casual inspection, the HP creates images as good as a photographic print. Even when we used a magnifying glass, we could not detect printer artifacts like "corduroy effects" (where individual swathe of ink are visible). W e encountered one anomaly thatwe were not able to reproduce, and which did not ouur again, where the printer misregistered a 2 mm wide swath. creating an oddly textured line running across the print. We also learned a lesson applicable to any inkjeu clean the print heads before printing a large image. After leaving the printer idle for several days, we hit the print button in our image-editing software program and went olf to do something else. When we came back we were disappointed to discover that the first two inches of the print were severely off'-colour. The magenta print head had apparently dried during the period of inactivity, and it took a number of passes before it undogged itself and started working again. 14 them e substitute for dpi'7 In the inkjet world, there has been an ongoing debate over the real benefit of dot resolution. For example Epson, which produces printers with 1,440 dot per inch (dpi) resolution, maintains that there's no substitute for dpi when it comes to producing the best looking prints. HP has long argued that image quality can be achieved in other ways. and the HP 1220 uses PhotoREt III, the company's latest version

of its inking technology. Acmrding to HP, PhotoREt III involves an ink layering process that allows each dot on the page to be built fmm up to 29 individual droplets of ink. The company says this allows the printer to create up 17 different levels of each of the primary colours. A second technology used in the HP 1220 is called Colorsmart III, which is designed to improve the reproduction of colours that can make or break a photographic print — skin

tones, for example. And, apparently bowing to pressure from the "more dpi is better" camp, HP also states that Desklet 1220 includes an alternative p h ot o pr i n ting m o d e of 2,400xl,200 dpi on photo paper. Adding it up One characteristic of this and other tabloid inkjet printers is their greater bulk in comparison to a letter-size printer. If your work-

space ison thesmall side, beprepared to have the HP 1220Cxi take over a good portion of it. (3n the whole,we've been very imprmsed with the print quality and speal of the HP inkjet printers we' ve looked at recently, and the 1220 continues that tradition. USB and parallel interj'aces, plus the optional Ethernet module, give users connectivity options both at

home and in a small ofgce environment. A dutycycleratingof5,000pagespermonthfurther reinforces HP's intention to create an

• •

•

gus(SessHSHB: Mon.fri g.'00-6:00 Sst 11:00-5100 yiae Parking At RNI sac«em««num«eau«su a s «co nemo«au«.mcnemumlnuwh s c«omda ummwau«mhs

inkjet suitable for a busy home ojgce or small business. C)

4'ic

4e ooos

EIQ • 5E 155

— OWefsoAEC www.Pcwersonic.bc.ca •

I I .

•

ps onic/0pon /ersonic.bc.ca I •

104-1 1400 Br d ePort Rd, Rtchmon,

• I • t

qgo IntelCeleron

K6ll-450 + Superrh!8+ Viri eo+ Sound 64MS SCRAM..............3310 Ceteron 400 miSIDMB+Video+ Sound + SIMBSCRAM+ATXCase3370

dKO ctysteitt

PentiumIII Motherboard ATASS 64M 100«hz SDRAN ASP Video / 45x Cbltciih

6 46 Hard Drive /144AI Fbb

©"

Windows KeySoerd / INouse gb Sound / 140w speariicrs 56K V.90Voice/Fax Nlodem sOne Month Free Internet

ew Location ,:'

' %%~

Opening Sale'.:. Is coupon, ttet $2 off for any :: purchase of parts or 020 off for any

: purchase of system. 0

m s

.Cps fm

, :NOT aoceptablei Offer expires 3/31/2000. Firn nd ssiubey aubIedn change vihaul notre. we nspan In rigkth cured ~ en«s AI ssceuansI brats ns props rkw of Inir nappe&a swans. Mioe5ob pmcvcb us be apkl niib newsfuem only.

• • •

Home Officer

At h(on KT Master PLG'Pa KT-500

450

•

hoss

PLQ' Cbmmander I/rrcl

Cclcron 400

bream Machine

lease

' P3-500 , I : a -466 /-500 $ 7 $75 9 P3-500.„ 344/mm 375/mth -600 .................... $1249 PB-500 / 550 . $969 / $999 PS-550 / . 2 49/ $1279 P3-600 / 700 . .$2149 / $2469 KSII-533 . $649 Ky-650 /-700......$1299/ $1 349 P3-600 / 650 f1029 / $1209 FB-S50 / 700 $1459 / $1599 Asus PIII 133mhx Niotherboerd Supcr7 100mlw Nothsrboerd PentiumIII 133mhx Motherboard ASUS KTNI Motherboard ASUS Pentium III Metier beard 12SNS 133mhz SDRAM 32M100mhz SDRAAI 128M 139mhz SDRAM 64M 100mhz SDRAM 128MB PC100 SbRAM

KSn-Sao. $599

BMS 3b ASF Video 6.46 Ultra DMA HDD 48X CDRONI/ 1.44M FDb

Wings KeyBoard /Mouse 3D Sound / 140w Speakers

5SK V.90Voice/Fox Modem •

•

32M ASPx4 Video Card

138 7200rpmHDD / 144M Fbb 48X CDROM / 300w Ccac IntenetWheel Mouse / Keyboard 3D Sound / 140w speak«'s 56K V.90 Voice/Fax Modem

BNBATI Xpert98 ASF Video Card 6.46 UDM/t HbD / 1.4411 Fbb 48X Ulfro DM/I CbROM PS/2 Mouse / Keyboard 3D SoundCard / 140w Speakers 56K V.90 Voice/Fox INadem

32lhs ASPx4Video Card 138 UDMA Hbb / L44AI Fbb

Asua V8860 GeForce 32M AGPx4

205 7200rpm HDD / ZIP Drive

48X Ultra DNA CDRON SB 128/ 140w Speakers

10X DVD installed Sound Skrctor Live valse Altcc 54w Subwpofm + 45psafmwc

InternetWheel Mouse /Keyboard 56K V.90 Voice/Fax Modem

hogitcch Wireless KS & Aleusc USR 56KV.90 Voice/Fex Shod«e

•

Prtceend svegsbf lily VIDEO cub/ecf lo cbsn9e wlthoirf Pr/er nodcm Creative DDR GOF«ce Annihilator 32M....379 CPU Asus V660DOOAGsForca 32M dlu&........409 I F voi i i Asus V3600 M64 32M / Vsnia 16M....149/109 u 7 t 1 1 P 4 ri 2 AsusV3800 TNT2 Dura32M pure/diux20$/269 Intel Celeron 400/433/466......105/115/119 Maiioa G400 OH32M soma.....,........,.,.,239 Int I 4 /2 Diamond Vlper2 Bavsge2000 32M xspaa,....249 ieamimPgl-560E f 55QE..... .......3391 379 SniperTNT2 32M inpaa/penv........ 125/139 ieeaaaPgl-600E I 650....,.. ......A09/589 SniperTNTI 32M aopm m tv masm.............. .. I6$ PI I 7 I Sniper Geporce 32Maapmpcnv.............299 Pg/ ATIXpen96/ Plsy98 pctsv SM aop,.......62/ 79 AMD KMI-360 I 450..... ATIxpenofrisy p/nm SM /ac/...................39 AMDK IIATI Fury Pro 32M I Msxx 64Mporn» 209/ 379 AND K7-500I 55D...... ......275/285 ATI Agrin Wonder 126 1611 /32M.....229 /309 AND K74I00 I 650...... ......239 / 339 ATI Ail-in-Wonder ProSM/32M........159/call Ky-7 / 7 I I ATI TV-Wonder Tuner & Capture Cmdsax....gg intel Pentium 233mmx..............................60 Sdbt Voodoo3 2000 16M aop ..................129 3dfx Voodoo3 3000 16M aof' I Tvout...169 I 209 MEMORY M M M 1 M M Bdfx Voodoo3 3500 16M asp w/TV Tuner . 339 inmm SDRAM 55 89 169 34 9 SM PC/3D S3 Trio / Pine SiS................591 49 a«usa SDRAM M n PTNT / v P .. . / 7 $ 9 1 7 9 36 9 7 Logltech OulclmamExp IWebuse.....591 119 4 9 14

MOTHERBOARD Super7inn+ Creshve Sound...................105 SUPSry farl+ 8M Video + Sound............... 129 Supsr7ium+ SM Video+ Sound+ Modem 138 Acus S uper7 PIA ianp / P5ASlava...1 26 /115 Atua KTM At&Ion aaamamraap.....,.........„,gfM Gl s 7IK Athl ar ..I Pili i81 0 <arxl + AG P + Soundmr/vn...........129 Glgabyin SVXEatatn sane»crate............t cp &Open AKSSPro immi iaauaamraap ... „,....115 Acus fetal P3V4Xsmuaaa rasaaema........,.149 Asus Iatx/ P3SF..........,............ „..............179 Asar iatxi P38.1394Fi/opt m......................259 Acus latin P3C.2$8D am......................... 229 ASIT tatxl BE6 II I BPSxrpes............ Ig& /199 ABIT istic VA6 latm»m ass».............. „,....129

ihuDIO

Crystal 3D Sound Card isaip« .........,...16/19 Sound Bluster Ensoniq / PCI 'I28.........31 /44 rl v I ' hlulumedis Speskess...........................B I up

GNT5000ASub»outer +Speakers...............52

CambridgeSubw + 4 Speakers snsmme.....109 Altec Lansingxcs33wl 46.2wl 48w5W85/155 Aliec ncsgcw Subw+ 4 Speakers Input.....95 in I f I/Iicmphons I Headset Mic +Vol Contmi....6 / 12

CD-IIOM/ CDRW / DVO

46X Uleon I Sony...............................56 /6$ X I Adspleo EZ CD Creator...........................25 Panasonlc 8432 CORW en ......„...............499 Tamslta 8424 COIIW xu/ scu.........379137$ NDD / LS1 20 / ZIP .x 1 x Sony 6432 CDRW ne/son ..............379/379 Fujiisu 139 149 159 175 1 9 9 Sony «txs«sx 4x2x6xsiss«sam»CORW.„369 Sfsxfor 159 I 75 1 99 2 1 9 2 6 9 CressesI Plextor 8432 CDRWios ............379

MODEM/NETWORK 56KV.90 WinModem pci ......................25&up 40pen 56K V 90 Voice Mode«ca/p«...69 I 49 USA 56KV.SO WinModem/ Voice p« ....53155 USR56K V90 WW Nodem/Voicesax.....7$ / 99 PM Flbemet Card Rtts iamips p« .................... I 5 Abpen RJ45&SNC Combo mrna»a p«Inn....19 AOpen ipuimmamp«Fast Ethernet Card......26 M In k i aplpmapapcl iasrmsmmmm/......,......26 3COM30905 i map»spa pci Wekewndsn......72 PCMCIANehv«k Card iamips .....................9$ P Ethemet HUS5/8 Port sama« .............35/45 USB -7 16mbpsConvener ..................,...,69 4 r I nk I N etwork Ceble10/20/30/50' ...7/10/ 15/ 19

MONITOR 15 Ca LOW RadieIOn imparts............179 & up ly" AOC m 7GLR lxsyVLR..........>75/25$ ViswSonicsr E7711mE773 ...........3D9/365 mPF775/ mPT771........4991559 m PS7751m G773..........4691369 xr G5771/m GS773......419/439 OP&tuestsi Qyt /m Q73................309/319 Sony mG200/xa E200.. .........599/529 Samsung xr 750S I sa 753DF..........299/379 16" ACC m 9GLR.......,........"-...."" -.459 ViewSonicmE7901m GS790.........509/619 m PS790 /m PF790........699/739 Opeevaai sr Q95 .........,..................,...529 Sony mG400/saE466...........939/7SS Samsung m 900NF / m 950P. „.......649 / 53$ Psnssonic m SL95................................629 21" Viewsonic mG810/Cpsq seQII5...1099/999 Sony xa5500.........,..................,...1489 PRINTER ( nsaaiaasanau I Canon BJC-1000 12MD' Color..........89/139 EpcOnStylue 440'1660 /740 13$ / 179/21 9 Epson Stylus Ph«o 750 ccamm iaacem .......359

Kaybim/d a. Alouse Coiiibo...............,....18 Wlmlesc Keybosnf................................45

Inter netKeyboradIhogiiech.............25 I39 Chinese Keybosnl.................................I 9

ChineseHand-W ritingPen................., ...79

Fugmu 8725 Keyboard.....,......................18 hl ral li hiS Wtmel Inta&imouse 25 2B Serial/PS2 Mouse...,............,.............8 psmWheel Mouse I Logileoh..............12 / 16

Tnackssshtouso / Finger Trackss8...29 /25 WirelessMouse.........,..........................26 M U

PS2++ AT Keyboard Adopter...................5 Keyboard Mounted Drawer.......................18

C ables forMonuorlxs/M ~

em.. . 7

Magnetic Shield Monitor Cable ................19 Printer Cable lci-Diiactpmu) I'115'...,.....7/15 IDE Cable/33 Long...........................3/6 Power Cord I Split I Sar .................2/ 3/6 SCSI Cable with 3/ 5/ 7 Connector...6 / 8 /12 SxBNC RGS VGA Cable,.......................25

Ethernet Cable C rimp. tools / Tester ..26 / 79 48S/Peniium/AMO CPUfan...............918 Duel Fan CPU Cooler for K7 CPU.............25

Slot Fan idler for overcloeklng................15 CPUCarer kfsmf lor OverCloeldng .. 15 & up Healslnk Compound/ Timnnsl Paste ...,..2

CaseFan3pin/4pin sassaaaap............15112

HDDCooler I HDDVentilator............,17 I 29 Mobile Rack wf tan for HDD ............17 & up Meblfa Rack wf fan 47468.......,...SS & up Mounted Frame toi FDD / HDD..................6

Switch Sox forPrinter 214 porL .........15 / 19

Switch SoxforMonitor2/4 porL.........1& f19 SwitchBox 1«system 214 way..........26139 Printer Card/ Enhanced...,...............18 /24 Monitor Screen FIRer 15 /17 ...25/39 &up SCSICard ocsss/astu/mpp......55/69/139 SOS I ExL Cable.............................19 & up Esh Box hx CDROMI HOOI CORW.....,.79 i I ts'-25 Case AT /ATX Various Styles 29&up Power OVD Software Daeorder...............25 4 1 x Power Supply AT 230w / 250w.........25 / 30 8«OVD Pana so n ic/Asus/ Creabve..........ceil HP Laser 1100 / 2100 .....................549/ 959 PowerSupplyATX 250w/300w........39/59 6/sx/or 179 1 5 9 249 319 10x OVDPioneer.............,.,..................osll Brother Laser HL-1030 .....,. „................,369 And<fagsWristSkap................ ".."..".........9 D SCANNER (vuwm ~ P62 P«t I USS Port for Molherboapd....6 / 16 LS1262x tggmbSuper Drive/Disk.......88/14 Blank CD I COAW.............1.5 & up I &5 & up I Zip 16MNS lnt IDE DmieI Disk........,,...85113 Blank CDSpi ndle 5gpcs I100 pcs ......68 /128 Acer 626P'I 62051620U'...........1391149/139 Aoar 628UT use Tmpapaim»r Capeum.........209 MS WindowsSS Upgcsde 2nd Eduon.....129 2ip 256MB Int IDE Drive/ Disk.............159/23 ggmln Sank CD Recordable ............ TLS& up Aces 620PT / 62087 scn Trmmpam mw 21 9 / 23$ MS WlndowsggggProfesskmsL..............209

c HA N DS O N n

Money makes sense

that is predominantly American. Even better, Money has links to the MSN the fact that customization is easy for both the hasplenty ofcalculators:mortgage,loan,sav- MoneyCentral Web site where you can find user and Microsoft's programmers, who have ing for a car, saving for your child's university current mortgage rates, and current articles written by writers from magazines like The included a number of simple pages.These pre- costs, and others. Another important job For the program is Computer Paper, and newspapers such asThe defined pagespull together data based upon a theme, such as Th e H ome, o r O n line helping users with major financial decisions, Financial Post. Accounts. such as buying a house. Sure, there are mortgage calculators but, more importantly, there Pica and bars Loans ond morlaaaee are a good number of articles as weg. These Likely the most useful feature of Money is its Once the user goes through the surprisingly articles are Canadian, which helps set Money ability to display your income, savings and painless process of entering the initial data that apart in a world of financial advice software spending data. Ta do this, Microsoft has is required, the pmgram is ready to begin work One function is calculating, and Money

Cnnrinued /iam pagedd

1266 WeStBrOadWay, VanCOuVer, B.C. V6H f66(D khfnmwiiej ~ - Mtaotmesa ggessswt:Ailtstt-Sat I li00.19:OO • Sttit I ' D

aa vtaaa

).44MBNoppTDdveS

. 32X UDMABIDECD-ROM

vesrln9Sroak special Ontyv

GAMSUDMAHaul Drive

1.44MBFloppy Drive

uxintaws 9e SSCD

Egg~ AguaKTM ATX M/6 ~ 64MB PCICOSDRAM ~P

Pcl 126sound

AOpanAXSgpm/ABNVAS Ceppomdoeh?I(M/6

Wta Keyboard &Mouse PowerAmplElsd Speakers 16 AlX TowerCsee

a3P

$ggy

c ssxruzaws 2000 pm & -~ l w ' o g w/5 v m Pnnlla5edONLY

I A4MB NOP PT 40Xgiog uohmCD-ROM 13GS(?tempo>uotm/tm Hwd Drive ATIRageFuryl 26 w/32116902?V SSKV.SOF/D/V Modem 16'AIX TowetCasew/cwt zoowP/e

Hetql Dylve SleUINI 17.266 EIDE URro ATA 44

$$90 64MB PC100 SDRAM 13.306 UDMA/66 EIDE HD 40X EIDECD-ROM ttvldlo TN?IOMShap VideoCard SausdSIa sleransoaiqsoundcam

&atmoooxtoo BleakCD/oomin................ge.se/Les

SSotgmmeSlstwudzkbtttpbws

iinw pemy ptt/lu tcscmx..................-........,...etve

ZsutNS inaumu lase waeybmni.,..... tines ZsusFeo'0/0/0'8::. :..'.L..,.......gogo/eaa/eee ZsasKtttXV AT)(w/lhe,eoaad...,...,.;.....,.. .dele

hepta Izkt asgTOOaoanrta ....See

Lspue hwtudKouss ...,.................gta

FCIIC?hOeg Vmne? Seen rgVe/Ss gtherastIso AdapterCard .....Old 0 Link ago?X FC?10/100..., ..S/m

Ampuasdspeaker..............,...,....,gs

iocwgZt pDisk.....................,....eta 144KB 900 ............... .................4ts

Piu SOO/SSO/ 800/ SSS/Soo (PCISe)..........Cau

Atm Ks2400/Kea400/450......,.see/its/Oaa awuxvBoo/seo/aoo/eao/700....,...,.....-.oaU go/Oq/ISSMS PclooSbh/OL:...'.:.........,..:..NeU Scmms gOavtg e Npoahtwm Bound Slastsr ln PCl......................................ges

SSlornValue/IliaPlatinum .................. gea/Sae Aarsai Vortex I / Vortex 2 ASDPCI ..

Intel Pro ioa PCI ............,SVS Scvm3CQCSBSIC,.... . . . . ..gee les e/am DLiake/eVariw/Buc uuh .See/Wi Sasmoakncoaasct t/8 ., ..eee/tes

Lmphnrq mo mazpwkm".;.' ..eee

ia SamsungSsoa.aedp Svah...........„....,...Slog IV' Kugyg-lye.svdp..............,.................„........lima IV"SamszadVsogXydp/VecoJeep...Says/alo H" Nho Xdyeeyo e . adp..............................dose IV'opuqzsmq?3/Vya........=.....,..Acio/ess tv'vtsnaoaicsvvI.2?ap/pyvm .zaepe800/atw it"vtswsvatsBvva.zoep...,.........„...,.......4eeo IV"10 ' /Vs lastarea/Vga+teaasiest.,esse/eee IV" SSCn/Oo.oodp........,:...,.........,.........gmm

.....gaea

Creative aamhrtdtb Pcgbrk epvlat Spiwr

witheuhwaofvr/ytueooaDhptsl.........,.gee/teo CrsmivvHomeyhsatm s.i,.„....,...,c.......,......,guee dlts cLszsiag'AC803w/gutnmofer; ........,....,.gee Ahac LsasiadACS404 w/Sahwsobr „...,...., .gtm tuteeLaasiadAcgsa6 Fviasw/duhwoofsi.......ges tuhnQuieted eases W/SahWSO/era .... ., ..Stye

RJee esp?a to/Zo/600 ...Ss/tc/to

Coos is" Towerw/zgowAT....,.,.,,.,,...,me Ie/Iy/Ie" ttnwrn/S/kmstxese/de/ee

TgastgMtrtwe (XDM) EaB?ahLMmgm 4.s /ed/Io.e/ls,s/Iv.zspgtas/teo/toa/tee/tse Matter13.SGS(Vgocrpm).........,.......Stoa' qamtum18.SEX /eo,ogx<yzoorpm) ..late/SFS. Pxlmhex Num 4 Ucwmmew*saw assesmaw daeva1000/S000 Color...........................sos'/tee'

uptoneao/eooCater..... .............-......-oeo'/Its* gpsanVaoyhsia C okir...,.............,........,...,....SISS Caaan Slca Cater...............................................Sees

is'Sonyaccye/azaae .....,, ......,....,eeoc/aee sp Dss Q}t IIcocxtProf.Printer...................Soap

19"Vimrsaa!cSye a .sade..............................egos EF Dash)st 1isocxl Prof. Printer...............,. gese la"Viewseaicye?go/Ptyos.egdp.... eeoc/mw i Hy ilcoh/tlktnaaePrinter P/9/8/...„.„,.......eeoc

play on your home pageeach day. 30 clams or 00 clams Money 2000 costs $29.95 and has everything mentioned above and more. Money 2000 Deluxe sells for $59.95 and adds additional investment and planning information, as well

as a few functions for small busintus operators. (There are mail-in rebate offers for both versions, which return $?0 and $15, respectively,

For the person who needs to track a few stocksand maybe an RSP mutual fund, Money Deluxe is a good choice. It is twice the price of theregularversion, but for thatyou gettools investments. One of those features is Roaming Portfolio, which — through an email solution called e-Noti6cation — aRows consumers to synchronize with their home computer when trading stocks from another computer. M oneyCentral i n cludes data o n al l Canadian mutual funds, more than ?7,000 stocks. as well as stack quotes for Canada. Other benefits to the Deluxe package are some small business toolsfor invoicing and tracking customers.

The envelops please Microsoft built a browser, which eventually edipsed Netscape. Has the same thing happeacd with I ntuit's Quicken, a personal finance product Microsoft tried to purchase five years ago? Comparing the latest version of Quicken and Money 2000 is like comparing two beautiful siblings — they are different, yet very similar. In particular, I really enjoy the clean look of Money 2000: it has lots oF white space, yet maaages not to look too Spartan. This year, Microsoft finally figured out what intuit has long known: the Web portion of personal finance software is very, very important. However, at the time of writing, the

Microsoft web page (htip://www.miciosait.corn/caa ada/monsy/ozone/haaidng.htm) shows only a half dozen or so Canadian financial institutions that have added the download feature to their sites. (I am lucky that my financial institution supports Money and Quicken, and in testing, downloads fmm both worked Sawlessly on every occasion.) While only half a dozen institutions support Money, more than 20 offer account transaction downloads for Quicken (htipy/wwwquicken ca) Thc king remains on his throne for another year. Ct

Red ty?ssooopsoho.......,......,....,..............,.evo

Vltloc Jhdttpgozm ATISadeyuty Aapsmm yceTV....................Stye MI sagayuty proagtm vidsaInseut...,.....„.NNS ATIitsiaWonderles 18/32hm A0P.....gote/Ste ATI Sagaymy Naxzz ogle A0P ..................Sees ATI TV ttaadsr Tuner ...................................gee

.......sea/Ss ZeusTSTZVS800TVSsmm/ uhra........ghee/ese

bimaoadmiash r htggoo .....................................Soe

uetyalmytg/t~ gzgugOiai/ee

WingsPZZ/hyKeyhomd ........,...„...ee

I'/ SonySZ00Xgep.......................

Csi siaaSee/taa/tez/tee/mme ye/ee/tse/Its/tse pti400/ps ego ..............,.....................,.sloe/seo

Iat /ibt 66?IVOO 0/9/9 ......Sae/gs

Bast CD/CDI?-W............gl.ee/&ee

Litto n PC Camera.....,......elle Lagtwh HomeCamera .......4? Ie

Aiiu sF300000iegcCappsrmiae..................gals

20.2eSUDMA/66 HardDdve mvlcNcs TNT2 32MSzopwomcwe

460W Speakers w/ Suhwoetar

$140 (mmVegaaehoie)

Ahit Eye/sse Il/spe ................siss/I'te/tee

44X UDNIABIDE 0 -ROM

MullmedmugnKagbatud &Mouse

WebCamera OBIS) CrsatimCamas ...............else

..SISS

1.44MBFloppy p

PowerAmpgtled Spealwrs 17 ATXTowerCase

Bgcmltcr ithtt VA4 VIA/ippoga w/lde Sound.....

AsusP3VOappwmlaeA?XM/6 126MSPCIDDSDIA

W inKeyboard liMouse

Mltsow740 Color Fdhte?

deueysh / Fahh SupsvyATX....,.........,..Stes/Ms AapsaAXasFraVl/taappsnaiee.....................otto

I year parts and 2'yearslabour waranty

64K V.VOF/D/V Modem 19 AlX TowerCase Diamond Nmwtertmgoosemd Cme

66KV.SO F/D/V Int.Modem

eotmtata nm/vx.. ,

Win Keyboard& Mouse PowerAmpleedSpeakem

part of any graphical representation and the data for the segment will be displayetl The program even sdects a different chart to dis-

formanaging, tracking, and analyzing your

44MS

40X UDMABIDECD-ROM SMSAGPSVSAVideo Card PCI 3D Sound 64K V.90 F/D/V Modem

4MS AGPSVGA Video Cmd Ialegrated16bit SlereoSound SSKVSO F/D/VIut.Modem Wia Keyboard &Mouse PowerAmpNlledSpeakers 16 AT TowerCase

it us 0 www genericcamPuterhc ca

a spreadsheet. Even bener, you can click on any

to purchasers.)

Intel Thill S33

PC )C O BO L~pe

4.369 UDM AHaul Dave

' jeoglPPf f 2 Q un

P 6/NI Maths?600/d

32MSSDRAM

+Igg gOOO~Q: Ait systems come with:

le yon 36sds

: PeaSumUATM/B

$4CkfW

n e r i C OMPUTER f $ $ $I,

Intel

-1 6rOO ~ 0

induded a number of dilferent chart a'nd graph formats. You «an view your account balance as a line chart, a bar graph, a pie chart, or

/tsusotyarce3ZNSVeeao/Dsltm ...........tete/Sao AcusasperseDDR32IIS98800/Dsiux,.does/Ote skusoxd vipervv70seKs/Citis...........etve/ese avsativsTa?OAQPex)IS Vates/uttra .....else/edh

EP ee000 Seel/000 Scanner 1200dpi ..........Sess

Eycgcod/02000t0$0 dcaaasr>....,..„,gtoe"/ods" Assr seoyacanasr......, ....,........................... egP:

On-a e On-awavzgeoo eoX CDK/t CMOK..........................................gee Crsatha SSXSlug CbaohL........

....................,.gaa

ugc Dybs 8X iat. IDE...........,........-....-...„.,-.Stae PioneerDV00 IOXlog / Sm..........,.......otas/leo Creative BXDVISEtt.................................-....gogo

Assr OaoeiBxtxm iai. IDECDRV..,,...,..........erne Creat ive 84M ex4xet iia.IDB CD-SW....,.........gage

creative aspersetaaashtw hv w/pzus hap.gute

Crssu m ease Ozdz@tat.IosCPhp, VSS/

gotxygotx/?vwhm IeKjjzdk. eteo/eep kkemzNgktm atoo le/szktp emghEwzi slee/eoe UstmzNDmtatoo Sutg/thwDmigsadANe/Stm

Byeeect IDEint, CbhW.......,..........,............coeeo Ysmshs stza tat / azt ecel...... .,...esse/esu m Sgtoexazosmt. goal.ykuu .. .,.geeh

• tvkmo spec. ma suhlaet tc ehanoa w/a no/ma • Ae pesos mihmt ta earn teseount• Ae pmduet nenes, tradammks am pmparik¹ ct emir mstnmmm awnam • SS APRIL2000 THECOXupt/tml PAPER SC EO/ntzt vnan ~ e

s.c om

The American Museum og Photography NS-The A m erican M useum o? Photography ia a virtual museum dedicated to educating, informing, and sharing great phc'tagrapha wilh illtalrlat vleltam worldwide. Exhibitions are drawn tmm the museum'e collection, stetted by William 8. Backer more than 30 years ago. The cagection includes 5,000 individual images, from the aaluaet Phatoanlohm paltralta ta ule work of Ansei Adams. Each photograph ia chosen for ita visual impact aa well aa for the importance oi ita content. h tax/Avww photasnlphymuseum.corn/

WORLDWIDE N

BridSe ponRoad

MJ(I(R: 83)IC ' COMPUTER LTD.

+, ~

9 vrnrr in Susinrrrr Snh/rrt ru munufur/urer wurruutvr

SarcAurgr fnr r edit cards:

VANCOUVERStore 6596 Vtc(oria Drive. TEL: (604)327-2003 Vancouver, B.C VEP3X9 FAX: (604)327-0061 Hours: 10:OOam - 6:30pm, Closed Sundays 6 Holida s m

WDRLDNDE

Customerspny shipping igulrr nr Rrpvirl W ~

4 4 4-

R(CHMONDSbom 1104-12611 Rowaft Race, TEL: (604)270-7200 Richmond,B.C V6V2S6 FAX: (604)27(b6366 Hours:9:30am -6:Oopm, Closed Sundays 6 Holi days

ClarkPlace worldwide group

RlcDMond t

WorldfechAND56.II4$0

WorldfechCeleron466

OATX17' Case

OATX17 Cess e 50x co-RG M O50XCD.ROM OAMD664450CPU(K65-5Q +NO elnlelcshran466CPU(500+$30) eCPUCoolhg tan eCPUCedngtan Ot.cc MBRoppy Dmre O1.44MBRoppyDiva e6 4GBIDEHant Dm re(BAGB+St0) e846010EHudcr'm(102GB+Q5) O32MBSDRAMPCI DN64MG+ $40 e 64MB SORAMPC100 456K InlNoicc/Iax/V9WModem e56K WVoictaxN98/Modem pena pseoueeana e agsbyle GA.5SMM owilh hibcn sound/video Ow/Sound6 Vrdoe Ow/Network

$$45 orDCALL 9 55(O SB.' $20

(pwchascdwia anysystem) 140WSpsacr Qn98Keyboard Gerer'eMoirsoW/Pei MieophonsW/Stand

$575 arDCAL L

eAO(tg Case

325WSpeake

fuiiuu0725Keyboard

MSTrackerMouse2bW/Pel Mice nc W/Shad

O55XCO.ROM OAMOK7400 CPU(650+ $55)

OSOX CD.ROM

elnlsl Pgl560ECPU(550E+525) OGPUCodeDfan el .44MBfloppyDave O102GBNEHmlDriedt3.3GB+$20) OI3360NEHwdcee(17AGB+SQ) Ol 28MBSORAMPC100 Ol 25MBSORAMPclgg O56K Inl/Votes/ax/V90/Modem e56K IntNoice/fax/V9NModem Oayeylc7NEgisusKT M+$35) engdhh6lNESNZtm+Q9) e Cteative Ensonh SoundCard OS.B.120PCISoundCard OAHXpet@Q BMBAGPVideo OATIXperhpt2816MSAGPipaso

eCPUCook'nptan ot.cc MBRoupy oen!

N14$0r DCALL

• fuidsu6AGBIOE(discon5nuesaon) ................ $139 funsu84GBIDE/108 ............................ $149/$165

IOMEG A ZIP OREKTScsi ......................„.....,... Scag , fujisu136GW172GBIDE .. ..................,.$183/f205 IOMEG NPANASOMCZIPDRINTN ......... Seep/$90 ...... $193/1234 10MEG A ZIPDRPLUSmginL 250MB.............. Seep . Ouanhm13GBCXIOB13GBKXIOE Oumlum202GBCX/20AKXIDE .......... $249/$295 LS120lntemaHO E ...................................... $112 ' Mmtor SA/8.4GBOEM.......................... SI50$159 IA4MBFloppy(hive.............................,....... $195 MmtOr 102GS................................................ $162 • Msxior13GB/13G07200 ......, ................ $187/SIQ , Medor'17.2GB/28G07200 ................... Q05ISZQ ATXIT 9850/ST3/787......................64/$45/SQ , Mmtor27GB/27007200.....,.....,............ $30NQ29 A1X19'T87deime/9858/ST4 ....,......... f4035$$52 . Maxlor 40GS...„.....,...................................,... Scaii I Hed OtivePeasaCap..................... Scall ATX24'250W/QDW ......,......„....,................ $75n88 ForSCS ATXIS 325Kbius/while ............................. $40$49 ' dergaerd • Fupisu 4725,..................................................,... 858 CDBgn furisu8725 .................................................... $19 Accr eh /Aopen 4th .............,...,„.„„„„„ 365/QS •. M.S. NaturalEue..........................,.................... $32 WIN98 Koyboed................................. $11 Asian Nh/Afrecy Nh ....,............................ $59/$60 Generic M.S.Interet Keyboard...............................,..... Kn crea5ve4th /crcabveSh ...................,.. $6B368 ' UTEA)N UITERNET .............,..........................,.. Qb Samsung4h/Panasomc 40x.....,................ Q5WS ' LopilschCordessiTiwch (Ks 6Mouse).......... Scag • Tu/bo Media EnhancedWe9$Keyboard ............. $20 CBWdter . MS USBKeyboard .....,...„..............,............. Scali Crcacva8432.............„.....,.......................... S!96 HP921lhSCSI/9110ilOE ..................,.. $495/$395 Noerorr HP82gaIGE.................................................... Q15 16MB72Pin Regular................... ................ Q3 Sonya«Q....................................................m8 ' 16MB72en Ecg.............................................. $48 Ysmaha8424IntBDE /SCSI.....,...........SCGN$423 ' 32MB 72PinRegular.......................................... SN Mesumi4424.........,, ..................................QTS • 32MB72pin EOD.............................................. Na DIMMiPC100) ............................... Scall Panasonic0432............................................... SNi • 32MB SD . 64MBSOOIMM(PCIm) ............................... ScaB . 128MBSOOIMMPC100).............................. Scall DgsBgn(4em/ CreativeLabsNgcraaha Labs103........ $1324145 2QMBSDDIMM(PC100) .............................. ScaB Panasoric gx/machi 6x.....,........,........ $135/Scab ' Madam HQQR ih SCSVlthrIOE...................... $199/$175 • USR 56KmiNO/faxfgos/PCIN90 ..... SINVSQ/$61 ToshbsIh/NECIh ................................ $149/$139 . Aopcn 56KIntNOIISAN90..................,...,.... Q/ ,Aopsn 56K lnyfxtNo/PCYV90 ................$426 109 BCSICmtmlhr CaN 56k V90............................................ Q6 Adaptec1Q5 .............................. ......... Scab . MOIOrala GVC56KBrl USB.......................................... $123 Scag AdelccU2W Scan ' Mon/tet ooair • Acana18' ...................................................... e189 Adspree 2944uwDm sranest Asusac 20N875 Scall . Acana17'/Acanalgb................................$2N7$478 IbamondFire Purl 40 Scab . Acer15 512/77c (Iyrlsboe)................$265/$34S DiamondHomeless Card SCap . Ately 77F/78E........,.....,,..............$34(y$123 AN I 5 4P ..................,................. ................ QQ ' AN 17'5P+ .......,........................................... QQ CP(l Pneeesar ir.fp ..'.."..'...",.".'...","..".".".".."."."."."."..".."."."."..... Qbe AMDK6il40N450 ..................................... 574/$87 AOC AMOIO55N600glox) .......................... $321/$355 Dsytakis'i 53N .......,.........................,.......... SIQ AMDKT65W/00(Bos) ......................... Soughed Osytck I7' W26D.......................................... $295 AMDKTS50 (Ber) ........................................- teell Sony17'216G..................,............................. Sceli tr A100 .,.................................,..,,....,,,,. Soap intel P.233MIN ...................,.......,................... $55 NEC 17' E70NE750.......................................... Scali inielCsieron43W466/5Q,.............. Stgmtet/SZQ ' NEO c15 $50 ......................................... $2Q Inta PB400wifan OEM.................................. $178 Panssoni Pmasoniety'SL75/SL90 ...................... $445/$725 Inlsl Pig45iy505E/500woen ......... QQ3415/Q99 • Preview15' ....,......................................,........ $196 intd RB5330/550F/550 w/Fan,...... 95/3436ch25 • Praem 17' ........................................„,....„Qtfl IntelPBISCDEISSIY/00 w/Fan....... $497n6%41059 •

gg5(2(J)'$1 25

yurcnasadmth anysysten) 3D-I 05455WSpcecr w/Sulmmisr MSinternet Keyboard M,S InicbrMousew/whcli W/Pel MicrophoneW/Stand w/ioysbck

' I ~i

II., I I• 0 "~

(33565()S ww

IESatki~im

%43pldwidIe

II, II: II,', II

Syh Am.

Vaacgugsr

toHhhcalenderday:85% refund/ repime. r

. r ra

r l : I

WoddfechPID6DDE

y ATX 19' Case 4 50XCDROM

etnlcl PB INNECP U (650+$70) OGPUCooling fsn O1.44 MBHappy Dive elTAGBNEHsn&lmtaLQB+SN) el28 MBSORAMPCIQ O56K Inyyoice/teW90/Modem OAsusP2-99(P30-F +$45)Matnbd OS.B.Hvarvahe PNSoundCml e AII Xperl@2000 32MBAGPVideo

DIZD5 or DCALL Q(55$(L'$140

(purchasedwilh snysystem) GNTTO QASpmlw w/Subwmhr M.SNabml Kcyboed MSlntcai.Mouse w/wleBW/Pad MicrophonaW/Siand w/loyslrCk

Proeew15 ...............„....,.„...,.............,......,..Q70 LCOIII flatmonilor ..............,....,....„................. Scall

Sceptre15"oraponEye..........................,......... Seas

Sceptre17' Drapsnfye.................................... Seep MspNievSonrc/Opbeuast .......................... Scheek voxon/Hcacnvs&lssnyfvm..................... 5cllmk pfotporbee/4

Ahi BE6.IVBF6/BIU6,.................... Stpp/$173/SIQ Atui BP6(DUALCPUSLOT) ............................. $215

AsusKTM........................,............................, $210 AsusP38.F/P30-fl (Pbl PC100),.......,........... S197 AsusP30.1394 ........................,...................... Seep AsusP20sensa........................................... $159 AsusP2.99............,.................................. SI45 AsusP5A(AMDK6 8PC100} ......................... $126 Asus P5AA (w/Audol ................................... SI39 GIGA 5et/5AA (AMOKc II PC100)........ Sit SSIIZ GIGA SYXBSZXC(PNPC100) ............... $115ISIQ GIGA03250BOOAAT ................... $1550134$125 GIGASSMM 9+S ........................................... 5115 GIGA7NE........................................,.....,....... $198 Micruster 5184 AT......................................... Scall

Mateonic 7348Allnene (end+mdm+vdo+net)$122 EatsP6-SET.MLAlive.one .................,.......,., $115

Noese Aopsn20 PB2„....„......................,........,....,.„Nl

Gcnencmousciwi5r wilcol .„..................,...... SBQ Genusnetmouse.... ..............................,....,.. $13 Lcytcch20 PS/2/Secs ............,.....,............,....Q Loytcch 38PS/2........,.....,............................. $14 (speech1stMousew/ wheel ...., ..........,,...„.. $16 Loyt8ChCordless MousensnPlus................. Scail Mesumi 20 w/Whccl.......................................$11 Ms InlawmousePS/2 ...................................... GU MSConeessMouse...................................... Scag

USB38Mouec .......,..................................,.......Sll me <~ w/mhue)

Canon0/C.SIQ .............................................Sm Cnen BJC-lbgg/2050............................ $114/$145

CanonLBP.17ap ....................,.................. Scaii

Epste4HVEpm/r660.............................. $14N$176 EpsorrPleo 7iNV40 .................................,..... 6caB EpsanBW900............................................ Scail EpsenL0470070 ..............................,.. NI1NQ73 EpsanLOSrtyt)t.300...........................,.8347/Q 45 HP 710C/11NLCSC r,...„.............................. Sgall

HP895C/6PLsscr........,........., ................ Scali

Brolher/ Lcxesrkl0kidata ............,....,......„Scheck

Scunner Acct/UMAX/HP/Epson/Micolsk/IBWAGFA. Schsck Baaed gerd

AccrAW37tSA/CREATIVEEnsonic ........... SINSQ

AureslAUQ20PCI................................,..... $35 Diamondnu-300 PCI.............,...,........... Schcek

MSWIN98VS/NN2000CO..$30FF AWEPSONPRWTSI..............QOFF C/WO N10m2NN ................QofF AWSCANNER ......................$5OFF fpgllmp8210+ ................. $50FFCA)WON44Q.....................,...SSOfg Qmsmply 750S .................$5OFFSPBNBI14%......................$10fF DAYfS((5'17262 6O P...........QOFF SPEAKER320W .. .......$20fF OAYIEK17 1726SSOP...........SSOFF ANYKEYBROAD....................$1OFF RWASONIC17"SL75..............QOFF ANYMOINE.......,.....,...........,...SIOFF OP1IOIEST............................ $5OFFANYMICROHONEor/OYS'RCK....$1 OFF

Dowrtloodlview our price list (I)Commom Items +systems (2)Complete Items Producl iotvoduclioe le Cblaeser www.pcueliec.curn.ce

SaundBlaslar120PCI....................................... SB uvePCIreial Ss LhreVALUEPN VmahaXwsve-3OQ PCI

WdmCent/FCI/

av es

sie ve'

arcstvv

• res"

lepvrsv

rrs rs s Vl lr v Iver • vv vtvr 'rlvx tra v " e ver r v v

r uvlrr v

$3IRNBMB ...................................................QB SIS CMB........................................................... $39

clrrvui v scrrr emu v vrv vrrsv srvvflr

exlrs/wc n vrrr

4! v vx Crlxxrr

rvvmv ve r e' rlvr.rrrvur ever eaaelaa osvrvvx revs' 'lvwv srrs

srxv" sl'ls''

sass" rrev"

WdooCard (dgP) Its/was AsusV3600TNT232MBAGP .................., ... $265 o vt x ls'vrvvx rrvr AsusV6600Geforce256 32MBAGP............... Q25 xvxvlls xvrerv rrv ATIXperttpps BMBAGP,...,.............................. $70 v eevvurv r'r' vlr r ATIXfartrpt 2816MBAGP.„,....,................... $135 rsvs sr • v' Itrvx viresn cc vl r v ATIXpertr9200032MBAGP......-.................... Q75 Onr xu xu x • lvv rsvp rrrv' \'lv vl 5 vrto ATI AsIn Wonderip128 Pro32MB.........,....„.. QZ/ 'r rvs Veer' xarv sar mrs ATIRepel28fury Relet ............ „.. „.............. QBS rover vr 1 v' xsrv nrr srrr Ali Rapt FuryMANIQMB .........,.....,.....„.... 6439 mnrrw q r rr v " e r r Mmax Qgb 16MB/32MB...................... SINQ229 Geeec RIVATNT2 32MB................................ $142 GeacncRIVATNT216MB .................................. Q9 Ssvspe6432MB.............................................. $128 Dltpi//ewwseer.cgm/ CestiveLabsQForca Pro 32MS.................... Qpp 53Tna4MB......................................................Ne Dttprjjwewad(USg.corn/ Vaodre 6 ~ 500 AGP ......,.".'...'.".......... ScaN DNR:/ jwww assp.comhv jprgduc/s

gdd OnPr ruser Stkmremme

DNR///wwwstitecb. comI

Inta mealsandshareUSS ...........................Scag Lopiechnukeun ushkoda dvc.323UsB .... scag

QtgrjjwwwdlsmoKdmmcomj hitp/jjewwggssa corn/Dgmdouce hitprj/WWW O(ea-brfd,corn

ATI1VTimerISA(for ATI only)/Ams N Sox .... Scali

Networpieg Acer/Surccome /Gencdc Csm. PCINetwork CarQI9 Acer/Surecome /Generic Com.ISANetwork Card$19 Wink1W160Mbps PCINetwork Card.......,......... Na OhnkNctwark lgt...........................,...„...,........ Scall

DNR jwww dayls)t corn/

hltp: jjwwwbp corn/

hnp/jlwwwworldwlds.hc.cd / htDKI/www loOi(pcb.corn/

USBNclwomAdaptor ..................................,. scaN

Dnprjjwwwcseoa,corn/

USBHub......-..„.„...,.„................................... Scab Speaker /aectsnensAOA305/3D.105 QSW...... $185/Seep

DNpijjeew quan)umcomj

4.p etcfpelHub ........,....,...„,.................$45/Scab

Cami¹dyr Sound.........................,.............. Schcck

Gsnsac140W /3Q ...............................,...,., $10$20 GIRSppgaltgmw/Subwoot ..................... $55/$86 Loytech soundmsnememe ....................,......ScaN VamshaM15/ZenannHi006 ..................... $7B$55

of bum

promiseUOMA66 IDEcontroller card ............. scat UDMA66IDECable ........................,....,................ $4 UDVM6610EMob/a Aack...................,....,...... Scab ASUSSMARTCoohnSfan ....„....„,.....,....,.......... Q 586CPU 1stBeaxnDCooli npfan........................Q Headphonew/Mid Mic w/Stand .................... SB$5 AdelnOrfOr SOCket 370mS IO II (CC I«an)(.....trcm) $11 1.44MBFtepf 7 Disk/Zip Nsk.....................,.. $4$13

Pinler CardNA (EPP,EC P)/causa..........,....... $15 stankOMlaokCDmhyncnnubls co sl sacats floppyl.44MB Wr bnr(hnkler) ........................52

Dtt'prjjwwwnsc.corn/ http:jwww psbasoa(c.corn/ 8/fp//jwwmSeggtrs.cpmjprodgc/s/

htrpr/jwww itd,se/ sonycomjprgdgcts 8/tp: jjwewcreacus.cdmI Dnp///www vlpwpoa(c.cgmj

See WEBSITE For current Price Price on AN announced thn 6th Nar. 2000 BttdValid un tO 15th Mar. 2000 onl

~ ~ ug r

Wortrtvxrftte Com

System 2 yearslabour. I yem pans (Extendedwaennty available) Pans: Common Elecuonic items: Some or next businessday: 100% refund/replace: after next businessday

OATX19"Case

(purchasedwrth anysyeem) 320WSpeake Fujrlsu4725 Keyleard Logcech1stMa/res w/wheelW/PNI MicrophoneW/Stand

(purchasedwm eu system)

WorldfechAlbionAy.&DD WorldfechPDI 56DE

$1056 or OCALL 55$EQ„$100

QO(R Q(JL$60

Backup Brioa IOMEG A ZIPOREn Para/USB........................ Scag

ENGLISH

Ema(b ww wBrwortdw(dc.bc.ca Wcbt ht(p:I/wwwwor)dwidc.bc.ca/

%%@

';SortdEUtde C~rrg . puter Corp r.

II II II

%OQ'l&Vid5: ~ r'

II U

• 40

Tgf(BRLEBV(RSBB

"'*

I I I I

c HANOS O N

There are buttons to split dips into two. to quality at rates under GA MB per second, so ble a series of scenes into a movie. VideoWave you can stom 20 minutes of video dips in was also oac of the Rrst applications to usc grab a still kame and to extract the audio kom

Denhttqbvideo prooeaalng eoffwere Continuedrrom page4y

about 500 MB. But rmnember that you' ll need dose to another 500 MB to save the final rcndmed movie. These applications range in price from $80 each captured segment or dip arc displayed to $800. While price is a kctor —you de6nitely according to length. VideoWave pioneerml the get more bells and whistles for $800 — ag of storyline, in whi«h mch scene is represented by these pmducts can produce high-quality one image. Studio DV can display either time- video. Adobe, Ulcad and MGI have thar roots in line or storyhne, at your preference. If you'rc in a hurry to put the pieces together, the storylinc PC graphics applications. Pinnacle's backpanels and palencs open at the same time. There are also two di(Fercnt approaches to the working arcs. Premiere aad Media Studio use a timeline, in which multiple frames from

a clip to usc as voice-over narration. Audio used to be one of VideoWave's shortcomings. It now supports up to six tracks per segment, giving you the opportunity to add narration, musicand a couple ofsound cffectsto a scene.

Intel's MMX mrtensions to enable real-time previews, Other pmgrcms were tedious and dunky,but V ideoWave was fastand fun.

The st oryline approach docs make some aspects— like adding music to scvcralscen«bless intuitive than they are with a timdinestyle interface. VideoWav«compensates with sn exceffeat online manual that indudes both explanation and step-by-step instructions. The

Unexpectedly, and deligbtfuffy, VideoWave has the abiTity to combine two imagesbased on

colour, a feature called chmmakcy or bluescrcen. (An exampk of this cffcct is when the TV weather forecaster stands in kont of a blue wall in the studio. Chromakey is used to replace the blue with the satdlite weather map.) There are also many image filters, both to correct problems, like a colour shift created by Ruorescent lighting, and to add artistic dFects, such as a mosaic. VidcoWave offers a choice of 52 transitions to use between scenes, induding stationary effcctx, like wipes, and 2D motion a(facts, like pushes. When you place a transition, it can be played without having to wait for a preview to be created. However, depeading on the speed of your processor, you may not be able to see the full effect in real time. A preferencesseuing lets you trade-off quality for spcetL

indexingcould bebetter thougl« Supergciagy, aot much haschanged in this ground is in professional video produ«tion.

approach is definitely easier. If you' relooking to 6ne tune, you'R probably Bnd the timebne These aren't the only products out there. and latest release, VideoWave IIL Under the hood, offers the greatest control. W hen you'rc done, you willhave created an edit dc«Ldon list (fDL), a set of instru«tions indicating what happens—and when—in your produ«tion. The final step is to take those instructions and make the movie. This is often referred to as rendering.

the geld is about to get a little morc crowded. The nextconsumer release ofWi ndows 9x— to be caRed Windows Me —will contain a basic video-editing application.

it's faster, more stable, more powerful and bas expanded its feature set kom minimal to interesri ng.This rdmsc supportsag the lateststuff induding DV and MPf G2.

MGI VideoWave NI From;MGI

hurry. With the Viewscreen and its contcxtsensit iveconsoles.ag ofthe toolsand information you need are in one place. The various consoles indude a variety of preset cffects. For example. the text console indudes effects that change the look and paths that move the text

hRP:Ilaaw.iiiglsog.«Oili tybnimumsystem

Some tips

Although these programs may be essential for feoucefnenta266 video producuon, owning the software docs ben PenbumI

I I

VideoWave is designed for producers in a

notmake you a producer— any morc than a

processor.64MB

on the screen. This makesa complex task, like

pen shows you how to write stories. Several of

RAM.

creating a credit roll for the end of the movie,

When MGI intro-

VidcoWave's templates give you a guide to the sequences you might use to tell a spediic kind of story, like a wedding or a graduation. Video gobbles hard drive space for breakfast,lunch, dinner and a few snacks for good measure.A second of raw video footage contains kom 21 to 30 M B of information. Comprcmion applied as the footage is being digitized means that you can get VHS-like

VideoWave's simplicity means you can't

as simple astyping in the text and clicking on

these programs include templates and other Estimatedslreet guides to help you understand the pro«ess. price:$80. duced

VideoWave three years ago, it was a breath of fresh air. It created a new style of user interf ace,one that has since been copied by other programs. The innovative storyline approach made it simpler and faster to assem-

always get exactly what you want. It's not that the fmturc list is short, there just aren't enough unwaated footage born the stan and end of controls to let you Rne-tune ag of the setcaptured scenes. With VidcoWave, that trim- tings —like the grid of nine squares you use to ming can be "kame accurate." This means you place text. You may be able to solve some oFthese misscan move forward and badcward one frame (or image) at a time. Although there are only 30 ing capabilities with a little ingenuity. For frmnes in a second. VideoWave displays time in example, with the storyline approach it may thousandthsofs second. Itcan rcssvc th«scene seem impossible to put smoothly scrolling after trimming, to savesome disk space. Continued on page 60 two buttons, Thc Cuning Room module is used to trim

•

• • •

•

3400

12.1 88PA orActiveDisploy s$33 MHB Intel Celeron

5g OQ

4M 1 Video SGRAM 32 MS SDFFARR

W elghg4.2lbg / 2.8ke

$gO3/

14.1 XOAorTFT Dleplap

3g QQ

8500

444 NHB Intel Celeren S MS Vfdeo SGRAM 32 MI PC 100 SFSRARR

•

8 •

•

$gO3/

. • • •

•

2,999month

month

•

• •

•

' • • •

•

RB APRL2«OO tHE SOMPUT FRt PAPEFt IC EDIIION ww w ~

•

cs.corn

•

• •

•

• •

15.1 X GA TFT $8lglblcbly 466 6688*8rbIml C.fmyem 32 MS FbC-100 SRIRAM W eigflbg 9.5lbg / 4.3kg

'2g99 •

month

e Me Video SGNAM

W elghg4.4lbn / 3ka

$$ Oo/

13.3 X OA TFT $818$b lcby 400 RRNB Intel PentlmsbbII 4 MS Vlcfeo SGRAM 32 MB PC-100 SDRARR Sdk VGO Internal modem W eighg 5lbg / 2.3F«N

'2 t 999

SI.~ ~ ' QL99 86S/

•

g g C r©

o II

Fax: (oa4irsg-4ooa www.vancocomputers.corn uancoLBvancocomputws.corn

C 0 M P U T E R S

I i I

I II I

ASUSKTM orGigsbyteNX ATX M/8 128MBSO4AM PC-1% 15GBUltra DMAHard Drive IA1 NappyDrive 32MB RiveTNT2 SoundBlsstsr Uvevslue Digital 450wSpeakers+ Subwoofer 40XSONY CDROM Ori ive %K V.90Fex/Voice Modem WindowsKeyboard a Mouse ~ ATX 300WTower Case MS WindowsWL?rrsEdidon

cxI~I 'laa4 West Broadway. Vanoouvar, BC Vad 1VO

" I

'''

ii ' ll '

it ' ii

I/'

'll

AsusP5AATXSuperi M/8 QMB SO-RAMPC-IN 15GBUltra OMAHard Drive IA4 nappyDrive ATI XPERT200032M SoundBisstsr 120PCI 450WSpeaker v Subwoofer 40XSONY COROM Drive %K V.90V/F/Modem

AsusP3C2000/ P38-F 120MBSD-RAM(PC.133for 0 CPU) 15GBHard Oiive ATA% 'IA4 RoppyDrive 32MB RiveTNT? SoundBluster 128 PCI 450wSpeakers t Subwoofer 48XSONY CDROM Drive %KV.%V/F/Modem WindowsKeyboarda PS/2Mouse ATX 250WTower Case MS Windows98, ?rvrEdmon

ATX2SO WTower Case WindowsKeyboard a P$2 Mouse MS Windows98, ?nrEdition

•

'll

' ll

®m~Q lz@~wr®'.C'.

T ue- F ri : l t t o l

Gate Bun: 11 toS Mon closed 0

Tel: (604)732-5691

• '

BX Pn-HIAll in OneM/8 32M 8SD-RAM PC-IN 6AGBUltra OMAH.O. 0MB AGPVideo 44X CO-ROM 1.44 RoppyDrive 3D SoundPro+ 140WSpeakers 56K V.90 Fsx/Voice Modem PCI FastNetworkAdapter WindowsKeyboard BMouse ATX 250WTower Case MS Wmdows98,?nsEdnion

•

'v'

iii i il

III III

I ll '

irr I

iii

56KVSSFax/Modem ....... . . ..$25 3D SaandCard ....... . . . , . . . ..$15 17 ATX Tower w/250WCASE ..$39 ATA65Ultra Controller Card.....$47 • SXSONYCOROM Drive .......$05 10BT/IS-1M PCINetworkCard SIS/IS 5 PORTSHUB 10BT .......,....,SM

Matrox 64M32M Dual Head,. S279 HPSEISISCSiCDRW ..... . . .$879 Creative Anaihiiater Pro32M . $305 Acer 4XGX32XCDRW ........ 3265 3DFX Veodoos3IW TvoutHletailaoxl $105 IBM 206B 7200RPM ..... . . . . $259 Ricoh6X4X24XGX !OVD+CORWI $399 133MHX Pl(I MB w/sound ..., SISS Creati ve SX4X32X CDRW IDE ..5309 Intel NG PH-P(Hw/Video SrSound S140 HP 0250iCDRW4XGX24X ..... $279 Prcview19 $6 .... . . . . . . . . . 3425 IsenasenicSX4X32XCDRW ... 5300 37 $0 SVBA Monitor ........ 4279,

CPU • IIAM

CaRfor Today's tlpdste Prices

•

•• 2

•

AMDKWI3N45050WSN ....... $688WW39 • Prices ee sash/ (shee dismmmad K6 Hl40W450 ....... . . . . . . . . . . . . .. $119/219 • We will try tomahb ar beat any Kl 5W55WNN650 ....... ... 2$9/?98315/399 soups%arkpri so'. Justash hrit Kl TWTSNEN...... . . . . . . . . . .. $11 W5%/899 • Ask lar newReamwMI BestPrice Intel PH400/P-233MMX ....... . . . ... $1 BW65 Intel PHI450/500E/55W6NE....8 / 4 5/30W429 • We huyortel e inyoaroldsys or pans • Phoae on(sr andshippiag avaihbls for Intel PRIG133MHt 53WNW667 ... $3N439I589 oouide lower Maiahnd Celeron4W 43xttangy533 .$10WI I W129/149/2N I BM Mn3%(3X0%NHN ......... $4WSWSW79 SPinSIMMILN4M ..... . . . . . . . . . . . . .$?/15 72Pin4/WINS?/QM ..... . . .. $1?/28/4WNI39 MOTIBRB OAHD PC INMht 3?/Q/128/2%M ..... $5489/ISW345 5(%%2jdl@(lrhgsnh PC133Mnt Q/128/256M .......,. $EV179/379 Gen.VIAASPINMIOAT .....................$% 27$VE • FLOPPY + XSP• GigsbytsGAWO/GASAA ................. $169/1% QuantumLM(7206) 102/IWW30 3?0W?N?69/389 MSI MS5169Ali M1543512KINMHz ........... $117 Ousntumig/0 V102/13600 SISWISWI69/179/215 AcpenAX5SPro AlX UWSI?kCache ....... $11485 Fujitsu(ATA66(6A/8.1/10.W13 . $1%I149/15W173 AcpenMX59Prow/Sound6 Video ............. $136 Fujitsu(ATA66)17.WW27 ........ $1st/? IW?79 AsusP5AAT/ATX/ Sound ............. $118/123/131 Fujitsu72EIRPM10/13//0/27 .. $185/?05/24WSI5 MicrostarSINAIX/SIQATIMAud ........$10W119 TysnS15W ION,........... „........... SI?WI45 IBM 7200RPM20....... . . . . . . . . . . . . . .. $259 ~( I S ~ i h ynh WD154Ni 0.7/INIW17/20 ..SISWINI 5/26W239 WO(7?N)INIS/?N?7........ $107/239/28W379 AsusKIM ..................................$?09 Maxtor Max8.7/10/15/17.2 ... $1%/165/185/199 MSI61WGigsbyteNX.................... $189I19? MsxmrMax 20/27.2/%..... . . ... $224/285/373 P Msxtor7260MsxplusINIS/?N?7 $185/195/(SN320 Bits P6SEfAIIinOns/P6BAT133W/Sound ... $115/1% CoolerFanforHarddrive35 /5.25 .......$15 ABITBBV8% 0/BWZM6/ VA6 .$1WIWteV12%131 RemovableHard Drive Rackwith Fan ..... $21 ImpressienOceanic Slot I 6 S370AlX il4NX.... $122 IA4 Roppy88 Bri/Bah ls/25/Npk $1NNINI8 6igabytsBX?6W6VXErATAB ............. $1%/129 LS120M82XRoppycmis/Oi skeue ......$8WI• AsusP38F/ P3VIXVPP3029W P3W.ESt%I?W?tgn% ?ip INM Diskeue ....... . . . . . . . . . . . . . .. $14 MSI6i53YAVIAAppub Pro133................. $1% Zip OrivelggM1st/EmP/NU ... $85/13WIi w185 AcpenAXN MXQProYIA 133MHt UOMA%. SIWIIS Zip Drive250M Int/Ext P/S/U...$1 53/I/247/245 Niouuyona M anyBrands 56K V90Voice Modem .... $258 up VOICEPCI 2976/2974/ISAlwinl .. %5/6W45 lmpressionPlus15/17 $7/19 .26 ..SIW26lir485 USR% DiamondSST RockwellPCI56K V90Voice ....$38 Panasonic 15 /17".27/19 S190....SBW3W6% Ace rPCI V90SMIPM/ISA ........ . . . . .$38/49/67 Res(IS /17 $7/17 $6 ..... ... $1%(Big/3% Acer%KExtemalUSB/P ...... . . . . . . . . ..$75/95 Samsung550S/750S $7/ 19 ..... $1 5/95/529 P INEUSB56KV90 EXT....... . . . . . . . . . ... $% SamsungTNNF/9%NF ...... . . . . . .. $150%59 PINE56KR ockwell/ESS.................SW28 LG775FT.24/910CS.26 ....... . . . . .. $37WS?5 Motoroga56kV% PCI ....... . . . . . . . . . . . .. $27 MAGIS $5/17 770725 .... . . . . . . .$??WSS Hsnsol15/17 $8(25(tg 26 $1N3WNS/479 Proview 15 /17 .27/2W 19 .25 SIW2%I2N425 Acer ISA/PCI INPCI IN Mbps ....... $18/19/24 OptiquestOll/073/075/GSS . $(SWSIW389/179 10 Base-THub5/N16Port ...... . . . ... SN48/95 Viewsenic 17 El/I/77W6790 ....%157%9/515 10/1008PSHub8/16/24 ....... . . . .. $1N36W449 Mbps ....... . . . . . . . . . . . . , . . . .. $20 Viewsoni c 19 PS790/GS790 ........$5W 629 PCI 10/100 PCMCIA Ethe rnetCard .............%9 AcerViiew15/17 $7/26/19 $?0W?4W4?WSS SOHO Acer9/16Ponnub ..... . . . . . . . . . . . . . .$62/145 SONY GS15 /17 216/19 G100 .$?W45/IBP Intel/?Com%5 BTX/0-link 10-100MBps $67/77/20 AOC 15 / ll .26/19 26 .... . . ... $175(??W4 69 Cables,Adsptors. Accessories,Switches. Tools KlX VS55W le/195e .............$1SW?TW459 Pleaseco/IforAnvsstpri cns TTX 15 / 'll .2W IF25..... . . . . . SISSISN455 •

•

;

l l '

Ce/eroff 400A /P// 400/Pl/i 550 ATX 250W TowerCase,3?M PCI06 0/H Video, 30 Sound,56KYN Modem wvoice 8 IGilNMbs

( ,u/~f~,g.w./ P 5 9 /4$9/N9

VIDEO • CAPrtma CARD PineSISPCIttWEWMatrox6XN 8MPCI .. $3WS?/S

$3 Tiio3DBl PC(/Dia m ond Veer 3%4MASP .$5Q9 AOpenASP4W8%/TNT?3?M .......... $%/SNI MatroxGHNMia A6P3?SWDWMAX ..... $1W?4W?% All Xpert 98/99AGPSM ..................... $6WN ATI Xpert 128165VXpsrn0% 32M .......... $122/132 ATIRageFury32M/Rage fury Pro64M.... $175l3% ATI AginWonder 128AGP8/16/32M .... $149/2?gl315 ATI TvWonder0 CaptureCard ................. $99 Voodoogl 2NANM/35% N 6 Rd Tuner $12WISW289 Creative6eForce2%Anrihilsmr32DDR ........ $55 Sniper2Rive TNT2M613?M/N Out ....... $13WI49 AsusYSEWYNN(ultra Oakasl ........... $?TWSB Asus6eforcs 2%DDR32MB................ $319 AsusTVBox .................................%7 EisaWinnerU32M w/30.8ev ................. $139 CARD ' SPEAKERS e

3D PCI/yarnahs3D Fug-Duplex ....... ... $1%25 Acer AOpenAW3W AWE% ...... . . . ... $36/?S Aureal Vortex I/2/Superqusd ........ $3W47//3 SoundBlastsr Ensonic/ PCI 128,...... ... $3W45 SoundBlaster Uve PtatnendValue Digital .$255/69 Creative PCworks 4 Poinu/2 Points .... $119/65 Altech Lansing452/ACS 32/48 ...... $8W65/155 YamshaMWM30/MSWI0/Surround..%5/7//SW149 Silver Rat PanelSubwoofer ...,... . . . . . . .. $52 Juster 3014V 2ay 450Ww/ Woofer.....$1 WINS GNT 5NW70N 14NH ....... . . . . . . . ..$5WSW99 Mid Headphonewith Mic ....... . . . . . . .. $9/I3

Qwc.a ~

•

fdi bardsstcsun, sestet nssnwkiss uwtv. Iuawr 6 ecsssurymuwwt prices 17 /'19 /24 A1XNewcssigns ...... . $N44/69 CPUFan3P/ PS/P n/ CaseFan ..... $1W12/11/10 Inwin CaseA560/ ASN SSN/ 0500N$79rf?IT?/125 KeyboardWin/ Many brands ....... ...$12 a up MicroSoft Natural Bit/ Internet w/sys.... $?(P/25 USB • Port Hub/Card ....... . . . . . . . . . .. $5S/39 logich Home/Express/ EZCAM Camera $9W6985 Mouse 2/3 ButtonDesigner ...... . . . . . . .. $7/0 MousePad/Msnykindsacolor s.......$?aup Logitech28/38+ Wheel/USB ......... $N18/22 logitech cordlessdesktop/ Pro..........$11W159 Microsoft Inteli Box/OEM / Explorer....$45/27/95 Internet Mousemlh Scroler Serial/PS2 ..... $14 Joysdck/Gamepad ...................$9O up Printer Cable/ IEEEHigh speed anys'ue $8-tt aup IOF/ ATA56/SCSICable ...... . . . . . . . . .3?.Wl fir Tekram3W F/ U28/ U2W ....... $NI W21S/275

coy%tat% cua' 3?X/447U50X ..... . . . . . . . . . . . . . . . $53/56/59

Acer 4N/4%0gxcx?4 ............ %2%6/?S

CreativeSBOCDRWBX4XB. ... $?NSS Toehiba tat IOE/ SCSI/ SONYNX.....%7/13WSS LG 4X4X?4 CDRW Int...................$289 Ricah6X4X24X4 (OVO+CORW( Int...... . . .NS SONY/PLEXTORQS CBBW ......... $30%3S HP 9210iSCSI/gllgi/02%i ........ $379/$75/2(9 Yamaha8424 Int SCSI/(OF/4416 ..~ BlankCDR:Basf/Sony/ Princo(10 pcsl SIN2?(17 BlankCDR:Kodak/TOK/Memorexllgl $?3/21/Ig Rewritablel4/80 minutesBlankCcs ...... $43 Make COWriter lnt to Ext Kit IDF/SCSI ..$99/89 AOpenDVDWriter w/SCSI Card ....... . ..$879 SX LG/Assn ........ . . . . . . . . . . . . . .. $1Nllg GX/10X Pionew ...... . , . . . . . . . . . .. $24WIS SX/10XAepen ...... . . . . . . . . . . . . .. $14SN79 'Saveupto nnkoa pri me rIak/Toaercsnridgss Conan 8/C 10N 2000SE ....... . ... $EP/I?(P Canon LIC 510W6(NLssert?60 $215/NW1739 Epson44I/66W740N.TN .. $145'/185 /22S (-75( Epson950/900USB/12% ........4356/Sggmg HP610/71N010/030...... ... $14W235/219/299 HP 880/895/970 .................$379/527/557 HP 725CMultifvnction ...... . . . . . . . . . . . . .9549

HP laser 110W21% ....... . . . . . . . .. $555/950 BrotherMFC7050/7150/4350...... $45WSN/585 Brother laser lsuy 10W 1240.... $436/3N4% Brother HLISNE/20N N ..... $117W149$1799 Fujitsu10V/ 16DV/20w....... . . .%99/83WM29 Leanark Zl I/?31/251/3?N $149'/2%'/325'/I 8(P Acer 320P/320U....... . . . . . . . . . . . .. $EVI 15 Acer 620P/620S/620 USB ....... $135/14W149 HP 330W520W63W 6250 .... $XD/345/515/579 CanonScan330P/SNP/ 0 $125 /175'/NN'(-30) Epson6W 6%U/12NU ..... "" $?DW265/329 6P/12PVigorBXu12% Scanner ........ $N99 Umax2000P/ USB/2400S2 ........ $13W197/419 Mustek t?NCU/600USB/9636LS ... $115/99r135 EpsonDig,Camera PC 7 02/308%% $78WXXP/402 CanonPawsrebut AN SIN Pro70 . $715/07WI139 canonDigital priinter co2w%0 .......$35%815

sony%ARE Many Software /Guaesreed tuwusrPr/cgsl Games onsale...... . . . . . . . . . . .. $12.99 & up

Adaptec 29W2930(2940U/U2W. $/Wt 27/26WS I9 PCAnywherv90xostanemote ....... .$129 OfgceProOEM'97/200WSBE $ 14W479/(%

e HANDS O N w

Dssktop vidso Processing software Continuedfrom page38

you're creating an opening sequence,a musi c video or a comm«rcial that consists of multiple layers and

dosing credits over a series of stifi &ames or funny outtakes. But if you render that scene first, and then put thc credits over the new combined scene, the problan is solved. That kind of creativity will come in handy with any of thae programs, «spcuafiy if you' re trying to emulate what you'vc seen on TV.

images.Anytrack'sdisplaycan becofi aps«4 hidden or locked~ p abfiities that will be familiar to Photoshop users. You can also have up to 99 audio tracks.

Thc ncwm onitor window consolidates ajumble of different playback windows from previous rcleascsto make trimming dips and adjusting edit points simpler.

VidcoWave imports AVI, QuickTime, MPEG and This is much more like the two monitors you might DV vid«o formats. If you have an IEEE 1394 DV transfercard,you can use VideoWave's DV features to contml your camcorder while you copy original footage to your comput«r.

have in an edit suite for your playback and record machines. The ability to "scrub." or see and hear thc dip while moving the cursor back and forth, adds greedy to the case with which you can locate audio and video edit points.

Finafiy you can copy it back to the DV camcorder, again at fufi DV quality. To watch this process work is nothing short of amazing. This is a "wow" in big capital letters with multiple exclamation marks. Studio DV's working area can be displayed and modified either as a timeline, storyline, or text list. Tbe preview scenes display as srnafi thumbnail images in a scrapbook. Th«scscenes are automatically selected during transfer, a very useful feature. The selection is based either on when you started and stopped the camcorder, or when the image changes— for example,when you zoomcd infor a dose-up, or panned from thc ice to the crowd at a hockey Conriwued on page 72 gamic.

tw uv

c v n

There are moreeffeus than youcould or should use

Adobe Premiere 5.1 From:Adobe

in the next lo years. You can vary the playback rate of a dip to speed it up or slow it down. You can change the Oso://www .as«os.com I P ra size of any dip and its position on screen. You can move Mmimo msystem it, distort it, and use any of more than 30 dilferent cormoult«locals:Pcfltilml rective and artistic filters, singly or in combination to txoc«ssx 32 MBAAM create more efi'acts than you can imagine. There are fmimai«0socsimks even fiiters for audio, like hum filters and compres3000. sor/cxpanders. Premiere's vid«o transition list indudes Adobe Premiere is 3D motions like cube spins and page peda, in addition as closc as you can to the standard stationary and 2D motions. If you can't get to a professional find what you want, you can probably create it using product on your the Transition Factory feature. d esktop. I n th i s I suspect Adobe has never done any usability testing release, it's stabl» enough that you can complete many projects without on this product. The text editor is particularly bnvilmiperiencing a crasiz The new auto-save capability dering. Although this release has simplified the ability means youql only have losta few minutes work when a to create a credit rog, you must still navigate some crash does happen. You can now undo thc last 32 treacherous waters to create even the simplest onactions, or use the Save A Copy command to set a scrccn tcxL let me explain: First, from the File menu, you select checkpoint to return to when your creative instincts go New. and then Title. This opens up a new window that ofi'on an unproductive tangent. In professional terms, Premiere is an olE-line, non- looks a bit like a paint program, but the conunands and linear editor. Olf-line means the movie you' re a«sting tools are afi a little dilferent. When you've placed the is not tbe foal one. The Snal movie is created in an on- text you want, you save the title, using the Premiere line suite, where the original tapes are played back and menu. Although you might expect it to appear in the "conformed," or copied to a new master according to project window, it has to be imponed and then placed the off-line EDL Non-linear means you don't have to on thc timeline. Finally. you set the transparency assemblescenesin order,thewayyoumust when you'r» options, so it is supcrimposal over the scene.

•v

o sgcJ

novae M •

a oa.po ow.n.

=iAdfibePremiereSO

•

iTV I sJiTV ITV ITlT

AdobePremier«'s swee«amtaias a SmcliacIor anaogiagclips, aada monitor for playias CCSpl«It«wing yourwork. Ov E«I Ivwv Ov «IN«w Im

Studio DV 1.0 by sendcring the movie. If you are, you' ll tak« the From:P1mactcSyst«im Praniae KDl to an on-line suite to a«ate your foal SttpJhwnv.pilmactccm.can Mioimomo/mcmreqoiremmls: Wmdmm98. 233 MfizPcnfum, bmadcast-quality tape. Premiere is not easy to use.The learning curveis 32 MBIMM, POslot, a bwddsrc capablaol a sostsia«0 4 steep. Thae is a bewfidcring and idiosyncrafic set of MB/ssctraosler rats. menu commands, on-screen tools, dialogue box Estimatesstreet price:5270. options and keyboard shortcuts that must bc learned Studio DV is bundled with an IEEE 1394 transfer card. before you can appredate the fidl powa of this pm- This PCI card allows you to attach your DV camcorder granz At the same time, you must learn thc som«times viaia FircWirc or iiink pon. Once connected you can obscurejargon of Slm and video afiting, aswdl as spc- control the camcorder and import your footage.

Studio DV uses that functionality to dramatically

raise the video pmcasor capability bar. Once you' ve worked with this program, nothing else measura up. The user interface is slick, and the functionality makes editing video so much easier that other programs seem and«at and tedious. Unfortunately, unless you have a Luckily, with the right bighead video hardware (and DV camera. you won't bc able to use this pmgram sucterabytes of disk space), you could create your Snal cessfufiy. Let's start with video capture: You put your DV ouubroadcast quality output using Premi«re. corder into VCR mode and click Studio DV's Start Although only a small number of high-end video Capture button. Then you take Sheba for her evening capture cards are explicitly supported, you can pmbawalk When you return an hour later,afiofyour scenes bly import the Slee you've captured usiog an unsupare neatly organized and stored in a preview file that ported card's native capture program. Praniere works with AVI and QuickTime formats. Until recently, the takes up about ISO MB of disk space. (Incidentafiy, an Windows version didn't support DV, although the Mac hour of full quality DV would require about l3 GB of versiondocs. However, this appears to have changal hard drive space.) With any other program, you must carefully select since the latest version of Pinnade System's mimVideo DV200 For Windows indudes a copy of Premiere S.l. the segments you want to copy and monitor the scenes Premiere alsosupports awide variety of image formats, you do and don't need, while Sheba paces at the front door with her leash. induding lfiustrator and Photoshop. In Studio DV. you work with the preview film to creThemul track timdine appwmch imposes no tipleate your foal production. When your ED1 is complete, limitations on your work A project has two standard you auach your DV camcorder again.and itcopiesonly video tracks with a transition track and a superimpose track for tides. A project can contain up to 99 tracks. the sc«nes that arc used in the Snal video to your hard

drive at full DV quality. Then it conformstheproducoverkill, it's a feature you will put to good use when tion, as you would in a professional on-line suite.

Although that number of video tracksmay seem like

•

a a •

copying kom the original tapes to the master. If you're not a pmfcssionaLyou'll Knish the pmjcct in premiae

cific proccdurcs that Premiere expects you to fofiow for certain tasks. Once you have mastered the program, you' ll find that there's very lisle you can't do. In fact, most professional on-linc edit suites don't have anywhere n«ar the capability to manipulate video that Premiere does.

• • DEMIv I M •

•

ra •

•

OW N S I n k s

It 1 0

s . •

•

I•

premier«'atext editorma«ala nemb to baomar ictcomtcd, aacsimpler to uss «w Sw y e ~

tga> 0> O ~ Qc

Tool»

I:W : i i . alt

0NNN liow

PowrOn» lnellh

Cot

O c

m~vc

gtodmgtps music compos«I letsyouscud musicstyles, aadcreate ssaoaslrackthat b czaogytheright la«gibfor yoormain

+ ATOF' Computer+,.

kth l e -

j'c%"-L Plnanctn 8 Leaaln P $.

S BNW

m+R'"'"-'e 7th,

1'I

>vox

r a m Available

•

Surre Location:¹10083 136A ST. E. Whalle Rin Rd. Surre BC Tel: 930-4838 Fax:930-4848 Lan ie Location:¹20188Fraser . La n le BC Tel: 514-9130 Fax:514-9133

D l

AhD K0.$450Mhx w /3D Ncw CPU Ggsbyte GA-SAX MS w/ATA66

64MFC.tooSztau 4.3G tlkWh66 Hwd Give 44X DE COROMDrive

att Xmm908MVMm Cwd Xw ave 3000 FKI 128 Sound Card EBS V.90 56K FsxNofce Mcdem

tuele r-140W hhibxndisSpeaker A4 38 Mmse w/Rxl

AMO ttthlon w/DVD

Pent(um I(I 133Mhz thk/DVD

Asus K/M Athkm ATX MS w/Audio 128MPC 100 SDRAM

htel 4408X PSFSATX MB 64MFC.t 00 SCRAM

Asus FitctX ATX MS wIAGFK4 128M PC 133SCRAM

Rmason'c 1.44MRoppy 13G tÃaka66 fknd drive

Ruunonic I A4M nappy 0.4G tzaha66 Hard drive Oeaove52XCDROMOive Rva 1NI2Vakm 16M Video Card

Rmasonh 1A4M nappy GNe 20G 7200teru tkzrta66 Hard drive

10X DVO fhOM Ohe 10X DVD ROMDrive Rva 1N12 Vakm 32M Video Gud Asus Gsfores256 Deluxe 32M Audio on Bowd Aureal 0030 320Voice FCI Sound CardAuresl 320 Voce PG tkglal A Oeakve V.go 56K FnrNoes Modem ESS V.9056K FsxNohe Modem Oeaihre V.go56K Fax/Voice hhdem 19' ATX Case w/300W power 17 ATX Case w/250W power fS'ATXCssew/250W power tahdcwsS0 htemst Keyboard whdows98 KeyboardPS2 Window s98 htemel Keyboard LogitschWheel Nkxne w/Psd A4 4D Wheel Mousew/Rxl lngitech w heel Mouse w IRxl

htei Gkeron 433Mhx w/128 L2 Grche Acus RmtiumCelsron MS w/ATA66

64M FD.too SCRAM 4.3G tÃNA66 Hwd Crive 44X DE CGhOM Wire

Ss620 SMAGPVideo onBoard Xw ave 3000 Kl 120 SoundCard ISS V.90 55K FsxNofce Modem Juster-140W Mrklrndh Speaker A4 38 Mouse w/Phd

Window s98 Keyboard P52

GNI500M Speakw w/Subwoofer Juster XPX1 SpeakerwISubwsofar Alee ACS54WSpeaker w/Sub (ofb) Wndows98 Keyboard F%2 17 ATXGnew/250W ewersunnfy AOC11 TQr 26dpi Monlor (3yrs wty)aocfr 7Gr 26dpi Nbnkor (3yrs w ty AOC 10 9Qrs26dpi Mcnkor(3yrs wty 17 ATXGmew/250W'erver Supply Rrst Nbnth Free htemst CD Rrst NbnthFree internetCO Rrst Nhnth Free mtemet CD tuhlon 800Mhz...............$1710Celeron433/466...... 1189/1210 Pla SBBMhz...................$238$

Athlon SSOMhz...............$1760Celeron500/533..... $123$/129$Pl(i 533/550Mhz......$2420/243 /uhlan 800/650Mhz..$178$/18 PIIISSB/850.............$1400/161 Pill 000/SSBMhz......$249$/256 ttthlon 700/750Mhz..$1069/20 Pal600/050.............$1679/163 P( a087/7 00M hz......$2899/27 Wonitor Extra Athlon 000/850Mhz..$2300/2 PSI700/750.............$1 039/1989 Pla733/750Mhz.....$2869/

MS Window 98 2nd EdWon CD 8 ManuaI add 139 ... Window 2000 CD 8 Manual Add 209 w/8 tame On

Monitor Extra

easeca usorvtslt our we site www.ato . c.ca or currentpnces • • •

CPU a RAN

~or~sr

Call For latest prhss Asus ATX PSA/AT...............$129/12 EP~Pentlu Etk(ESS Aspen AX59 ATX......................$11 233hatKICekrran 4KI/433...$7$11$11 Epox Nh/PSAT/ATX .............$12$1 Ceieron 466/500/533......$149/169/229 Epox MVR}-G2 w/ATA66............$14 ~ 55$ 60 0....$389I449I44 Gigsbyte GA-5A AT/A1X......$11$11 65$T0$750/600......$559/699/099/1 Houstonal-h-one AT/usb.....$110/120 Socket 370 Adapter......................$2

Video 858$(SSLRlhS

Fuyisu 4.3/6.4/0.4G.........$1 35/149/1 Xpert@Work/Ray 8M AGP........$89/89 17 Viewpoint 28dpL..................$309 10$1 $17/20G.......S(7$18$219/24 Xpert9$998MAGP................. 1T opr/GT56......................$37 Msxtor 1$2$27/36G.$1 9$23$29$34 Xpert1 28 16IW2000 32M.......$1 29/149 10 G6$21' 6G....,.............$64$1 1 Quantum LCT 13G.....................$1 95Al.h-w ondw 0M128 1Q/l....$1 OE W.D. 6.4/8A.........................$159/16 AM.wonderfto12032hl..........$3 1 5' 5E 28dpt 1024X760..............$1 99 W.D. 10.2/1 3G.............,.......$1 85/1 Rage Fury 32IWPro..............$109/229 1T TQr .26dpi 1600X1200..........$290 ESIIIIBBL(lg~lttE(a EELBEEhw/Egtt W.D. 2OG30G......................$255/32 ATI Rage Msxx 64M................... 10' 9Grs .26dpi 1600X1200.........$469 Asus F299/FSB-F.. ..............$149/185 Ko-6400/45$500 w/Fsn......$79/0W109 ~266r SJ}rhe Qggtead SR Asus PSG2000 820 w/1 33Mrx...$229 K6-I 533/550 w/Fan..............$1 39/1 Fu)tsu 1$13GI20G..........$205/22$31 Viper IZ200 32MS3 Savage2000.$259 15' AS50 28dpi 1280X1024.........$25 Asus PSC133/4X..............S12$169 th o I Quantum KX13/2$2TG... Savage< 6540 toM32M ........$9$145 1 TASTNFETONFET50...$379/449/559 Abit BRi/BES $...................$17$26 KT 50$550/60$650..$27$31$339/379 W.D. 1 5I20/27G.............229/28$345 Mtgfttz tir AS90 .26dpi 1600X1 200........$589 Aopsn AX68XC........................$149 70$750/800/850.....$449/509/869/1 Nhxtor 1N13/20/27G..$189/205n7$33 3 2M Dual Rsg/Mm...... $245/2 2 2 'FE1250 25dpL...........,.......$1399 Gigabyte BXOBX2000..........$1 39/159 ANon Fan/Dual fan..................$1 5/3 G400 sngh 16M32NL..........$159/205 Q 000ttglg Ggsbyie VXE+ w/ATA66............$129 RAM G4OO.TV 16MAGP....................$399 1T ETN/SLTNR.70,......$329/409/499 Mcrosiar 6163 Ro AlX.............$165 32/64MPC.100 SCRAM.............$59/I QT 9.1/1 8/36G..............$429/739/1 35 ~ r 1fr SL90 .25dpi 1600X1 200.........$649 Gigsbyte GAWCKC 820...........,..$219 128/256MPC-too .................$14 Fujtsu 9.1/1 8G...................$549/839 Rh/A120ZX 8M AGP....................$59 21 Pl 10 .25dpi........................$1219 HoustonsbkvoneAT/usb......$12$1 6 4/128MFC-133.....................$99/1 W.D.9.1/'ioG........................$499/74 vaha/lw2 aktra 32hl....$1 55I 100/249 sfLtt • / • • aggkttLElkjtI B ggtu~ l g Annhhdor GsForce 32MPro..$359/41 1T 520NG200....................$549/619 Abl w WBNB/2/%........$189/169/1 Panasonic1.44MRoppy...............$22 80/x 19' 8100IG40$Ftm......$819/069/1 Abit FSB Dual Ceisroi ATX..........$215 Asus 4$MX...........................$6$/ PsnasorucLsf 20 hl...................loa Voodool 1000 12Madd on Card...$1 Acus BX/ZX ATX................$1 59/185 Creative 52X ............................... IONEGA 100M Zip ht/ext.........$9$155 Voodooa200$3000 aG .....$14$199 1T 700nf/1 9 900nf...........$499//79 As us NES VM w/8M VGA...........$125 44X/40X CDROM DE............ „..$57/5 100MZ tysk/120MLSOhfc.....$15/1 Voodooa 3500-lV 16MAGP.......$37 atblttkabtukM(a IEEtKM 1T QTf/QTWQ75...........$32$33$429 Ialgz Asus KTMATXw/Audio............. Cr e alve 8X OVDldL.................... ht a ft Asus VSOWOStuxe 32M......$239/269 19' Q95/21'Q1 15................$539/1 0 Asus KTMA1X .........................$21 Acer 10X DV(y40X QXI ... . .....$17Logiisch 2lyw heehnuse............$9/1 Asus GeForce 32MMux......$33 ~ w n GA-7IXATX ................$199Roneer toXDVty4OX(XROIL......S/7 Ms inteamwseFS2/USB.......,....$2$ Asus Gepcrce 32M ODfk.............$369 1T ETTt/E/73/fP775,.....$329/389/489 Modems d Sound Sgnn PCI Dscorh Board..............$1 S3 Trio3Dnx 4lW8M AGP.........$42/59 1 Aspen V.90 56k wh RX,............. Q(t)EIEgr. Logihch Cordhss 1 touch KSM....Sf 29TN12ne4/16IW32IWTvouL$99/t35/1 21 G010/F01 0/RI1 5..$1 129/1239/1 290 Oeative V.90 56k w h PCI ............$49 Acsr 6432 6x/4x/24x...................$329w n98/htemet Keyboard..........$1 5/35 Networh 8 SCSI EBS V 90 55k w h PQ..................$29 Creabve CORhkN32....................$389 MWhhtruaf Sie inyboard....,.....$45/25 he ~et Car ~ g b tft CanonBtc 1000/2000SE......$1 19/1 49 ~ GVC V.go56kwin PCL................$49 HP0210e Ertemsl USB cdwriter... $3 Egke. 3CQM 3C9051X 10/1 00 PCL...........$79 Canon BJC 5100/6100...........$229/3 l/SRV.90 56k FKhwh..................$6 HP 0200/91 10i cdw rler........... 17ng ATXC ewnIO .......$5$5Ohtsi Etherexp Pro 10/1 00 PCL........$79 Epson 44$66$760.........$1 59/189/339 USR V.90 56k PCI Hsrdware........$110 HP 921$32x/4x/Bx SCS cdw iker ..$41 17 /19 ATX Casew/300w .......$7$85 D.thk 530TX+ 1$100 PG.............$29 HP610/81$880G..., .......$149/239/38 Sound Runonh 32X/4Wox DEcdwrler..$319 Rtto Cst5 Cabh (1' to 157...........,$1 Lexnnik Z11/Z31/Z51 ....Sf 49I24 Aureai 082$8030/thgksl......$3$53I75 Yarrnha 8424 DBSCSI Bare...$4'19/4 Juster 14OW/320Wspeaksr.......$14/31 R/45 Cae Cable (16' to 2$)..........$15 Lexnnrk 5770 photo...................$379 Auresi SQ1 00/SQ25N.......$105/145 Y snobs 0424VK DBSCSL.....$449/469 Aitec ACS54 w/Sub ops..............$1 RI45 Ca5 Cable (51'to 1$7).........$35 Qgaggftta Oealve FG 12$Lhie Veins......$5$79 Ywraha 0424 SCSI PC NL..........$549 O eakve 4feht Surround 5pb.....,St 29EEM Acer 320p/320u..................$10$125 SB Live NPS+/X-Gsnnnr............$139 Sony 32x/4x/Bx DBSCSI tOL..$419/509 Yannha MSW1MM20 ...............$1 09 Adaptec 2902/2903................. Carxm 330p/830(/................$129/1 99 DiamondMK300 .........................$95 74 Mn/Sonin CD R ................. ...$2/2.5 Juster 30/FX1w/Subwoofer......$57/ Adaptec 2940 w/50ph Csbh....... Xw ave 3000 PCt 128 ....................$2 GNf5000A w ISubwcofsr.............. A 2940 w ' Cxbh....... tkvfaX .............$14$199

'Prices basalt ort CaahlnteraclaraIL'AS Prices raBaot 3% cssh tgscourtt'Prices are subject to cbartga without noSoe'Umllad tpiantBIP

'Not re

n alble for an

ra hloal error&In will

to best an Store rloee'

IPC SOIHNoC SSS ~

OC SeleeboSSSS - SssbeNI DaallamfD 5$8 hteemor NS NSH

CS C SOre Deade r S SS MSSC re rdfsh21

•beISPClNSDRMS

•bA GSHad Drho •dbRCDRDM •30NrlLNSINPQModsm sAll MSNGPV)deotHSVab • 12NSpeokfN •?fi)s lV ModlV isla

•128 M)PClN SDRM)) •102 G8Hrsd Df)tte •NDO

•Cols)NhriafeaHNOSce2NO

•11'Mort)a ~r

eststatdss stco 4dsesttsdio tanl

fAeet $50moekt Iebcde.)

rat setaraeeeesd tidsaettcceg

Ot Ieoe fotSdmmonfh"

~, ~

C~Nl - -=' M• )

)

•Naloh trdd)IIHIO) • )?'MatSa

Cleoefoi$50)month"

UpgrodePkg. I 1000Hedotfe

tdee HdadneHheceaedd7tea 2000HedfNe

Htdreoodedoel loedrefdbt

52IHtedta twlfttbrsfae

Entertainment

Research E nm-ll

Homework Communication RC SeleeboS CSS - bsrbcSCIDaalltsm® • 128IS PC1NSD Nl

a aouta'Oa u h h tauumhmaaua h owuaua h

•20GSHad Nlo •bXDSD

•250MSPC)N SDRM S •2? GSHrsdNtto •SRDO

•Hohwo& $tsfotsrdSomdSpha u?obf)tfVV0SNRPC) Modem •rtV)doHHSMSNGPV)deo

•Cctolro boo)rt)t Sterastdlastd$pkc

s?oNI Y0055KPC)Modem • 32IS Mfbfos SpbNNGPV)dso •?08bt)V Mar)VRster ttfV)debCopkee

u?oNl)VMes)Vlner IHIV)deoCopkm

I40 ~-~ 'a ®

•cae)bfbfarbtfstscMfosce2NS

doeriat prtddr.td

•NalonbrtlNns 20N •?08ftr IH8Ccmao

•)?'Mote)or

ettdtsretlstatdsete~m' 'Ht sediheeatmd tmeicow'

Upgtode Pkg. I tdWtetdanecrscdearaebe 2100feedode

H iran i

Qgb

I I

Upgrode Pkg.2 gyp

• )0'MortSor fttrfe $50mcbet rebate,) Or leos for $62lmonfh"

lr trotea

The IPC Select Direct Achrantaget • Toll Free Nationwide Technical Suprton • 3 Year heraend labourWbrtonlr twih 1st Stoa an-site smuiceo)

l ®SSS 4 4 6 a447 2 N ost-Firl 9-11 Sl'/ S02$94 S T

recaednerrat5$a0aerseedstttae 'to oetsheeeetmdnsaadsosa'

UpgrodePkg.

a rieumniiesn~

$100mc&n shale.) Idee fot $102)monlh"

A N '

The ItsC Direct Satisfaction Gtsaranteel Ifyouam notsomphuuh satldisd wsh aa psnanol computer pa pumhossd tram IPC Iruoct, Snplr mtumewiden30 thrtohu o

star dtptttd). Samemencdaa apple ptoasoah Soa ~ ra dotorn

wttrw.ilsc.ca 24 bloat'

maonmw~ wa on a u a a uaa omanmh ~ ~ uhu al a a o s ~ a na ~ ~ a uua u na a l a a a u ua h snh t m a ua ala ~ Io na & I ha a aoo naou raanmna a o a rwuwah a r a a a u a a ~ uws a a u h s a l a umaooua aa la ~ na a h a a s a u n a n w a s ma o imlm ~ ~ oa wa a a a ~ na ~ snh n a a I maoa a ~ a na wa n uwrnaasnsaanomanaa Q I &o a a a ~ nm ~ hwl o a m a u aa s a o a m a a a u a umouaaou~ \ uw nunuaawo a~ oa ooa u u mawha r a a r a ~ ~ a ua a ra ~ ua huo a a a a a a a sa a a a w~ srn no a h a m a n e a a a u n ua r a r m a a w ~ ua a u h a ~ a a na oa na a w a ~ ra a ~ umwa a m n h ~ a ~ a a nna a ~ oua oo am ~ ~ ~ & ~ ~ l w ra ~ h a ~ a wla

yen @ urn11(

IPC Direct Investing in your Future I.

'I'

' •

I' I

• II

I '

•

E Il1c I'ill Il lIl all t

RL~e,it('.h

E-ITI'Ill H()l11('.9 01'k C(3 1111 11(111I(.'Il I 0 I1

'I ' I '

I '•

• I

I '•

•

1I -

Visit us @ v~vw.ipc.ca 8 we can cul m b uild oneiust for you!

c HANOS ON >

'NE

ayte umber

n Canad MEN V/sto YZ/ 2S 040 0SN/r

IIW

Take One.

Lights...camera...edit! TCP Lab gets into the movie business with some hot new computer-based video-editing systems

started to change. Previously, SCSI drives were almost dc rigeur for any Form of video capture Pfsto Ylp edging from the steady trickle of mail we and editing because they werc the only drives sd 020 as/do receive on tbe subj«ct, a lot of people are with a high enough transfer spcetL On the interested in video editing, whether for downside, they were usually far more expenome m ovies o r bu siness projects. sive than IDE drives of similar capacity, and Pmfessionals usespecialized (and costly) com- required extra investment in a SCSI host puters and editing studios For editing broad- adapter. Recently, the cheaper IDE drives have startcast- or industrial-quality video. but for home users or businesses with limited budgets, the ed a shift towards the faster UDMA/66 interoptions have, until now. been expensive, com- face, and generally cost just a little more than UDMA/33 models. Thc faster transfer speed plicated, or both. Dedicated video-cspture cards have long between host and drive is ideal for the home been restricted to professionals because their video-editing enthusiast, because it makes it higher cost has put them out of the reach of possible to smoothly capture video without mosthome or small business users.Even if the added expcnsc of SCSI or the configurahome users were wiging to pay the thousands tion headaches that go along with it. I/fsto V72 of dollars that such cards typically cost. most ll" 0.26 dlzdr desktop computers just didn't have the specifi- Does your maohine have what it takesy cations necessary to make thc quality of the Even if you don't have the newest and best video capture worthwhile By the time the hardware, you will still be able to capture hardware was upgraded to the levd nc««ssary video, though having a newer system or comto make the purchase of the card worthwhile, ponents certainly increase your options. When users may have already had to invest many shopping for a vidar-capture solution, check the box for minimum system requirements, to thousands of dollars. I/y-192df/ 19 0.26ss/oe see if your machine meets or exceeds them. It' s worth noting that machines at or about the Capturing the market ATI made a splash with the intrude n ion of the minimum system requirements level will have All-In-Wonder video card for thc horn«mar- trouble taking full advantage of the video capket. The All-In-Wonder was a radical rethink ture opuons, and performance may be far less fsf-XSSM /s/ of the graphics a«cderator, adding limited than you'd hoped for. (You may be restricted video input to the same card that was respon- to capture in only the lowest resolutions, for sible for output. The quality of video input was example.) Even with thc faster UDMA/66 hard disk nowhere near thc level of professional video capture cards, but it was a start, and it was also interface now available, simply upgrading to a relativdy inexpensive compared to the dedi- fasterhard drive isn't enough for users with cated cards. oldermachines. To take advantage ofthespeed Even with this addition to the consumer of the drives, yoni) need a UDMA/66-compatiyy-1636(tfl536f/ 1 world, hardware limitations inside the PC ible motherboard gook for a blue IDE socket tc /rs 02d remained an issue. It's fme to be able to capon the motherboard. and make sure you use 48/SS/2/r ture a video signal with a video-capture device. the thinner 80-lead IDE cable) or a separate but it just wouldn't work if the hard drive was controller card. O nce yoursystem is ready to accept a faster too slow to write the information as it was DAYTEK monitors - grat in sales, hard drive, the most important factor for the being captured. The s ame was t rue i f t he CPU grat in value. was too slow, or the RAM insuflicient to keep video enthusiast should be size. Captured in the system From continually swapping to the full quality mode, 10 minutes of video can take hard drive. Solving these probkms required up to 4 CB of hard drive space, depending on 8 2 9 4 $ 5 investment in components: more RAM, a SCSI the resolution and method of compression Web: http: //www.daytek.ca hard driv< a faster processor and a mother- usctL It doesn't take long to «at up all your hard drive space when capturing at full qualiboard that could handle it. E-maiL infoldaytek.ca As is typical of thc computer industry, ag of ty, so users who plan to edit at the same qualithe baseline components of the standard PC ty as thesource material should seriously conhave increased in performance and decreased sider upgradingthehard drive or adding asecin price. With lower RAM prices today, users ond dedicated drive. Those who want to capcan easily install l 28 M B without breaking the ture at low resolution for usc on the Web may bank The same is true with faster processors. gnd lower capacity drives adequate, as long as What continues to be a potential limiting there's enough space leh to capture, edit, and V anco uv e r • To r o n t o 8 I factor is hard drive speed, but this has recently save the gnat project. On balance,a second

1-877-DAYTEK-1

~DAYTEÃ u~

llow M t u c a avesta 1NwI

drive may be the better solution in any case, as using the same drive for both program Blas and capturecan cause degraded performanm because of gle Fragmentation and simultaneous access.

OV or not OV (that is the tormaO Composite and S-Video have long been the primary method of geuing a video signal from source (typically video tape) to capture card, but DV has the potential to change that. Those

using an analogue camcorder or VCR will probably have to content themselves with composite/S-Video signals for now, but a new generation of digital video cameras uses the FircWire interface to transfer data between cameras, appliances, and computer hardware. Typically, these cameras connect to a standard FircWire port, and software on the computer is used to pull the signal &um the camera in

full digital quality. For PCs that don't come with a standard FireWire port (and most don' t. yet), DV editing solutions typically ship with a capture card that features one or more built-in FireWire ports. Those with a second port allow users the option of adding other FireWirc devices, Inc)uding external hard drives. Thc disadvantage of these cards. however, is that most of them are DV only; in other words, capturing from a VCR or analogue camera will require a separatecapture solution. Cards that feature both DV and analogue capture are available, but th«y tend t o b e m ore expensive. Unfortunately, we were unable to obtain any for this month's testing. Vigital Oideo Sdibng Roftware nug No matter what kind of capture hardware you choose, you' ll need a program to grab the video and then edit into a usable format. There are a fcw different software editing packages available, and most hardware comes bundled with some software. However, the bundled software is generally a trial version of a more powerful package. While novice users may find it meets all of their capture and editing needs, those looking for more control over the editing processmay want to look into a more powerful software solution. AB bundled software comes with the video

capture driversand basicahting features (cutting clips and rearranging them in a storyline, for example). Some offer transitional effects, like fades and wipes (or even the famous "star wipe" featured on the season linalc of The Simupsosa. More comp)cx editing f«aturm, like adding layers of audio, may only be avagsble

c HANDS ON n

Analogue-to-digital video-editing solutions Interlace Replacesvideocard?

Videoinput

gdfx Voodoo33000 TV

ATI

Belkin

AD-io-Wonder t20

Videobus

Daxfife Guigemet Metrox Digital VideoCreator Cougar VideoEdition Marvel G400TV

Pinnacle StudioDCtgPlus

internal AGP

external USB

external parallel

internal AGP

res

internal PCI

yes composite,

yes composite, S-video composite(adapter),

composite. S.video,coax Videooutput composite, S-video Maximumcapture resolution 320x240 Capbxe/edktsafiwar e Runsunder Windows95 Windows 98 Windows NT Windows 2000

inlemalAGP yeb conlposile, S.video coax composite. S-video

compospc, S-video composite. S-video

704x480

640x480

composite, S-vrdeo

none

composite, S-video composite,

720x480

352x288

S-video 352x240

S.video NA

Ule ad

MGI

Ulead

Avid

VideoStndio

VideoWaveII

VideoWaveSE

Pinnacle

VideaStndio

VideoSludio

Cinema

Studio

yes

yes yes

OSR2only

yes

res

yes yes card only

yes yes

res

yes

res

S-video, coax

no no

card only

MinimumCPUrequire d MinimumRAMrequired

266 MHz 16 MB

233 MHzPentium 6 notspecifi ed

Contact Website Warranty S eg estedretail pric e

888-367-3339 lilclirne

$29 9

composite, S-video

card only

IfeS

caid only ca/d only

166 MHz Pentium 16 MB

133 MHzPentium 32 MB

233 MHz Pentium fi 32 MB

233MHz Pentium 6 32 MB

133 MHz 32 MB

905-882-2626

800-223-5546

510.360-2300

877-484.5536

800-361-1408

888-484-3366

www.ati.corn 5 years $299

www.belkin.cor n

www.dazzle.corn

www, uipemot.corn

www.pinnaclesrs.cor n I year

US$249

3 yca(s US$170

www.matrox.corn 3 years $439

$349

lifetime $149

'At time ofwriting, subject to change. with an upgrade to the full version or by

companies offer add-on boards for capturing video into the computer, the iMac DV is pretty much the first consumer PC directly aimed at that market. The iMac DV comes with a 400 MHz G3

changjngto a more fug-featured package,like Adobe Premiere.This can be an expensive proposition, though.

It's n 'feature,' but it mny bug you

processor and 64 MB of RAM. We had a

Something you' ll want to keep in mind when p urchasing a v ideo-capture solution is

chance to look at the basic model (available in the same five colors ns the standard iMac).

wholly sohrethe problem, either, aseach clip is Apple alsosells a Special Edition model, which limited to about 9.5 minutes at full capture is available for $2,249 resolution (owing to a 2 GBcap on dip size). The iMac DV comes in exacdy tbe same Neither of these things is necessarily a drawform factor as the first iMac models, which back, however. Paul Chato, director of

Macmvislon copy pmtection, which existson source material put out by major studios. Macmvision appears as a puke enbedded in

the orighxa)video sowce, undetectable to the eye but intrusive enough to render any copy Dil'tal 8 Handycam (hgp://www .sony.ca), which means it sufi'ers fiom some of the same limitaumriewable. wns used to record our own Test Lab home tions. The 15-inch screen is internal, and canSome video capture cards detect the copy videos. The camera comes with its awn enate not be upgraded, and the computer has no protection in the source material and will contml, SteadyShot, NightShot, has a 20x opn- floppy disk or other removable storagesolurefuse to capture anything from it Users who cal zoom (360x digital), and usesa proprietary tion —which is cspeciagypuzzling considering only have an interest in capturing and editing Lithium ion battery for extended runtime. The the funcdon of the device. The iMac DV also their own home videos have nothing to fear camera can handle both digital and analogue indudes the earns keyboard dnd mouse as from this. You'D likely be disappointed, tapes and converts signals.lt has a suggested first-generation iMacs, which have been the though, if you have plans to duplicate copy- retail price of $1,400. subject of complaints bysome users. rightcd materiaL (Shame on you!) Not ag That said, the DV model adds a few things cards have this built in, however.

DVsolutions

The tests To test digital video capture, we used a 600 DV solutions use aFircWirc connection to pull MHz Pentium lll-based PC armed with 128 both video and audio simultaneously from the MB oF RAM, a 133 MHz front-side bus, and device. This saves having to separately configtwo 13.6 GB UDMA/66-enabled Quantum ure both video-capture and audio-capture hard drive; (onc dedicated solely to video cap- cards, and allows the user to retrieve the data tur«). The system also contained an ATI Rage from the DV device at high speed and with 128 card with 32 MB RAM, and a Sound excefient quality. Blaster Live! MP3+ card for audio capture. In cases in which all-in-onc cards werc tested, Apple iMno DV they replaced the Rage 128 card. Esfimeled slreet price: $1,949 ln addition to the bundled software, we also Bestmatch:Mec-based video

usedAdobe Premiere 5.1 (htlp://www.adobe.corn) enthnsiaslswhowentan ap-in-one and MGI VideoWavel I1(htlp://www.mgisoa.corn). solnfioll Ihai Inclnilfn pie cofnpnlel For a detailed review of these packages, sec itself, eilhernoviceor professional. Maarten Heilbmn's accompanying review of video-editing software. We used two video sources during the review. The first was a Panasonic PV-59670-K VCR, which was equipped with both composite and 5-Video input and output. The VCR provided an cxcefi ent picture through both outputs, and came with hi-fi stereo audio. The second source wasSony's DCR-TRV210

quality video, it isn't without a few kinks. The editing shelf only has space for nine scene selections at onc time, and if the source material contains a lot of fast cuts, users may only be able to geta few seconds of source material onto the shdf. Switching over to straight capture without auto-scene detection doesn' t

..AndtheiMac phenomenon continues. Already on the desktops of many users.

Apple brings its all-inone computing solut ion to a mor e

demandinggroup, the digital video enthusiast. Although many

that make it a joy for the digital video enthusiast. First, it has a DVD drive instead of a CD-

Toronto's E)ectramedia, likes iMovie's limitations because it forces the user to shaot and

editbetter.lfyou have a zgfi on dipson your scrmn, you could quickly be overwhelmed. "Giving people everything sometimescuts off theiroxygen,"saysChato.By forcing the user to work in manageable chunks instead of trying to tackle thc whole projez at once, it bener senres the novice, and can hdp to focus those who are more experienced. What could be more problematic is hard

drive space. The iMac DV model we tested ROM drive, allowing users to play back their ships with a 10 GB drive. which leaves only favourite movies. More importantly, though, the two USB ports on the side of the machine are supplemented by two FircWire ports, agawing users to plug their digital video cameras directly into the machine without the need for add-on equipment. The computer ships with Apple's iMovie video-editing software installed, which handles bath video capture and editing. Capturing from the FireWire port is easy: just plug in the camera and then press "import." The iMovic software gives the user camera contml (rewind, fast for-

about 8 GB frcc after the OS and applications are instaged. At full-quality capture, that's only enough space to capture about 30 minutes (without even taking into account the space needed For the Anal edit). For very casual usc this may be fine, but those who want to do more serious digital video editing will neel to add a larger hard driv«. As the iMac DV only ships with 6. 10 and 13 GB drives, demanding users will probably have to look into an exter-

nal solution, most likely Fir«Wire.

Pinnacle Studio DV Suggestedrelafi price: $229 ward, play, and pause), and can Bestmatch:UVcamera owners lookingfor a low-coal divide a tape into "dips" neatly and automatically. Because of the speed of the FircWire intcrF ace, capture is both fast and smooth, with vir-

way to efii prolesslonel-qoelily video.Suitable lor novices.

For those with a DV camera, the Pinnacle Studio DV offers both hardware and software in one easy-to-use package. tuagy no framedrops. The hardware is a PCI card with two Although th e p rogram FireWire ports on the back, for hooking up the makes it easy to capture high- DV camera. Although Windows 2000 wwwccnsascomovvncam THECOMPUrfi nrnPER eceofnON APRILzooo 05

c HANDS ON »

then converting it to digital information that

the settings can certainly improve perform-

been synonymous with digital- the cornputcr could handle. Given that DV is

ance, but professional quality is not an option. Capturing and editing is done with the bundled Ulead Video Studio 3 software. The reasonthis card has "TV" atthe end of its name is because the back of the card featuresa co-axialcable hookup forboth TV and FM radio. 3dfit software allows you to view TV signals in a window on your PC desktop (or in fullscreen mode). and even to record progrmns as you would with a VCR. The package also comes with a software DVD

For professionals, miro has long

recogruzes thc

card and DV

video capture, and Pinnacle's pur- reiativdy rare mmpared to analogue video, chase of the miro line means it can most users will want to look at the following now offer customers a lot of higher-end products in their video-editing quest. technology. The miroVideo DV200 is poised as a more entry-level solution in the ficld of 3dfx Voodoo3 BIB TV Suggestedretapprice: $299 higher-end capture cards. odabasicvideocap. The DV200 is a PCI capture card featuring Bestmatch:Garnerswhowantt two FireWirc ports. The hardware comes bun- tare m lsw-resolutioa capture for the cl«an, andeasy. The bundled Studio DV software is easy to dled with Adobe Premiere5.1 (the fug edi- Web wilhoai having ta useanothfigure out, ev«n for the video-editing novice. tion). Installation of thc hardware is fairly easy. er PCIsbl for a dedicated The software can pull video from the camera What makes the miroVidmi DV200 dilfi«ult, cwd. Thesewhewaflt Io as one big file,or can save as individual cgps however, is that the software component func- sari IheWsbat thesame (based on use of the pause button on the cam- tions as a plug-in for Premiere. Users familiar hmethey're ssrlinp era when shooting video). Clips are dragged with Premiere should find it relatively easy to channels. from the scen«selections into the storyline capture vidm, but the learning curve for the novice is steep. inspired by the other window below, where they can be edited and Because of this, all-in-one solutions on re-sequenced. true beginners the market, 3dfx updated its The FireWire port transfer resultwith a DV Voodoo line to indude video ed in virtually no dropped frames camera will input. The resulting Voodoo3 3500 TV model when transferring video to the PC. probably want is a 2D/3D video accelerator that indudes a Ukewise, transferring the final edited to save a few dollars video "snake"cable with an A/V Contml Pod version of the video back to the DV camand go for the Studio at the end. This allows users the choice of era results i n a n e xccfient picture. DV. More experienced users either composite or 5-Video for either input or Compressing the video down into AVI, MPEG will find the DV200 an ex«agent output. The Control Pod also features stereo or RealVideo format results in lossof quality. choice if only for the fact that audio input and output, which can be routed but offers good portabiTity for the Web. Premiere comes in the box. to the sound card via connectors inside the PC. (For a fuller review of the software compoAs with other ag-in-one solutions, video nent of this package, see Maarten Hcilbron's Note: Thaahsagain to Smart Machinehtip://www.amaitcapture is not the primary purpose of the 3500 mschlna.corn for pxwidihd uswiththe sample unit. accompanying review.) TV, and capture performance is only good at Nots: Thmhs IoSmart htachlaa (htipJ/Www.smart-mach lower resolutions. When the captiwc size is ise.csm) for providiad aswilh the sample uait increased, more frames are dmpped, providing camera,at this point the software is geare d strictly towards Windows 98 usas. Installation of both hardware and s oftware under Windows 98 is quick,

Analogue-to-digital

fmrly jerky performance. Becauseof this, the

Pinnsde mireVideo DV300 Suddesiedretail price:3749 Bestmatch:MareezperimcedmemlmddagIar boih hmdwmeslidsehama.

Before digital video camerascame on the scene,

3500 TV is a great choice for capturing items

PC-based video ediUng involved a processof capturing the analoguesignal fiom the vidrxr,

destined to beusedon the Web, or for purposes in which asmall size is adequate. Tweahng

Supe r.Oita -,.".'-

•

1237 West Szeedwey, Veneewer, NC., VBH 1QP r Tel: (604}732-yg38 FNN: (304)7$2-7303 B(s j "

• txhhsbSnmara PC-Sss • ISCS EWrEUXIP4A/ddvide • 38" 1AehsbFloppy Drive • 3DPX VooDoo3seae Vates Card • Dvm dz laisraat drive

® oat

• Creadve Lab Uvc roaad card INRlmt • Crvaeve warhsCambrldze w/San»voter

• Wined teluwr heyboani • I dilectl z eanalu wheathseasem pad • Assr pshvso iatwaat pas hssdera • 19 ATXhmdvowwCasexaaw • AOC Sv" Dlphal laaastehe 34 dpi

• 19" ATX Tower Case CSA PX • ts" SVCA Ihzs Didiiat htaalwr

• SSK pCI Yoke faz/modemIaieraal • 17" ATX Tower Care Cda Ph • lp" SVC/t aM Cvtoar btoatlor • i Year paris m Labor Warraaiy

489

Itic

e" ~ ~

31 7 33/1$10 gl 333/dgyd $2030/3063 $3 3 35/3433 $3473

Celeron 400/ 33 Celeromlgg/500

Celereng33

gdoga

with the full version of the game Unreal. The card works under both Windows 95 and 93, and comes with a lifetime warranty.

Alll All-In-Wonder 138 Supdesimlretail price: 3299 Bestmalch: Gsmemwhowast to dobasic vidsacapture mIew.resaludeacapiare for theWebwithout having tauseaaoihsr PCIslot fora dmpcatsdcaid. Those whe want Io suri IheWebat the sametime they're suii-

ixp channels. ATI's All-In-Wonder series is the line that started the all-in-one craze for the PC. The All-

• tsevr tnt nasa«vsepephs

• 38" 1A4htb Proppy Drive • zmpX Vooevo 3sadeAmp w/yv • Iatwaat dz Dvm romDrive • douse Biaiier Uve Vates Diphat • Sorter Zd 626Stereo w/Sabwasfer • VrlaW eahaac«dheyhewd • Aspenph/Z Movie m pad • Acer zehebpsPCI Neiwvib Card • tp" ATX Tower Care CSAzheVVPe

• ty"SVN h endComer teoaear • Z Y«ar pans Ei Labor Warranty

AIR D Ky<00/550 AMD Ky+00/650 AMD K7-700/y50 AMD KT~O

3$43 3362 3310 $333

.Hansol

710P 3

ebewrim

ABBD kg-2450 AMD kg-2400 AIWD KB-24$3 AIWD k$4MO

31103

CRW843

3 1 730/17$1 $ 1 80S/1839 31 $ 23/2133 $3452

= ;%a i .

lsy Smy mgpVD Plmyik

avieia vieia mvavuvz

$349

Omd m Rook PC

ivaaercexsllllllchv

Rvllal eaa t unmaauarrssa

Ulema 3000 neucal asa • tzaa dal sa Imvruaeatw ellm wee

$ 33 9 /1010 $102 5/10gy

graphics-intensive games. The packageships

• Aet/d/Gidabyte AhmzTC V Atlhaa • With tmhta ad/ Zaehmweas • 1ZPMb Seltara PC-tae

• XOpea PS/Z ieallu! A Pal

• Z Year pwis m Labvr searraaty

garner s for its high frame rates, and the Voodoo3 3500 TV is no exception. This 2x AGP model has 16 MB of onboard memory, which gives it enough oomph to handle most of today' s

•

• Aver MXS9 ProATX hzataba • ptzK LZ Pe Cache • Apace htVP4, tmhtadd ready • demb SDRawFC-lee • &40$ BIDE Ubhla/dd • 3.5" 1.44hth Ptappy Drive • Tatepraud Advaacwt I/3D AGP • peX Btbg CD.ROM • latexrated hexad Oubssrd • IaeStereoAwp. Speakerw/Sabwaafer • wiava lav-xez aeraoard

Hs ascoi

QR,'--

•

• Accr hIXesprv PCISS tmMA „er 'i m1/s • VIA Pro Chtpseta,ex AGP u sahih Seeaw PC-tee • asGb Utes IDE Aanl Drive • 38" t.4Mb Fhippy Drive • l habit TNTZ RiveAGP phhae Vates • peg Elbg CD AOM • Oa board SIS APCSdeasd Card • Jasrw SD dpeatm'w/dab»safer • Vriaphte/rurzyKeyboard • AOpea phiz Mouse • SQC PCI Voice mz/modemlatemat

• ZYmr partsdiLabor W arranty

Pendlum 3430/533 pemNum 3~30/300 Pemilum 3~50/667 premtlmm 3 TQB/y33 Petttimsw3-750

Sit elneee •

• talet Pmihua-tti

•

ym year In

, E91>ail: Swig'.CO )SMPd.'9'-.dztg~©gl11 • Awr AXdSPro I lsshttw Ve

•

is in 2D/3D video performance. The Voodoo line fmm 3dfx is well-known among

H EWLETT Q U Cf llU T l /PE®f PACKARD Q'opOII Vi ew&md' Il l tglm ~mOa FUJITSU AMOVK[5

• •

playerforplayback ofmovies. W herethe card really excels

$389

srawrasaa i am

EPSON Stylus COLOR 660

LEXM)~ 3200 Color detprlnter

199

$139

tm m rt vavsh iasaawmi

Awsnl WlaaIa

bog)Sech Quick Cam

~ .;

•

g194 j

" ' ssos M~~

63 ApRIL 2000 THE coMpUTER pApER ec EDITIQN www.caaasacampvtes.corn

Ek e

$1 19,

•

F•s

•

eemmPedee e Vteuo Var

I ~ea avv T.sos Idlp Nglbemlmr Seek Slum

< HANDS D N w

In-Wonder 128 is

a big step up from ea rlier modeh, incorpo-

-hv

rating the Rage

128 chip and adding digital VCR functionality. The All-In-Wonder 128 features a length of purple cable (which is hard to miss on the desktopl) with composite, S-Video and stereo audio inputs on a block at the end. Output is done from another cable attached to the rear of the card, and this cable also has the audio pass-through, to attach to the input of the sound card. The card features co-axial cable TV input, as weU, and comes with a digital VCR program, allowing you to record your favourite programs in real-time using special video compression. As with other cards. the capture function works best when capture size is smaller, with more frames being dropped as the capture rem)ution increases. The card ships with MGI VideoWave Il for capturing and editing video. Because it indudes the Rage 128 chip at its hmrt, the All-In-Wonder 128 shines when it comes to 2D/3D video accderation. The card is available in both PCI and AGP formats, and in 16 and 32 MB versions. We looked at the 16 MB AGP model, which comes bundled with Expendable Lite, and Moto Racer 2, for those who wantto take advantage of the card's gaming abilities. The All-In-Wonder 128 also comes with ATI's DVD software, which gets a hardware assist from the card itself for optimal DVD movie playback

As wiih other ATI cards, the AllIn-Wonder128's graphics component can function without an

Capture size tops out at 352x288 pixds, but capture quality at that resolutioa is smooth, with virtually no dropped frames. MGI's IRQ.Thiscan beextremelyhandy VideoWave SE capture software is included, as when anIRQ needsto befreed up is a copy of MGI's PhotoSuite SE. for another device, but it should be noted The big drawback with the VideoBus is that that video capture and TV capability is lost it's a one-way mlution only: video comes in, when an IRQ isn't assigned. bui you can't get it back out again. For those ATI hardware does not al)ow users to cap- who want to capture video for use on a PC or ture video fmm sources encoded with copy the Web, the low price of the device makes it a protection. really auractive option. Those who want to be The card is fully compatible with Windows able to put the result back on tape should only 95 and 98.The2D/3D partofthecard can be consider this if they already have composite or used under Windows NT and Windows 2000, 5-Video output on their PC (on the back of but video input functionality does not work some video cards for example) withthese platforms. The card has a fi ve-year warranty. DazaksDigital Video Creator Sutpestedielal price: I/8$249

Selkin

Yideobue Suggestedretail price: $149

Bestmatch:Those baking fora tow-cost

Though USB connectivity is qukkly becoming hot, most of the USB-enabled deviceswe've seen so farhavebeen keyboards,mi ce,and hubs.O ne of the more interesting things to come out for the interface has been Belkin's Videobus, which agows usem to capture full motion video from either S-Video or composite Audio is handled separately though the sound card.

OFFICEAUTOMATION OISTRIBUTION INC

•

or lowrmmluliori capture forIheWebwithmri havingto use anotherP(3 slot for a dedicatedcard.

The Dazzle Digital V ideo Creator i s another ex t ernal solution, this t i me

A relatively new name in the North American graphics card market, Guillemot is a player in the all-in-one category with the release of the Cougar Video Edition. The 2D/3D graphics acceleration on the card is based on Nvidia's Rive TNT M64 chipset. The card comes with 32 MB of onboard memory. Because of that, the Cougar

—le

port. It is the only product we looked at this month that required e x ternal power (other than the VCR and

VE provides excellent gaming funaionality (and ships with a few demos to prove it). The card is available in both PCI and AGP formats; we had a chance to look atthe AGP version. For video input, the rear of the card has composite and S-Video inputs (audio must be handled separately by the audio card itself). Continued on page 70

PC sys tem, ofcourse!). The front of the Dazde DVC has both composite and S-Video input, and stereo audio input. Video is carried to the PC over the parallel cable, but audio passesthrough the device and enters the PC via the sound card. The back

NT Networking, $ervice4 Support triiriumioa aaxerv InternalPamby6 24xCD Wiririowsaa, PCISCIA sat avetm eaved 6 speakers 6.4ib, sliverhmm

IntelCelereagyttembt ioa Immc i.eem9pxvmy sasCbetbm. Ie beSovori SS 30 amerAGPariwe mammy il iownari evaa srivvvx Ww pasavtvmm,mouse

earnedsnaass,sax pavasedem wihdowsea wilriManual

14' ATXTower,scowspits Iribmbis Netvvvk csiri

'1148

PerlableCempeler

PNB(818

Imel ain SVGA wTVOvt Cache pio AGP.56hModem esmeo Iam, IO.IG Ikri sa Pair glover aodKeyboaui sax CD.ROM, PkxmvDrive iebii sound, Iobwspaakem Tiny DasklopCase Ip/lobmb/s Nehvoik Cam Use Tourowrimorillor 8

6SS

Canon BJC2000SE Color Canon BJCI0008E Irk)et refurbished

SI49 $89

Epson Stylus 860 Cuter inkier I 440x720dpi Lexmaik 3200 Colorinklett200xt200dpi

8199 $199

HP930C Gator takhstPrimai $309 H Pt 100 laser Printer, 8ppm, 600dpi,tmeg. NewMadel $M 9

IntelPeegemgl gtattetb:

Anythhg Less a Jea TEM BShauH

aavammtamed AGP

Athlen188MMx, ABUB K7M Beard w/abend

tee Hdek I.acmemeppr sasCmesom.exam Sound

I r Svarisseowv.arrip pn win 98 lwrtxmst. Mouse esmepSDRAM, sax Pasrivkm em wooowsea vvmManual ta' ATXToww. ieawepkla

'1189

vw sxasw

v l v vvovux

a1498

e15$8

I zamee PCIaaMhzRam Maxloi lb.e0 Tapeipol Ivdisa I.44mp Plpr drive, Ie'Towrr ea Savage-4 Iemep AGP sax cb-nOMbrive, Ieowatl aokm wm paKeyboard,Ivelmouse a pari Samsungtsps I7 .24 hri p monitor WindowsPe 88 onCD-ROM sakMoriemoi Ie/ieemb Networkcast

Intel Pen5um III, (NBW133Mhz FSB) Atjtltyn (K7) SyStemS: • windowspa withManual • Itic TNT2 aampAGPxlv Oui • Merci 200 ArrivmIksm Abue pav4x orA8USKissAlmenbcwo • taamepabarim. Iamtht ~ • sex CD-ROM, I.acme ROPPVdrire • iip Towercasa250weeAlx bmwl • NEG Accusroc I T Nl svGA moorer .zrop • topsechshrimovso.win aaitmsxwnl zvt/sa. EIDE dalai andprimwpwa • AcER Ivamware56KModem • sound slasierLwevalue, iaowail epkm

Cashpnoe only,craig caid useis add 2.5/, Sriemtxx ot MuhmlExchange Canada

ware is rdatively easy to use, though occasionallysome pinch cover up others during an editing session. The only thing some users may have concerns with is compatibility with other installed paralle ldevices,such as printers or scanners. Users who don't have a parallel device installed wig &nd this a welcome and easy addition to the PC.

tufa salaetil low.ieiahaml videowlN out tmwadtomstarianiatemat deuce.

co wv 8 7

Our 11th Year!!

jumpy during the mcording process, actual captured video is smooth. The induded soft-

Bestmatch:PCuserswhowant locap.

foiel Celeroo433 CPU I 3' HPA SVGA 4G Imsk, 32 mebRAM Tovcri poiniMouse,ri ak Mori em

•

for attaching other devices. Although the preview window can be a bit

Guigemot Cougar Video EdiTion Suggestedretail price:US$170 Bestmatch:Gamemwtmwant todobasic videocapture

IBM it428 Nelebeek

•

Video out, as well as a parallel pass-through,

using the parallel

methodot capturingbasic iew.IesoletieriWebvideo withouthavingto epm upthe PCto Ihslaba card.

1NTER TECH

of the Dazzle DVC alsohas composite and S-

Lesst/ vm ma/or brand,beaar components /vr/oo

Pentium gl Pentium BI Panttum lg pantium lg Athlon Ky Athlon Ky UpgradeOpt!one: Athlon Ky 'mmolwa2007200mmHdsk Sae • ATI All lnWonder i as AGP Iamp • Wlnriow sZeribPxriesaooa S aa • ATIRapeFuryltavx aimep tzaa Athlon Ky i samsungRat sawn I T 2a a 495 IOX yrnzzotri I/Ppmrie Siss Athlon Ky o as ttroriaa SIS 9 • CambridgeSoundWoriwwevbvrirs psa Athlon Ky PressSubri xritom angeWmma tsodce Lease Availatriefrom t 245 Months

+l 799

member ot the getter aveness aureau

431 7 RqASERST..VANCOUVER, IkC. VSV 4G4 TEL (804) 8727337/FA)L 872 2524 • Hour MonFii t(230sm -Bri)gpm, Sak t(k00am-4 00pm

588MMx 800 MINx 887MMx 788MIHx 800MMx 850MINx 700Mgdx 750MMx 800MINx

81889

gtggg $2099 82299 $1889

gtgdg $2029 82149 82479 82799

850hlhht •

•

' •

•

r g

' '

•

II ' ' INTELO CELMON» 5SSA NNt

ll l NS PCIOS IUSNHI SOAiH

' SSa EIRE ial CDRON DRIVE • lma PANASONI(FLOPPY DRIVE • INTE6RATEO IZMIT ICP VIREO NlrfllllTEO 32$IT PCI SSUNO NITEEMIEO 5$1 19$ IDDEN INTEGRATED lollll 32SIT NIC WNIOSNS %0 107 KEY PSt klTSOAIO ' •NIOSSS t SUTTON Pll HOUSE • IiO HATT NulTINEOIA SPEAkE15 • NID.TOWER ITA CASE e/ZSSH SUPPLT

• rloHall HVLTNIEDIA 5PlaaEIS NID-TOWEi Arl C15E • /t50W POW Ei ' 15', l l IZ SSailtl S VCI NONITSI

I929.»

' CICASTYC GA-Yu KY ATk NilkloiID 136$ ltllarn ULTIIA ATA Cl HO ' CREATIVE5ts SIDE ial <DION DRIVE • I. •l PiNISSNIC FLOPPY DRIVf SNIPER 1112 32NS I6P VIDEO ' YAHiHA I-WiVE PCI 5SUNS ' A(ER 5M NO%a D.LNI • 10/Iuu NIC NulrNIEOli INTERNETP52 kfrSOil0 ' iOPEN 24UTTON Plt IIOU5E /WHEEI •50 WITT $PEA11RS ISVSHOOFEII ' NIO.TUNER ITICiSE •/50SN POWER ' AOC 17',2669 1600altlo NONITOII

I919a»

IZSNS PCI33 113NHI SDillN ' ISUS P3uil ITI NIINSOiRD ' 206$ 720011N ULTIA.ATA 66 ND ' l a EIDE inl OVOIION DRIVE 1.st PANiiSNIC FLOPPY MIVE ' ATINiGK F011 PRO 31NS A6P CIEATIVf500NlllllTEI llVEI VAIUE ' USR iCON • 10 561 PCI NOOEN ISN I'52 INTEI/IEI IEYSOMD 10111 24UtION PSZ HOUSE •/WHEEL

• ilrECli15ml I<lll eil SP15 I 5US ' I • ' Arl TOWER CASE e/25$H POHM ' VIENSONIC Il' E790 .2641 NONITOI

INTEle PENTIUNO NI600ES NH1 126HS PCI13 131NHt SDNIN

iSUSPi<tloo ATZ NS «/UDNA 6C 306$ 1200IPN ULTRAATA 56 HO 10a flOE inl DVDRON DRIVE lms PANilONICFLOPPY DRIVE CREITIVE ANNNNlAIOR PRO 3ZHS A61' CIIEATIVE 10UNDSLA51ER LIVEI PlilINUH USII 3COH r90 S64 PCI NSpfH NICI$50FTPSt INTEiNEI KE'ISOARD NI(1$50FI INTELlloE SKPLOIIEI HOUSE <MATIVE 011 S.l ZSOO SPEliMS e/Sul ILP iTK TONER CISEnit SO Will Pl • ER FOUN S.tl'OATS FOR Ul'61iSiSIIITYI

SZ,9i9.»

$1,449.»

AP400-XTREMK

INTELO PENININO NI 533$ NHt

' iNDO 67 Sll NNa PIS(ES50i

caND pclOU IUSNHt soRAN ' ADITVAC lli NAINSOARO n/UDNA 46 ' IOCS ULTII.ITA 64 10 ' CREATIVE 52a EIDE Inl CDRON DRIVE I.l l PANISONIC FLOPPY DIIIVE ' ATI IPEIIY 9 • 01$ A6P ' INIMNAYEN Mill PCI SOUND ' NOTOIIOLA 56K NO ll 0-LINK IOIIOS NIC ' •INSOHS IS IDT IIM P52 11140iIO ' HINOONS 2 4011$N P52 NOULE

AP400-PRO

APAOO-H7

APAOO-SOHO

APAOO-SCHOOL

•

' INYEle CELEiON lISI Nla 32NS P(100 IOONHt SORAN ' 517S ATK NIIN40IRO G.l50 Ulei-MA 6$ HD

•

Ii,999.»

UPClliOE: llCUYZOOIIPN HO ......... a%%i UPSIIiDE; VS PF7$0 .25 NONITSI.. +5179 UPSIIAOEr IS' 120lalSl l . . . ........ • 5165 UP6NiDE/ 17' .1C4pl2llallll . . . + S IDS UPSAAOf.IHDO 17» CUONHa ...,.. +Sil COME DOWN ANO PellC»ISE ANT OF A.PSWBI'5 PRE-OESICNfO OkCUSTONSUILT SYSTEHT ANDIIECEIVE ONEFIIH NSIHN -EUUIVALENT10 Se FIIEE 1001 S- OfUN1351OCTED Sla-LINE OIALUP IHIEIINET ACCESSPRO»MD 01 NHINET CONNUNICATIONS

VlSA

00 D a ys N o P a y m e n t N o I n t e r e s t O p t i o n A v a i l a b l e o n S y s t e m s l

UVE ACCEPT

Need • so»puler ouidon'Ihlw Nr• calli lolls or Nnance ln A.poelr syllem and don'I pay tor so dayll speak»im you lain% raprosanlaliall for moro inlormlHon.

INTONAC I VI $ A I O A S T E NCAAD

DUAL INIELO PENIIUNO NI CSD Nna 2S6NS PCI33 133NH• SOUIN DHINa u l l l m ASUS P3<-$ ATA NAINSOMD • /UONA46

485$5

mmmm maamo

$5OO.M

$3,35O."

ERZZ • Tlmln

140$4UINTHN 10.sssnla Uz• Ko

TOSHISA lla 5(SI lal CONON SIIVE mmHII CR HHIHSS lml PINiSONICFLOPPY DilVE TDUWLCNTOSW IllZPEST 90 INS AGP VSNUSTDRTDSAHSP iDiPWC 29160 ULTIAIGD PCI 5<51(AIIO

1CON 3CSS5$ IS/YOU PCI NIC •INOONS SI lll IET Plt IE14$AAO WINDOWS %It 4UTTON Plt NOUTE ll' INHln 4500 TONER H/Ill OAII PS LEA5INC AVAllASLE FOR lilt / N l nr ni

ANDO Il.l » • 5$ NHt SINS PCISS IOONNt SDiAN

MHFUateu sme ammar 111 ame m aalu»»as malus u

Aful Ark NIIN4011D WNIONi 6 S.lCS ULTRA ATA CCND Soa SIDE lal CSRONDIIIVE I.cl PANISONI( FlOPPT Olllsf INTEGRATED SNS AGP VIDEO INTfllliTEO MSIT SOUND NOTOROLA MK NO 01 0-llNK lo/100 Nl( •INDO •S 90 101 Kf1 Plt 1$1SSA4D • ODORS 2 4UTISN • 52 N005E

MON 1<1$54 ll/100 PCI NIC,................ SCT lCOII 3C147SO 10/100 I PORI IIUS ....... 51%9 iCEi 10$151-T NIC Ill/PCI .................... $19 ICER5POIT/%PORT ISSAlE1 HII4...... %19/659 0 LINK IO/14$ NIC lallAKI .........,........... I t l D-LINK 10/1$0 PCHCIA NIC ........,........., 5119 0-LNIK DSH 10/100 5/4PORI HUS .. $10SIII • 9 O.LINKDSN la/ill 16/lZPOIT HUS SM I/STM I LINk I/15 PUKY SHITCN ............ %all/5959 INIEl aairls PCI NIC .....,..................... 5CL LIHKSYS4EFlur lPOIT 10/10$ ........,.. 5219 IS'/ZS' ill5 15ru Hills tlleai........ 51$/$15

IlS Niir NVLTINEDIiSPEAKEI5 NID.TOWER ITA CASE n/2501 PSWM

maarua a au»mule rml Immml caus»mam

ts'/5$'ills Iaruiaer laannal........ $20/$29

Ptmcessoys & memory

SCSI devices

Monitoys (cyt&dig its i)

AccessoriesAcsses

FOII LMEST IIO<15 SN PROMMONS 4 RIN, <ILLOUI OFFICE OR CHEW OUR •ESLITE

ISN 9.1/ISIS Ute SC51 IOKIPN .... 5121/Mlp

PipVIEH 17'/l9' .25 .................. $2$1/lail ASC IT'/ll' . 26 14llal200 ........ SZM/lail 16 GOLOSTAR IT'19511.2l ..............., 5159 LC CDLOSTINIl' 995E .ZC .....,........ LSZ9 Nil 15' AI500TIIY' IYOT ........... M1 91$345

ISN/HS/LOSITECHINTERNET 1$... Stl/lt9/139 FUNTSU l725/S725 PTZ .................. 159/$19

Meinboents et & etx

11 IITLA5 m 91/ I426$ S<SIrrmarnlltl/1519 $1 ATLAS1 9.1/1$36$ Mll mlrarallll / N IL 41 iTLAS IRK 1.1/Iles scsl laura 1 • 11/51s9

Il i i SEC-N tl041 Ml ....................... Sl • 'I

Sl iTllS ilk I la tm'll• Ir CACA I ......... Slml

A411 SFC/VAf iTI NS................ $165/$129 MI14PC IT• Nl • /USNA$5 ................ 5195

SEAGAW CHMTAH9.IITS.ZCS U21 llrl/lrll TEIIHN llluillDY P(15C511IT ..... 555/1111 iSUS S(115Uu 5(51.3 .............. . .. . . S ll9 iOAPIEC ZSICO UlTII ICI SCSI ........... SZM

AWR AK51PIO IN CACHE ..................... 511S ACEi M65PRO VliiTI N4 W/USHlil .. $115

a(aiuas(rMGS+ •loas 10 ...... lie /ills ACERAliCm2011KN4 ....................... IllS ISUS P1$-F/Pt-51 ...................... 1175/5115 ASUS PtS.EIPZS-SIPZS.OS ... 1159/1129/SM9 ISVS 11C f/PIC.ZSUOI42S Arl NS le%/el%

i50sp3val vm w/UDNMC ..„............... 5155 ilulPTAATI SUPER 7 N D.................... $125 Alul P5.99VN Ml WIVIDEO I AUDIO ..... $129 ASUSKT-I 5($'l.l IIK N4 NIUDNA64 ..., Mul FIC11 5LOT-I 50-11 AII 14 WNIDNAG • . $199

Qi. • Se/$$1S ............................ Sill/ • 301 6A.CSIOOCSIOU ........................ sall/Mll SA.G(k/5<t(-1........,............... SMO1109 CA.CVKE+ ....................................... 510$ SA.IH AND 750 CHIPSW AT • ..............., SI•5

IDEst(trege de vices

ROM drives AFEEIT 50a/CREATIVE St • <ORONIOE 555/Mt ACEi ala/Sit (DRON IDE......,..,....... 51//SCZ TDSHISI ala COIION S(ll,.................... 5119 A(fll Osl lit IHI IOE ROMSLOT „.....„, O'II9 IFEEIIY SVS4ar lit INT IDE Rln .. 5 1%5/5175 ASUSDVD la 1/T IOE Illa . . . . . . . . . . . . . SM9 PIONEEi SVD iorHH IOE ION ...........,. 11$5 IOSHISI SVD • INT ill ION ............... 1169 ACEI CDI• )Ia4 la NIT/Df alr»l ...... Till CRfITIVE <URN ll32 ill mrel............ 13/1 Hl'CDIIN 4250 Zlal la INT IDE af»a .. StCL

ar <Onu9110 llalala INT IDE • Iran .. 1369 HP CDM 921SIlalal INT5CSl mian... 5315 PANISOHI(•alt lt • l• INT IDE ......„.. 5219

FUNTSU10,2/IWSGS ,. „„„„, „, %IS I/1179

PLEkrol 32•1•l• INT IOE tlr»I .........., 1369 NHiNi 2la Salt INT 1$1 MIVE/IUT Mll/5399 TINOIA Zlalala IHT W51 ORIVENUT5301lltll

FUNISH17.lil0.05$ .........,....... $ 199/lll l

LONT CORO CN1100EIl tattle E11UIS., lllS

FUNTSUl. • /1. • 6$ .................,.. 5139/SISS

IsNDElksml 15.0 /20.01$ muami lzot/its5

rle DlsasmaM.onl.acl »soars sSMI la a%

Sooyydcsyds e speakers

NMIOII 10.tIIS.1CS .................. 5159/1119 NA11$iZS.SIIO.YCS,.... ............. 5205/MI9

FANAHA FCIe/Nial ............................ 51$ CREMIVE E150NNY • CI .............., . ..... I l t MEIIIVE SS PCI ltl Is/i LPI SUPPOITI.. Sll OIIHOND Hl)00 4 Nktl COHSO.......... $111 DIINONS Nll$0 PCI NON51ER SOUND....... 1/9

Naillilmoll0.06$ .................. 5165/M49 NAITSI ILO/15.05$ ZN 121asu . 5 1IS/Sill

NAIIOI 20.0/50.160 211mascle . 5255/1115 NMISI l0.964tN rtlmsan .... .......... 539$

sSmum vmus I•iops<al001/.............sls

Ruantun ct to.lrs .......................... les GuanluHM is.cmo,sIe n ootu sup er %

SS LIVEI Plirl/IUN lflarl ....... . . .. • Sl l 9 IllW SPN5/IUSYER • 50H SPKS /TUS .. $9/519

RuiNIUN Ri 11.3$4molmn ................ Sill

IMEC A<535/1• SPIL 150$ .......... $19/595 CIIEAIIVEml Stl till 55PKS •/INP ..... 5315 PCWDOIS tm POINT 5PKS e/Sul .. ... SS11599 PC WOOISFPL tolo SFIIS ailUS .......... 5179

WD 6,1/&16$ .........................,.. SIL9/5IS9 WO13.lllilOA%4 .......,............ $145/ital

Ha to.ser,sss mootra.............. elis/lies

SNPNWSy Loestlow

R:RE!M < R:MR::~

ElotlmoNE LoSstloN

~W 14:.IW

;=•

I I:= ~

: •

af< iI Fcrlo/is rplso .25..... lie/lies OPTNIUEL'I 17' 411/19' 4$5 ........ 52%5/3 • 75 PINISOHIC17' Iraimrs ............. $30O53M POOSONI( 11' ll15/ll' Pl 10, . 55 99/lalul 5INSUNG 17'ISUNF/I I' 900NF .20 llllll635 SANTON/ 15' 510S/17' 75$5 ........ SIST/5309 VIENTSNIC11' E771/E713............ 5305I$359 VIEHIONIC 17' Parr%.tl ...........,........ 5l55 VIEWTONIC1$' EYSS,M .....,............. Sll9

VIEWSONICI'5' P5790 .ZS .................... $569 VIE • SONIC 19' PF790 .11 .................... 5$51 VIE • SONIC ZI' C41SIPMS........ 5105%I5104'9 50NY 17'210Q/1100 ............. Sl59/5119 50NY IP Etll / I \ ' Wol ............ $529/5769 1 0/Ir 19' Clll / Zr' C5I$ .2 • . Sl at / 5 \ l u

WIN90STINSANO/INTERNET PSt 10 ..... 59/117 HICROSOFTINTELLINOIISE P52 ..............., 525 NICIOSOFTHIIElllEYE EkPLOIIER • Tr»L... 54t AOPENPSt N OUSE e/WHEEL,.................. 515 17'lll'Ill'Alt CASE e/tllu PS 1•5/555/ill

I•'• • iu' 4IYAIK CISE e/25$• 15 ..... SS9 INWIN 14'/ll' All CASE 30$H,.„.... $79/5129 FLOPPYDOVBLSQO INY ISE DRIVE .. 519I549 lOONS IOE llP DRIVE ...,.........,.......,. 53S

15 HmooNsSelenra.o Wu.....,,, s iilili l l Nl IINOONS toll PROFESTIONAL OEN'.. 51$9 NS OFFICEZoll Slf/PIO .. .......... Stll/SM9 SISFITDKWIIITISLE <0 DIS(5' .... $1.4$/51.79

Modem devices N SIOROll Ssl PCI 90 ROUEN ............. M 5 ACEN Ml •10 PCI//SA RODEO .......... 135/$CS

via su lo p<iinrwm Nosln ........... Sl1

Vydeocerds

VSI Sllr rll PCI INY FULL NODENW/VOICE Ml ACEI 561 r90 VOICE IIAI/OATI EKIMNAI .. 57%

POOEi COLOi YNIZ 3210 ACP ... ..,........ $135 ISUS3000U/3$00111 TNTZ ULTRA $105/M55 AlulVGCUI lr/Oils 32NS/OELUIE $M5llll9

Ptioteys &scstLyseys

ilul 16400 c roe<aanslDELUIE ... $3ll/1399 ArlTV-HOiiDER IDD ON CARO SEH ........... 5$9 Ml IPEIIT 91 IN8/ltl 1 6N IGP...... 512/3109 ATIipllT toll MHS ASP .......,.....,..... 512$ ATIFUAY PRO 32WNMA 6lN4 1st.Ill%/1349 All-Nl-WONDM 12$ ICNS ACP ... ,........ $219 All-lu-HONDM ltl ltNSASP .... „, 5 30$ ALL.IN-'40/IDEI Itl P 1$3ZNSACP/001.. CALL

(REIIIVECHI»t mmlHILAIM Imo lines 5311 SUNIONOVIPM t »mall»» 3214SI.... $25'I NillolCllllH 11N/321.......... M5111149 Narllui Ctllll 3 ZNINM alma.... 521 • l5269 NITROKGall NMVEL Tu 111NL............. 13 • 9

owea vll Mal Alp lares ......,........ sloe VOODOO Itill IINS ASP OEN ............ 5129 VOODOO 3.%ROD 16NS ASP $01 ..........., $103 VOODOOI.llll 1610 ASP • /Is ilr»l. .. 5269 105ITECHSUICKCiN EKPIIESS/WES USS Sf\ill29

<IHonrsoomololulsemr ....... srwmis <aNUN srooll iso eueRMHI-..... smmerl EPSOH llu/660' ....................... SIR%I%Ill EPLONrlo/Nu ' ........,.............. Stl • /M59 EPLON STYLUS •SSIPHOTO 150 ..... $35915139 LWNARKZl I/ill COLOUR '........... $19/5179 IMNAAK ZL I/MOOCollull".......,. 5269/511 • HP CIRC/130C .........................,. 5135/It%i HPSIS</•15C ........................ St%%/ill% HP 1100/tlol liSEI . . . .............. SM5/lpll EPSON6100/6MU ...................... 51$%11M5 EPSON 12000 llloallol SCANNER ....... 5IZ9 DIIOTHEI Hl.103D/It%OUI,......... 5169/5539 NP 3300C/ltll<MAHNEN..........,. 5169/5155 HP 520SC/630S<SCANN ER..,......... 532913195 UNIE ZSSUPIH32$11 .... .....,.... 9 139/5119 UNM 21400sllSS ... ................. Sl•5/Sl09 ACTH MSPO Sllalul".... ........... SIS5/5115 ACER620P/0 1201 • 60D"............,, 513515139

JOB OPPORTVHITIES:SALES POSITIONS Am youHmnamdh Im l iGI Hei 14W ~

e im4 MISe IWLmaa Apmu N Iuaini EH

esE manas»A cmnmmrHearn indriiaum'h ousnlewim alsl ehoHslmnmal HIN campo» »SUO14 1mlHtl 1»l Iue H»NEII9 m ammu/m, Iium Wld • cur» INHI Nal MINN usl I •/Num% -urn» HNMI Rumlum Dppmltml- II 4Ã OClmtmdHmdDWIA

c HAN DS O N u

Take One! for use with Windows 95 OSR2 and Windows Continued from page 67 93. (t comes with a three-year warranty. Output consists of one 3-Video jack and an adapter for composite. Ulead Video Studio SE Mntrox Marvel 0400-TV software is used for capturing video. As with Suggestedretagprice: $439 othercards,the quality ofcapture goes down Bestmatch:Bsmemwkowant tc dcbasic videocag. as capture resolution goes up. Por minimal lure cr lcw-resclenmcapture for theWeb wghcul havdroppwi frames,usersshould se>wxa smaller isg touseaccther PCIslcl for s dwgcstericard.Those whecanmakeuseof9>ecard'sdual.headtsckcclcgy csptllrc siss. The Cougar VE also comes with Xing'2 for addinganother display tc their PCviignut having lo DVD player software, for playback of DVD israel ia aseccsdmonitor, er thosewhcwant lc surf movirs. The Cougar Video Mition is designed IheWebat Ibesamegmelhsy're surliagchannels.

FREE)

outputs on the back of the card itself, the Marvel uses a cable attached to an A/V con-

v «r

« ~

/«

:« .« ««'1«««"":.I •

. Isl sl Pa/Pa cslsrcscPU 3D 16ba slwso sound 84MB PC1N SDRAM I cow stereo speskew4 Mic. 8AGb UDMA hantdrive 56K V.N vekm ~ Pssascnh1.44Mbaessy W/secws keyboard 4 mouse 6Mb 3DAGPvices 17«d lgaal menher ININNmxwcm wvd w l nawmsssE Full vemicn',

t« •

sallfteC

R (AH

HP0250)

Ada plea cmdSSflw

f259 2NIIPM 2MB Cache

M 2 IDE CDMSS~

e245

sss

',Celeron433/466/500 85$$/8020/860$

:. .Pill500- 81168k 040/m ""Pill 5504189$ I 0 60/m

AOTATx1TTcwerw/csA260w ' pengwng mosw/bcwri w/trna Isis) Celwcs 36N400... I Sem Fast sDRAM '6MB 3D AGP I E4nb UDMAhwc rgsk 4/km -'Pessccic 1.44mb Ikey4/km • 44XCDmm4 Iabit slelso soul>a ,. Nk VAOvoice fsxmwdem IN100Mb netwc/k csxl ,100w stereo speaks/s : Ps2 104 lw>ncsrd 4 mcvse 49wi

,„AOTITA1x250w towerwl2fans '-Acus/Mgl peal/vm It/almainbowri ;"Inks perwum6/0I snmssscr • PC1N/13364mb166PISBDRAM , „ATI Xpert N SMAGPcard «-Mwuerlqusnmm 13nb ATAN HD • pacascsicIA4mb Soppydrive « „4 82 CDROM drive ; CmslkmPCI 126 soundcwu . 58k V.N vclce Isx/mccem "s tems subwccfer speakers 4 Mia "cw/SNkeybcw& Nslmcuse „"«Qsg(BSSQINSI • samsung 7506 27 mcsxcr +$275 , NEC FE70NWwcsws 98+$3754139

31P/IT digksl mcckcr+$189/$8)9 Wkldcws 99 MSvwskxi SE +$139

"."-Pill 533- 811$8/esse 842/m -'PSI 600-81$8$ iease870/m

txn w«SS>$139 L ~ P$SF/F1gumpless)$17N176PA2013<atk 8011(m wmsathmM$229

ME99vM0/Ides6370) $139

:acysogw 19 icwernmrsxs "",AOTATxl9'250w towerw2sefas .A susK7MAlhlcsmslcbcs/4 ", Acuspsc 2609 1620pessumgl M/8 ; pc 1 33 128Mb sDRAM " PC1N 12amb 3DRAM IBM 20Gb sls66 2m 7200HD "Tosh)be gx DVD crive MauoxG400MSx 32MbAGP ' IBM 20Gb 7200RPM2Mbauger H.IL . P snsscch IA4Mb FD +Mat/ox G40016mb AGP „«, Penascnic 1,44M FD4/ive „".' Toshlba 6XDVD drive Sound diaster Live value ""Sound Blsslsl Live valve -:DS>nk INI00Mb Neswxk cwri :; USS56k V.ga PCI vc/ce fsx/mccem . ' N c losofl K/8 scd Icteaimcuse "Ause lansing AC354 5speakers 4MM . Aitsc Lsssisg ACS33 speskws . Mh rcsca Elite keybcarda Ictelsmcuse }U pgrade/Opgonst "'Nsgfsdgg}gtiqny. .. Wlsccws 9S/2000+$1394199 LG795/nsmsvxg700NF1T«3465/439 L G 79Nsammcg TNNF«$465/439. ; Vuwscch 5790 19' +$499 „ v iswscnicpF790 Rsl + N 6 9 .Viswscch PF76019'+3659 Wi ndows 9$2000 +$1394199

•

AK59PmtM(220lmmawwm)$126 arx v/Aissu«~anv>

$129~

3 years warranty

erlIlulm,I: 8/533h/0008/y008:$369/369/489/$90 enI(Ill I)j) ()'.500

Celero>433/466/500/533®119/139/169/229

«w « w « w u w w

M o n rfg>M

nru lager (1,500x1,125 pixels) than Smactual source material actually provides. It's a parsgel-port device, with only a video-in and a video-through lack, both are composite. It's not too fancy, but those whee main goal is to captum high-quality

video arne will love it. LBCie Sih/er

lEEE1368 (FlrnWlrn) Hnrd Drive Tek416-530-2545.h60Jawm.facie.corn Suggestedrels2 price: $999

TVA sl

mrna/500:395/115 KN3400:6'l15 (OEM) .'.„Ky-550/6()0:6269/299

m m

«w m «w m m

vebeo OARM

m m m

m w

' w

y 06 0/yos:3305/4og m m

m m

«w m m

BOUND/cDR0M

ggngM> eenre 44x/4ex/SSCO SiWSWSI nvxxivm I«lswmeA/Iwsmerwrtranssm~ SSSSux«umrwn12/wxlbsenmm nx««l Vail«klivs«l SMI62 Fwvwnvsu sew sns w«ws msauATass " m xr«W12SI SISS 3242/nn nINH ~ ~ Sxseuxw lnisn lmn culm rkcns: Iwtwsru ssn/San 4 S«SSS Fvls: AS/eaux/ielm/ir Sics SONVems rcanengs Sseaueum arsnppsreo Smnmn Vnu T«TSMMO6M swn "scmlmiuelscsiesss/sssMM stmnm//swfrwtssnm wgtnfgG TMX4209/226 easrlasmr/cstrwsm soNTt twstmsssewxm wm«is 22m IBMNG 7206rpm $245 ztaxsuxs161msssnsssSmn7/srmxwn sssnssmImtnox ' 'W m ' ' Nc sures/rm11"smwsm@ LASSH exes l m /canw sws ~ nsltsentsa Smnnm Hxxs«l 71SP/ SN Satensm~ ~ S SSCTII«~LRW SCSI SSSS 544 t42/W b SIN ~ Ssmmue 750S 17" 6279 MWS«l cism««4M«X reslmnnem 64tsnm nnslm1244 Sms 5CN. 12/ls/24 Slnxlesmn NEC FE)50 1Tget $499 Tumm21MSCF SSS//22 SCANNERr ~ SIN/t es/Sm 2sumw/u2WSSswms Srn m M ACMISseu/ur Slsneun "N m a m Sm ~ HsnwriNN> fe".M4469 gsrm/Wmmmteu sim W S TASSSI S s m mmm m/su.ssxmm MelggORM VlswsenmPP/N $6N wn Inurn FA>UMODEM emse«/s/sss>ussswms SPEAKER o.txw ovassc lwlse sm shnrox GSNmax $269 D~ ~ ~ ISN / Stmlm P0)4NesmCPU$2N 2MM5(uegferPrlees) Msl«lsl«Pclv.se«um Snl mmews/oui/. SsswsmAkm™wl g Acssw4uws' ss'm/m Acwllc s nkm w nl / s p l scloossswrmscwrsnm usnvss ~ ~ ss sms sowmmoLon(omn Pg>5NeemcpU$359 3115 cwxwwee>mxn sssnss scowssuntwrcc sm smssecnmmmwtm numumpw«ss««k»sss mvsrsrssnnbAgp ATX '17 gggwCawem i«««we i««««m «u««««««w ««s««x««v«v ««» myles «vw«s««««w ««««vw«r« ssnmSnn N sxn w 562/A«ii ssk 3493S sw INKJETl HFSI WSICC S i mnt s V7W v/wnm SSSW Sranm HSSS W112S Ssanam Vuwswcs Hpss m Mns 57/ 147>s w nwxm Csx«xlnnnnn Wxvlse gree Ssm gessscrenm Stxntre PFIm Snn

yg APRL 2060 TH5 ccrc

shots" from a video sowce. What makes the Snappy intwss5ng, however, is that it uses software Interpola5on to capture images that

Trillkyayt(BX SISI146370) $149 /AINSimt46370>6159 Tr iwvex(v

500/550/600/700.$379/3$9/459/949

1RSfgl bOXed0Pu Pemvgn/BBANNBN

it is video oriented. Ralher thancapturing fullmogon video, Bm Snappy captunm 'snap-

GA7IX (ATX Slcl AAth/cn) $229

IIAT5pNg

M)crQStCn f.

m m

Cgdd Click! Not exacgy a full video solu5on, the Snappy is still worth a quick mengon, as

G A 6BXU/68XDU(U2ub $539/649 28 G A6VXAX(wstssrmN) $155

~ 2 000/E(nm) Ntwggg M57twtsx S«tx«HVISS«>$89 MX59P/o 512k ATAN $139 MTN~(atxscus c 3 129 s giswNtoATAesvng) $169 E®S OYO/IB-Teoh v 4xb//stm> g f ~ ral<at vgvscu nem>gtm mmman~) $1N e vnatssiviatssATAN) $139 Knu(atxsictaalhkw)62N U = ) AX6BC(ltkaksnsl $145 6BA+05arkeX sum) $1N w~ AXN(vie133 smg e $11 8 caa+IV<aTX BXsmss) 3209 SIOSTAR M36167(ATxslot AAlklcc> $259 zeg/BMd(N70>> $1N/tN A xgcp~ 1 3342wsae)N49 rata'(ATXam~ Ngi Mg Sxmeswrfgxsmoe) $168 TMKA4)I(2NMHzx7) $289 VA80nsf N) $ 12 5 AX6 6CL(i620 sla66 Dlmm)$189 ~ ~ M SN015620SM88) $18 8 M61WC(SS70) 31 4 5 BX62/BF6$>0$189/169 43B2 EPEE))E/ISy ~ ~ E P GX = = S m 81NVA(Vls133) 611 9 M5AL(XSugsrr> $1 09 BE6(ATAN slmt ) $178 Gx/Gsfa~ lnww«> Nag 6 M$ggggsdsstsr VLSN)LO 61945 5/I33M ala66 Slol'I6119 Metxa(gmo> NN BN4 (smN stan) gtgg Advance AcvsnceN133ala66scckel $139 TKXAIKT Vk/fm) $2tg i NN Bpgflwussm ~ •2\ M \ M rm M w M M M M \ \ \ wn wn w s we w w « w M M M \ \ M \ w M w «w w xm

5« m m

htlpv/www.play.corn Suggestedrsts3 price:US$169

nector box. This box has input jacks for 3-

i'ACT'lP'o'wei"serieg" NCTStiIiei'"Snrlns "-«„"ACT'I reiiiiiiiii"08r>ei"":At T AtjIjolI'se'„'e",:.

.llggm!85}SSBDM

PlaySnappy4.0

Video, composite, stereo audio, and one coaxial cable input. Output options consist of composite, 3-Video and stereo audio. The audio signals, both in and out, break off

SS 28)• Ph: (004)435 2036 Fax: (604)435 1200

InteIC eleron4NPenlinllll45 enlnllllI041N1$15941I (I 1~

Instead of locating the video inputs and

Supporting cast

006 B(S 2607 Klngnwny Vnnnonvnr B.O. VSR 5H4

NscCom ••

Matrox's all-in-one solution goes under the Marvel name, and this version incorporates the speedy new G400 processor for excellent 2D/3D graphics, too.

An(ann

Ce.WRITER

Can Xs«inanslnlb S swssKP~ ~ xssmmnssc 311%12SHssnei ™

PAPgn Ec 20/tx>N www. ~ s

5peolsgls

scwn

The thing to know about >cud dnve space is that thme's never enough when you start to captum video. If you don't want to go through the hassle of opening up the PC to add or replace a haul drive, there are a few

exte rnal ophons available. For those who use one of the DV mfiring solubons that make use of the FireWlre po/t, LaCie's external Fimvdire hwd drive is just the answer. It plugs Into any avagable IEEE1394 port, and after drivere are installed, it's ready to go. At the time of wrigng drivers are only available for the Mac (maMng it a pwfect addi5on to an iMac DV symem), hut by the time you

Nmd this PCdrivers should aho be availabfe. We looked at a 20 68 modal (a 37 GB vernon is also available), attached to the iMac DV. Inslagatlon was easy. and thnwghput

was excegsnt. AMmugh it's mmu expensive than internal drives, it's an Invaluable addition to a well-used i Mac DV. And because it' s

external, it's simple to pick it up and plug il into another iMae DV Io a muM-computer envln>nmant. The LSCie FireW/re drive has a thme-year wa/ranty.

« HANDS ON »

from the cable near the back of the card, Pinnacle Studio OCIO Plus attaching by stereo jacks to the back of the SuSSssisd retail puca: 0349

sound card.

Bestmatch:Userswith uoo-DVediting sourceswho

The G400-TV is one of the cards offering want iop-hotchcaptureandad)Sagcapabiiess at low Matrox's Dualhead feature, which aOows two cosL

Editor' s Choices

displays to be hooked up to a single card. Because there is only one VGA out, however, this means the second display must be composite or 5-Videm Although this setup isn' t quite as nice as using two fug VGA displays, it allows one user to use the monitor for work while theattached TV plays a DVD movie (or other computer-related tasks that don't neces-

The Studio DC IO Plus usesbasically the same software as the Studio DV package listed above, which makes the program remarkably intuitive and easy to use. The sohware also featuresthe same automatic scene-change detection,making editing a very easy processafterwards. sarily require full resolution). Hardware wise, the DCIO Plus swaps the The Marvel shipswith Avid Cinema digital FireWire«srd for a PCI capture card geared video software,which capturesvideojust 6ne, towards composite and 5-video input and butdoesn'tofferasmuch user controlassome output. Unlike DV capture, the Studio DCIO otherpackages. The software is also very par- Plus hardware is not set up to grab audio, so ticular about its operating environment users will need to have an audio card that fea(colour depth and audio settings), but users tures reasonable quality input. This could can typically configure their system quickly require quite a bit of user configuration to enough. make the two cards work properly together Capture quality is quite smooth, with during capture. When we installed, we could frames dropping only at the highest capture not capture audio from the line until we quality. What could be problematic, however, upgraded the DClc Plus software to the is that the Matrox video capture hardware newest version. does not allow capture &om sources with Capture quality was top-notch, with virtuencoded copy protection. ally no dropped frames on our test platform.

The package ships with a software DVD

•

one solution, the Studio DV is a much cheaper one. For under $250, it adds a

quick and powerful DV solution to a

CHOICE

PC, and even comes with a good software bundle. For the beginner with a DV camera, it's hard to beat.

Analogue-to-diBitsl soluOocu Matrox Marvel G400-TV Although the Pinnade Studio DCIO Plus is as appealing on the analogue side as the DV is on the DV side, Matrox's Marvd G400-TV is even

m oreappealing fora few reasons.Not only does it conserve resources in the

relation to the other analogue-to-digital solutions is the need for two cards (capture card and standard graphics card) instead of an integrated solution. For users with the slots and IRQs fee, however, the capture quality of this dedicated solution makes it the I'ar superior

system (using only one IRQ instead of two), it offers top-notch capture quality, TV and digital VCR functionality. and has a built-in dual-head feature Forgreater display flexibiTity. (2

choice. Note:Thanksagain lo SmartMachine ihtipd/www .sm ari-mschiue.com)for providinI us withmessmpie unit. • 4 u vvms

•

PRiMux

;.; I)I ,Te): '488-'880

isra

Where this card could be problematic in

player, as well as PC VCR software for recording te levision pr ograms di gitally. PhotoExpresssoftware is induded, as are Wild Metal Foundry and Tonic Trouble. The Marvel is designed for use with Windows 95 and 98, though users can get straight graphics card Functionality under Windows NT and 2000 (but no capture, at this point). The card has a three-year warranty. m

OV solugon: Pinnacle Studio OV Although the iMac DV is anice all-in-

a . 4 8 8 -82'

d)88-8

N V N N o p p mssIAICI 'C N I .'NSOS6ATIO N 4S48 MaSesut : SS S S. Ca t : . ~ OmashtOC Ltl. S vuer7MS MMX/AMD CPU, 2DiMM, 2BMM...,. . . . . . . N I • OSO281 • luluel usshsassstsmlcN 6 scsl Adsltsshya/IN Imsnel slN Ism IyaslsvmdSuhemfm ....... . . . . . . . . . . . . . . . . . . ... SSS Iumutt ms/ psdhsll Muitimedeuuevev Keyteed.....NI/ls Lesumg lsml Mvscasawoesome Me.Roppy.ODRDMiivvees..... . . . .Slys ONOCSN PPGACosveter semso eerkek .... ... . . . . . . . . ..SSS .

Svm amhlll • vi avw ,

• Spsmalized in Repairs S Upgrades • IUsttsnrk consultation S installation

P38.1394MLV 3PCf2OM 1AOP 6 1394 Riamre ......, .SMS PssssooioCOVomer ih4v32 SISS Eisa'esEZdust c orn..... . . . . . . . . . . . . .. . . . . . . . . . ..SIN

Roovmenomeimemel Stater mi Avsilshis Sdmvvut:SOrltrm'Pleaa mubr NortmvlfmmC SS ' Asif/oxmmtfPE/louvEEE VE/Oni 01st/12D/1N/NN fuhmv ypmys /ffmmfm~ nimm /vfN 30 $in3)0n380 Asus 133/P33FPOCEtyxm3V4X SSS/471st/OOO/V1sy 64/ itv15/Eoo ssooISBO/soo/oa@ intel galeme000/033 $688940 0220gy10()/00(8000 0 AsusK7MAthiss AfaO750 w/ sound4U39 SSSS tamammIfa/VVO/Nearer/NNrrneevum l ' $)420ng)Onge .S04s l))go~a Asvs PO O D Intel 830 Pc 133Mhi/ P29 DS 04$7/aoe egs/e~ N OOOIOSO nOHOO Lm , N Y 2 K~ I SA/13.1/20/278 $1SS/000/OOS/SOS • K 7 4 ~ AM 0 S m 1U Asus P3 O . E P ss uum ui 920 Pctpafvuu Ramous B a s s PI mt uin 1118}i f 0QfvI u M8 f Lee Nl v I K9mI v1 -iresuuurug OmmMS Sgmesltmrm 100 168pio SDRAM ' 1 0 2GBUDMA AsusrsssvMA/PESBUDMAOO 017$/v183 • 32MB PCIQQ 188ub SQRAM• 6468 fXXvfA . ' 64MO PC AsusPSAA1X/Poauf AT \ebaPAP/33 EusmiqPCi 0140/185 , 0 18/ 3 S 66(66MB/sec)HardDrive• 36X CD.ROMU-DMA IBBMB/smf HD• 36f(CQEKS/f fFQM'Afybkh Ma 6167 Ky/EPOXKyMain Svsiu 01OS/SSO SoundBissur PCI 13EVLimVsiuo . 040/70 ' • Puuunutiu 144MB Fiuppy• 86K yS) utsarpm M a tch 66MO/See• AC97 30 SummudSOu nd • AsusRAMeu6 osmsusv Sss Rook278ASvtmoatsv sreem ei 4 Eplm Ooo lsxhm ' G2bit 3D WaveTabie Sound• 9/GA EO S) TNT2 32MB AGP Vsfm Cari • )0/IQDEthwmt Curd Intel SuperCC320vsmsouse AGP4 61SS Zeoosacfyf Svueoofer system Sss AGPVsbo • 120W Mutimsdia Sterno Speakers • (R opes/ADSL Resdyiv Psuasooic 1.44 RoppyDrwe MP3Pi a pv 33Ma Fi a vh (420 End uaer eaeisi Saaav v* paagutu/SSSOStufaa m eall Muibmedia iaimuet Keyboedv Primes 17" ATX "• Mmomfa 5SKV90 V/F Modemv 15.28 X-Super Svbesofsr spea ker syuem/ tSOW P MPO sovskw Sao/O.o ~v u eafrtruams' smmrsmmnme~ 3 case 250w• standard a Mouse Misvopieie/ Hssdpieses Se/ss vGA Monitor• 12ow MMdmudis.stoma Speskurs• CsooaBJC1SxfcfXXISt IXfat OOSea/1SO/01$/310 OP08802St Wm dowa SEw/CD+SISS 98 .Mu dmudfs internsKeybawd •28WhealPS/2 CumluC 9840158ICEEIIRSI BOSS/css/SIN/SIN ogs OSKSBS-2:ggkpgs sa'7-:SIKO vtarlsm 10.2/2(rvO HO+SO S/N Aip52X iar.CD-RDM 'Mouse• Pmuev17 ATXCase 230W Esse44nuutrrstu//strmo Suaa/use/aae/Sas/Sae CnssieuesOaxCDROM Sss +SIO/SS• 1513frt7L37Mommrvogg/SN v aiouer Htf I/1040tbut34OOX SSOO/OSS/eas OPV44XQHKM 04$/OO '-0 • 0 II 0 0 I 0: Wi n dows 98 SE w/CO+SISS LevnsrkZ11331XX VZ31/251 Sues/1aa/Oae/SOO cei333 fsvtop) s c el4$40$8 • 64/1 28M SX/ 1OXOVOasm tktm ouse/1ye MAO36bh P/Aitsc UIfucssmFS3XP Sas/Sea/SOS sam +es/ISS HpBpsoi /911ov 921osco.nw PC1008ORAM4488no • EthemlllLV100+OM 28 /SIN gad sass/ssa/sss Aver 63OP/ apus/uaou Eeevvr S S O S/See/1ae Arte o 4424/ pf emr 84 ~ 843 3ssse/sse/318 17127Muvkur+Otso. 12BM PofoouDRAIA+ON Rg Nsm pnaa ~ m, gg tn Ymha Cfwheav4s24aee KS Says 46/52X iut. CD4tQM+SIISS Imma~ . M ' j . fdm 56K Vay ~ PC V AOVr USS Ee OSOVv a a/SO , Dp uouu'st 071/073/095+OISS/248/SIS 4 ' Sm~N' )bggg'8)0' AssrVmf PCfFvv iSAV.mf workforlke OSO/ V O LopiteohCooesss KeHesnl 6 Mouse suan Mvieois 56KVmyOslalyuvtuvumisA OSISOB.II 310/40NOBO OSIS/000/ 035 Sas.ee F u)tsu 4735/8725 104 PS/3Keytee e Oes/ o o MS internal Ksyhssm/ Ms Mens NIORSSII 400/'ag soolao ,0IOO OOe Osr)ltumsc 4Nmsuvmg v) PNI 8800339S Opiieen17071/O)3/965 OSSO/3307930 Peeled Bell Mummsd'e iimmn SSO • Bupei7 100MHr MO ftisuv,NTY2K Readyf . • Abx BF6PIiSupe mertock MB iLinuiNTV2Kl A T 1Lr/ATX 17'/1Lr/34 Tower Cuss SSO/40/S /Sy frI/7VET/3 2hvm • 32MB PCIQQ 168piu SDRAMe O'AGBUDMA miuteiPemium ill 55DMht fSumr Speedi • 128MB Veveevo vmvsosic pr77517/prymf teer,25psrtesnesoao/yya ~~ yfn s f a m Omdvsgtummeevvv (OSMB/SaC}HD• 36X CD4IDM LIQMA MutCh 1 6 8 pin SDRAM• 2QGBUQMA BOMS/See Ha@I SsmsuopSyemuem 7509//fxfp .26mm17 Oaaa/aea PiNE 3D 4livBMEB px AOP/Pcl Soo/oo/oa v.16bitSD Wsm'fmissouod vXi'4MBAGP Vvfso Drtvu • 44X UDMAMatch CD.RDM • Cmative.SB ACANA15128/ tT27/ 19'.26 S SSS /OOO/vNO 933 $3 0 Virtr/All 4M AOP /Kl for Uea . Sea/ e a 4 56K VBOVoiee/Fat Modemv Paoasosie 1 44MB Live mthDipitai • 3dh Voodoo32XDAGPCsrd• ~m upMMvm R.:Cmstuauwallmrm- AR RsoRmi3msABP/84SSBAOPMAX SSSS7SSO, Floppy Drwe "12DWMuihmsdia St'eruo Speakem Paossouic 1.44MB FioppyDrive • Motorola 56K 3COM30905 10/ffxfOsmTPtyLink Sys AOP BMiteit 96 Sys • Muidmediainternal Keybosni• 1 5* ATcasa v f o ubkxvfuv 0 tel 10/100mlps/Aver MCPCufSA ' S ae/ a s AS Modeu• Multimediaslane Afi Xperl138 tsfvuXpetptuf033MOEM 011av/100 230W 'v Standard 28unoa Mouse 013/OO/2$ Ao ABPAkin wmow Ofvu 1281892M 01 8$/ooo/oso Subwoofer Speakers• Multimedia isiamn Keyboard Cshie15'/35750 fceusmevp v 28uasm WhealP9 2 M ouse• 1LV100 Ethernet Aduee IcII pcf tEDE/39ttths// Bstuolovvoyo/oso/sso ueooo ofOofxv3oofv 33% ' • P 08002 8 1 Wi ndows 98 SE w/CD +0128 .0140/Sos/oog Curd(Rogers/ADSL Ready)• 17 SVGA.27 Mouimr Addssceu 2 MoreioE sokesn Uomaoo Cemoi ' Sso SuvvevsAOP16MAOP/fnt2 32MS AGP ' OS S7128 182/SSN Oanl Slim '+OSO /SS P mavso UOMA66 PCr i DE Sys owaeRevOPfwf fusutnf3xMABvtsmsNS/SIN/BN I 552(V17127 Monitor +$108/MS SP000020:3DFx3000AGPlv mc+Oyo ~m m m dhsycv ammcnrkam~ Cmsde Ovreov'AeeenmPmOCR . ' SSOD 64/128MPC100 SDRAM +000n28 3QFX3500 AGP e/TV/FM TunerTV out+SIN smscome/co neo~ oosays.oa OemmuVipe V770lNT232M . 'mu/ g' ; nm .g dSS Emamal card fRtxmru/ADBLRmdfi +eg creadm GeFmcu 30 Ey s stw 32/vm DDR Da ltesess tvm ' Soo kasi msvl Cnst 19OMO ' SS.O Maine MisvmmGBKIOM' Primes17ATX ossaw/300W 4460 ' Pl)i s)slumpries uisil er call N SvomdUEOftst PCI 03S MsimvNksamostoaasaD Aavaxvse. Oosg/sso Secondnlusr Part PQ/St SKN/OO ~ mm. M e me)PV '32/OtnSONO v

Isstssl Home 0f(0)ot-gsovf/Nr T h e

O r ear n F a st e r

MctMflsrSoomnM

Wvemmessy Imt fwaa, plasmsaf

wwwosnsdscompuius.corn THE CDMpUTERpApER oc EDITI0N ApRiL zcoo 71

c H AN DS O N

Dnsktop video proosssinu softwmw Continuedfrom page dp Additional functionality appears in a pop-out toolbox. The trimming toolbox has excdlent kame-a«cu-

As with the first release of any product, not everything worksasexpected,butthesupportpageson Pinnade's

rate controls. There are lots of standard transitions, and a few 2D motion transitions. The timeline controls are exceUent, both for scrolling and to change the amount of time displayed.

releases.

Sa Sum M

ru muuSuuu

site cover the issues I uncovered, like scenes without

audio.Some of these have since been fi xed in patch

iS'% % W % % RS R S Ri l ~ K I

Ulsnd Media Studio 5.2

From:Ulead p:I/www.ulead.cern There are only three audio tracks: the orightal loca- hti tion sound, a narration track you can record &um with- Minimumsystem requirements; Pentium, 16MBRAM. in Studio DV, and music from CD or a pre-recorded Esgmatedstreet pdce: $600.

@ lgg W

Desktop

sional Title Deko application, has a powerful feature set. On the other hand, although I have figured out how to make text sciofi up the screen, making a credit list with more than a few names can'tbe done. ln addition to DV output, Studio DV can create AVI, M PEG and RealMedia fiies to be streamed on the Web.

onw

TheScraphnnhin PinnacleSystem'sStudio OVis automaticagy populatedwith thescenes framyourdigital camcorder, that yeudiaganddrop onthe storygna

~CRYSTAL ~ COMPUTER ~~LTD.

4551A Kingsway. Burnaby, BC YSH 2A7 Tek (604)436-455 1 Fax: (604)436-4000 e maut IntoQRcrysfalco m p . b c . c a web: h ftp:f/www.crysfalcom p . b c . c a Mon- Frl: 10am - 6:30Pm / S at: 10 a m - 5 : 3 0 p m Sun, Houdays: By appointme nt

liN uuuu

Ulead Media Studio is to Premiere what CorelDraw is to lgustrator: a powerful and feature-rich competitor that is consistently overlooked. I can't find a Canadian online retailer that even carries it. I can only find one shortcoming that stops it from being fuUy professional application — support for industry standard time code. Media Studio consists of five separate applications, for the various processes and stages in your video production. The applications Video Capture, Video Editor, Audio Editor and Video Paint are self-explanatory titles, while CG Infinity is used to create titles. Paint and Continued on page 7$

WAV file. If you can't find the right music, you can create it using a totally integrated application called Sonic SmartSound.Thissound track generator composes music for yow production in a variety of styles, at exactly the length you neaL The text editor, a junior version of Pinnade's profes-

~~ P I +

•

„• , 51 4' •

•

i i : • •

Is"SnrlTRnglignrlTVRIAS

I' QOIE/SPIN/Pa-Plu/RIUI Qu: IHIBIANO

swsW MINS

SWIRnl QIL

cswcoN/IosnIN/Bp/Up sf SI.wsnonNngnls INHSSI/dln02n22nr

stuuidlngWISMS

$444/IS HAVIO RSN:glnsi Ilfghl gnsm SINnlgnn/HH/2S AIER4wsiwass SWSIllWN HP9110ICONSIIS IOE SS BpsNsr plgnussfplg SNRN QUIHUIMRIITf/N

u•

•

IOII IPIVWSUSPSSF/USUSRIN

oslnc/slwlQHpsl/psa

$210/IN/21$

stsnNnsne

sol MTPIQ/02(OMAN)/6$/cnuEI SININI/dn20/21$ MINI/H/SNIMSSSS IONs s RISnwnNnui NIB IIA/Pun0-1N/IPNU S/BP.NUO SIwldlslsls QNN INWION/SIIN/INW/Nl QU/IW2S/SS/Ng SSNINf/4WISMIS211/$1 HPIIIWSIOC /VIICSE

CawasSP/dSP/42 0U/lnrd20P •

$1 N/2S/IIIISS

$$4$/lls/IN 14$/illnss/le

•

WMSNIOM/SIS SWIS SOIWBMN/POSSNID $l4S IIMMHAM IRILPS/IRW NIQIITS S l gnf62/lg NIIM AOP /5MI OP SS/4VSI Nucususog tnsIEIMvsstmusgps/us ssnNO N $NBIWISHSMN IMINIBAI MOIHEPSEHN NISI AQRPNINHVnSMSN/ARNS N TId/IHIEGIRNI242UL TR I SIN/ i s n t g INH/NI-SWI90/IEHOH NM 510/5$/S 1222 22IPK-INusWMnS $NIN9SWIN RATNNIL SPNON0N/IIINNIUSQM S'IIWNI N INOII PCI VOICE/MODBI OIASI N SS/S

Acs Pu/lcs Isl SIIRPouulcg AOC'Is'IAOC lrIMKIP

SM/d9/N SIN/SSI4N

OPUQ USTQlIMBOQNKEP/I/OIN

SSIWSWIN

HNIONANIINRUS/NQIEWOWIQ SNPAO Ss/S/SS

$F-VALUE P 3-V4 N E SF-PONSR GMMMS5AX51st ISWI 90,SOSand Owl rc 55KVN Madam

5upa l MWxad

PShnsnuxm SMAGPVueo 0Nnuda

MKVNMadsm 52MPC.IN 1.44Mlpu S.IG IOD 17 AIXCam, sx COSOM N KBIL Inninuin nxl

SWV90Madsm SSMPC-I le I A4M luu, SAGIGD 17MXCmnINCDSOM

Nsem

spi t

Nswsm spnwsm Smwnamoamlpsani

encl

sist

pmsm

mtnspudsanmnuda

15' Mou&INw spsani Snnn m

420 0

snu pc-IN

P3-POMSR

IW MOWSIOSWS Peani

17 XOS0.22 Mana

N4450e

N sel

prn e dlNt

stet

=- "„$129IR5%555 Mare IfamsNd sy• Iam prism 00 vabsite 22 A PRIL 2000 THECMPPL/Iun PAPER OC ODIOON umm ~ e

The OMEKRON notebook can present any w ffere, a n y t ime. It can even be used with common overhead projectors. Great even for teachers in school classroomsi

! Dealers Wanted! Available at: INTERTECH OA. (604) 872-7337 Notebook-Cl tycom 1-888-222-8082 UNI M.I.S. (604) 438-3386 ROCK Computer (604) 41 94)828 or 8794642 Uniserve Systems (604) 21 5-3822 I.O. Express (604) 273-3747

Interested in sales? We are hiring today!

I 7 uDS0 2l Malar SNW5unuaaia Spedm

Nmwsm siamnes Nsmnm 4letnrN teel

Sll»

nesrwnmsfaenae pemwfe slelllel

Wn defrnahlmhanHSS, spgladm, antwalklag. * 294 gsrehargn00 Sasfer Carl, 594 00I/lsa Bard•

Perfect foll * SalesPresentations * Conferences * Training Seminars * 80" Home Theater w Custom Projections!

Xpai 90, POSard Cad PO 54KV.N Madwii 44MPC-100 1.44M IDD. IDGIGD

90 Ksunuuaaaan nxl

N04m

Notebook 970-P comes with a detachable see-through LCD Panel 53,995 MSRP

CMIAdmnae5nll

I A4Mrtnx 100KDD 19' MXCaa uw CDSOM 19'AIXCow, su CDNM 90 umILInnmaum Iun 95 nmuuelmaue, lad

PNS IIN 4mt SrmtnI le

Notebook 970-P gt Magic projector ML-800 Combo 56,890 MSRP

• •

•

•5

•

LRABIIOG AVAILABLE xcam

•

• •

•

I I '

MKR Vv'PIK

SYSTEMS

Mon-Pri:14:00amdl:30pm

Inlgloelngn/IDMH zK63X Intel plllo330~12II N9 g g V 2S Q 5 ta t t 0 n

••

• Eurone Super 7 Slain Board • Eurone Slot 1 Man Board 1100MHz Pn/Plln • 32MB SDRAM DIMM 168Pin PC-1 00 wl SPD • Panasonic 1.44 Roppv Drive • 8.4GB UDMA/66 Hard Drive

' AcerOPEhl Main Board o 64MB SDRAINDIMM 168Pin PC-100 w/SPD ' Panasonic 1.44 Floppy Dime Idaxtor 13Gb 7260rp m UDMA/66 Hard Drive AcerOPEN 3DSound w/ Speaker5 M icrophone ; $3Savsae416MOAGP AcerOPEN 48X CO ROMDrwe Kl AcwOPEN56K F Meden Voice inkV90 lterr AcerOPEN HX45A 18' ATX Tower Case P o AcerOPEN 107 Key Keyboard • AcsrOPEN 2 Button Wheel Mouse w/ Mouse PAO ' Micmsolt Windows 98 Second Edtion (o$61 to W2K Pm) • Axion Internet Access Kil (30 Days Free Internet

•• Onboard 30 sound8MB onbaard wJ soeaksr 5 Microphone Shace RAM AGP Video

• 40X CD-ROM Drive 56KFaxModemyoiceinLV90 • Mini ATX Tower Case • 107 Key Keyboard • 2 Button Mouse wl Mouse PAD • Axion Internet AccessKit(30 Days Free Internet)

Intel Celeron 433/444/SOD/533

PJ0

Inlet Celeron

N IIDK/400MH z~ ISSI o Asus Krn Main Board • 126M 9 SDRAM DIMM 168Pin PC-1 00 w/ S PD • Panasonic1A4 R oppv Drive

o 20GS UDMA)66Hard Drive

'o AcerOPEN IDX DVDROMDrive Ace r OPEN10/100 Network Card o • • •

18' ATX Tower Case Cf/-" URI B Acer OPEN 107 Key Keyboard h a AcerOPEN 2 Schon Wheel Mouse w/ Mause PAD Micmsofl Windows 98 Second Edlion

• Axion Internet Amass Kit (30 Days Free Internet)

AIND Athlon Kl

S ISS/Iol/ill/ill 433/444/500/53 3 SII 7 2/INI/nsl/12ll Soo/550 Intel Pentium III Coppermine AMD Athlon Kl

Cyr)K Mll 300/333/400 ANID K4-2 330/450/500

SIll/Sll/SIS SOOS/SSOS/4003

can520 onRebate s/c-IDI Iosz

• . LILlx O.S.

II I

5f5.5I m oaoow I 2s

•

8Rod IIII6l Doloo25dlios 66I •At«SI-rlo 3I H)II IPteby 8Co reIIISISId,fd5ol 56 5 'a«loxoo04 Ma . 4GelIISIMoootdlios 6 II '~+ Or~~ ~ • ~uihas)PO PCMCIA CARD

$69 115 450 I 99 (99

lisle/Iln S2III/ 2SSI/2lll

UP GRAD E

to FasterSystem

Surone M593/MSll Mein Ronrd, IIMR SDRAM RMS A ep Video ShuraRAM, AGP Shore RAM y(dgo A Sound SSK Modem,32NIS SDRAIN

•AMD Kd-2330/4SO/500 IISI/243/III•Celeron 400/433

ANIDKS-3 400 IISI • Celeron 444/500 515$ •• C)frht MII 300/333/400 I ISI / I I I /? li • Celeron 533 aovmoooot & corporatepocdtmooidcic vmhomv. nice cohjon to choosowhhcwt pil ot Ail price oio cmh cbcovmod, tsn mnm for othoi pctmootc. All ptmloctoomch 560 notice. trmlomciki.ond reammedtiodoilmiiu olo piopolvm of their rccpcctivo ownow.

Acer Travel I@ate 506OX Intel Celeran 433MHz

Notebook M • Linksys IDMbps Network Caid • GVC V.90 Modem/Fax • Xircom Realpart fO/IOO+56K • Xircom Credit Card 10/1DD • Xircom Credit Card 56K

286/386/486/586

• Pnmo01410b sen

SISS)/Ills

SISSI/102I/Nsl 400/450

Intel Penflum III Coppennine ANID Athlon Kl Sell/Ill/IIS 4495/loo/933 SIrl/2ISS/2Irsloo//50/soo

One YearsParts 5 Ttuee Year Labour Warranty (System only). An Systemsare terled zndbumsd-in for 49 Hoursbefore shipping. Leasing Available.

Monthly 5 I

A o e CI t s

• Auresl Vortex 2 A3D PCI • Agee Lsnsina ACS-33 wl Subwooier • Asus VOODOGefaee 25632Mb AGP

III I /I I • II43/iII ISII

Toshiba Satellite26100VO Intel Celeron 433MHz

32MB SDRAM NeoMagic 22DD AGP 2 5MBVideo 12.1' HPA Display 4.8GBb Hard Drive

64Mb SDRAM 12.1 TFT Display 6GBb Hard Dave

PCI 3D Sound

56K V.90 FaxModem

Checkforothernotebookmodel andupgradegotowww,nlcw.corn •

• .

•

• •

•

Slot 1 Main Board Abit VA6 VIA Pro 133 UDMA/66 w/ Sound $129 AOpen AX6SC i440BX $145 AOpsnAX63Pra VIA 133Mhz UDMA/66 $125 AOpsn MX64 VIA Pro 133A w/ Sound 5129 Asus P3S.F t440BX $175 Asus P3C-2000 i520UOMA;66 5229 Asus P3V4X VIA 4X AGP 5159 DFI PBSO.V3 VIA I ODMHzAT $125 Malsonic M S7381SGM VGAVtudiotMadem $109 Slat A Main Board(AMD Athlon) Asus K7M AIIOIVIA Chipset 5215 MlcroSlar K7 Pro $199 Socket 370 Mainboard Abit BP4 Oval Celeron UOMA/56 $1 99 Socket 7 Main Board AOpen AX59ProL2 1M Cache $115 AOpenMX59Pro II w/Video/Sound ATX $125 DFI P5BV3+/e VIA MVP3 512K CacheAT $99 EuroneM598 SiS530 VGAIScundtuadsm $115 AOpen AW37ISA 3D Sound Card $19 AOpen AW320 PCI 30 Sound Card $38 AOpen 4OX/48X/52X CD-ROM $59/69n5 AOpen IDX DVD-ROM $149 AOpen 6X 4X 24X CD.ReWner IDE $299 Creabve Labs Sound Blasler 128bit PCI $49 Creabvs LabsSound Blaater Uve Value $70 Altec Lansing ACS33wl Subwoofer $69 Aitec Lansing ACS54 4 Sneaker w/Sub. $99

AMD K6-2 380/450/500 $65I85/109 AMD K6-3 400 $115 AMD Athlon K7 500/550 $299I315 AMD Athlan K 7 600/650 $349/415 AMD Athlan K7 700/750/800 $585/799HIOO IntelCeleron PPGA 366/400 $99/109 Intel Celeron PPGA 433/466 $115/1 49 Intel Celeran PPGA 500/533 $189/245 Pentium gf 100MHz L2 Cache 512K Intel Psntmm III 500 $450 Intel Psnkum 81550/600 $469/599 Pentiu rn tll 1338IHz L2 Cache 512K Intel Pentium III 5336/600B $389/525 Pentiurn 81100SIIHz L2 Cache 256K Intel Pentiumni500«550E $350/390

Goto wwwntcw corn forMore Coppermine 32/64MbSDRAM PC-100 Sdong 128Mb SCRAM PC-IOD 64/128MbSDRAM PC-133 •

•

$159 $99J189

•

AOpsn Cambo fDMbPs PC///SA $25/23 AOpsn 10/100MbpsPCI $29 AOpen 10/IODMbpsPCI Bus Master $45 AOpen 5 Ports IDMbps Hubs $49 AOpen 8 Ports IDMbps Hubs $69 AOpen 8 Ports 10/100Mbps Hubs $199 Linksys5 POrts 10/100 Mbps Hubs $99 D.Link ID/100Mbps PCI $35 3Com 10/IDOMbps PCI w/WakeOnLAN $79 AOpen FM56-ITU/2 ISA FaxModemVoice $69 AOpen FM56-PM PCI FaxMadsmvatce $49 AOpsn FM56-SM PCI FaxModsmvmcs $39 Hacker Card (Dale Recovery, Mulil-Scot) $35

1t79 PacificBIvd,, Vancouver, B.C. CONIPNERWORKSHOP

AcsrView 54e 15' 0.28mm $215 AcsrVmwG772 17' 0.25mm $350 AOC SE 15' 0.28mm $199 AOC 7Glr 17' 0.26mm $299 Viewsonic E771 17' 0.27mrn $305 ViewsonicE773 17' 0.25mm $365 Viewsonic G773 17' 0.26mm $375 Viewsonic GS771 17' 0.27mm $425 Viewsonic GF771 17' 0.24mm $505 Viewson 9 E790 19' 0 26rnm $489 Viewsonic E7908 19' 0.26mm Black $549 Viewsonic PS775 17' D.25mm AG $499 Viewsonic PF775 17' 0.25mm AG $469 Viewsonic PS790 19' 0.25mm $699 Viewsonic PF790 19' 0.25mm $589 Viewsonic PT795 19' 0.25mm $1039 Viewsonic G81 0 21' 0.25mm $115D Viewsonic P810 21 ' 0.25mm MPHS $1255 Viewsonic PT81521 0.25mm $1355 Viewsonic PT81321' 0.28mrn $1459 Viswsonic Pg I 7 21 ' 0.26mm TCO95 $2'l50 AOpan S3 Savaae4 16Mb AGP wlTVOul $95 ATI Xpert968Mb AGP $85 ATIXperl200D 32Mb AGP $145 ATI Rage Fury MAXX 64MBAGP $399 Asus V66DOGsforce 32Mb $319 AsusV58DO Deluxe Geforce 32MD $355 Asus V5800 Gsforce 32Mb DDR S355 S3 Savage4 Pro 16Mb AGP $79 SiS6326 OMb AG P $49 3Dfx Velocity 100OMBAGP $99 3Dfx Voodoo 3 2000 16Mb AGP $145 3Dfx Voodoo 3 3000 16Mb AG P $199 3DfxVoodoo 3 3500 16Mb AGP wl TV $299

•

5400RPM Hard Drive Quantum FicatLatl CX 20Gb Maxlor Diamond S.7Gb/10Gb Maxtor Diamond 20Gb 7200RPM Hard Drive Ouanlum Fireball KX 13Gb/20Gb Quantum Fireball KX 27Gb Maxtor 13Gb/20Gb ISM 34GXP 2DGD SCSI Adapter Tekram DC31 5Fast SCSI II PCI Tekram DC-390 UW SCSI PCI Adaptec AHA-2940UW PCI Adaptec AHA-2940U2W Kit PCI

$239 $159/175 $199 $225/299 $378 $198/269 $259 $59 $150 $299 $499

MicrosoftWindows 98 Second ED. $ 139 Microsoft Windows 2000 Prohessional $ 1 99 Microsoft Oflice 2000 Small Business ED. $299 Microsoft Oiiice 2000 Pro. ED. $499

cpo •

Website: INwlLntcw.corn E-mail:sales@lttcw.corn

• •

MiHenninm

http://www.aspert.corn Email: salesOaspert.corn

SPECIAL

lL.

4 0 O Sf

** Visitour web site to see the latest computer systems, equipments, BLcomputer parts.

MOInterest no P •

• '

•

RRMSPCNe SDRIM Msmsrr PANASONICtA4M FLOPPY DRIVE 48X CDROMDRIVE 4AOULTRAATAHARDDRIVE INTEGRATEDID8M AOP VIDEO 3D 328IT PCI SOUND S4KVeePCIDITN FIXMOONI N HOOWS P$2 KEYSOARD WINDOWS PS/2MOUSE ASPERTDESKTOP ATXCASE

4LINK10/180OTETHERNETCAIN

mndswsP$2 KWasuM LOGHECH28PS/2Mmms ASPWITMIDTOWERCA5$3NW Mulkmsd/4SlsumSpeaker

WEWS DNICNIO le' nts SVGAMOmlm( 5/N:AsP2K0384 AMDKsn455 AMDATHLONNe

l l

SUPER7 MOTHERSOARD AMD K48988W/3DNOW TECHNOLOGY

NNATHLONMowfteeNMFrsnlsldsnus NBITWJMBermtmamd m IIIEINXON 12N PCIN SCRAM Pmiasmu sIAiM$ Rspprodvs GNCDROMDINE 1300 ATAN 72NRPMMani Wive AWRAGENNY 1243$5 AOP CREAT(I/BASUVEVALUB

nt ' OAC for EEton(he

10.26 ULTRAATAN HARDDRIVE

IS USelise TNTRRtn AOP CHEATIVELIOENSONIO PCI120SOUND

USRSlkPCIVse MODEM WINDOWS 90 P$2 KEYBOARD

MULTIMEDIASPEAKER

FREEWIHDOWS 14 SECDG IWIUAL

sm:AsP2K03N

$699

PARTS

$ $ 249

OAeoXC

INTELCCNI TYAN Slml ADPEN APSIPHO EPOX MVP3G.5 GIGASYTE TIX

leos KTM

AOPEN AXIS/AXISC

ATI FURY 32M AGP ATI ALL IN BONER IN 11/32M ITI FURY MAXX 14H

silenus

~E CALL I CALL I CALL I CALL I

IFREEY N OVD

AopEN151 ove

CREATIVELAOIXENORE

OUANTUMKXIIG/140 ISM NG/206(tleerpm) Wo 240/278(t24lrpm)

AOPEH 52X

AGERIea/iex MIT4VMI411 CDROM ASUS 58X CREATIVELAD 121 PANASOHIC 481

TosHIDA41x(scsl)

KENW060 IIX C0ROM

Slt2 11 • 4 1105 $321

CREATIVELIOem2 PLEXTOR Ilm CORW YAHAMA8432 CORW

10$ $71

ail/le

AUREIL VORTEXI/06 SOI/NDSLASTErlLIVEVALUE

385 IN

SOUND SLASTBI UVEPErlnum IADTECmls 8PEIKsn

$138

1118

SRN

$51

08 APOINTFP41N4/lme

elm/218

ALTECIAN91NO ACNmil

Nlfle

YAMIIBanome

alee

BICROSOLUTION 4X4228(EXT)

1410

oeeemle

EPSON788/Ne

$811 NN / 111 • 548$788 1488 $141/188 $321/521

LEXHARK 211/41 LEXNARK1108/231

$1 • 5'/178'

OROTHER1240/INI SROTNER INNIRTI SROTNKR MP.RIC EPSOM448/Ne

MC SURU!IIRI TER 1311

4535

elm/311'

$151/'1111

sieerres 1S11/Ne

sml/Nl

13311481

ONSTIINiM 390/NS 010ITALDRIVE 5418/Ns TECMMI DITTOMAXMGIDE INT/EXT sm$321

SFAGATETAPESTCR TRI IO Imt SEAGATETAPESTOHTR1 28G

$EAGATETlsston YRI44G(sess 0/le 2.2Grsmsvaamdisk Dms(surf

1211

$411 1359 $338

1281/171

II • $38

INTI VIR04 NN WOROPERFECT 2NI MS WORK$UIT2m e

wlNDDw4RN• pno

$141 1118

OIIICKSCOK 0.0 PC ANYWHERE4.0 NO/ITCH SYSTEM WORKS

$340 $141 1181 1221 $128 $148

REOHATLINUX Ll ADOBE AC/IOSAT4.8 SIMPLYACCOVNTING 7.0 MY04 • . •

lrl • •

•

PN1

A•

A m•

• vc r \

E4mlPBBNWIf/No(mom133mtf meroomavm B

TOSH)BA

BfimmrCrn Nnam. I Lint Wmm umliemumANn,lAG.NUFTeimwmm

IBM NOTEBOOK

1imeuml tnl, lie, NXCNCU,lni Iumnl, immi, wmm mmmls JCU FNN 18IAA0,Nalomm, il rlsT 5urBBBLwme

EASY: 4 LOCAYIONS ye SSRV(CE YOUR PC.

K M CKMI'S

•

A I

Notel ooks

ASPERT SMARTBOOK

' NI • • R44ms 1

I •

SATISFACTION euAEANTEE SEWICE GUARANTEE' SBS MEMBER

EXPERIENCE PROFESSIONAL A+Mesa NGNE,MGPNsrvvornt+ Trained techniman ON STAFF

$849/lee

HPNNBI • II HP ITIC/lll HP 31N

• Compnter 70(ephony System rel: 733.DEED Pax: 737.1337

44145NWNW 4AGfemfmsmfIFU181MNBN/Nm

sale/see

1178 $118/118 528 • 1130 $180 115' 5181/set

ACER 129UT AFGA 1212U/P 0PSON N8U VISIONEER IINU VISIOHEER 74NU UNAX 2181U HPIRNC/1210C

OFFICE2810/PRO

251 218 188 IN 411

•Storeeensoement System - Sntsrprlses llansoomontSystem I - tniornst Sales Solnnon

FilsSSII LIFEBOOK

181/11

lee

HP 1218$ YAMAHA14244(DARE) PLEXTOR 1220

ISN1.16118G IOM ILRO/310(IIK) SEAGATESIIIRICUDA 0.16/1826 SEAGATECHEETAH8.1G/18.26 OVINTUM ITll4 IV • .10/ILRO FUJITSU I.IGHIG

see/as

• StorsKeepet POS System

elle/ale

SONY Nee/G208

Ne Ill Ses

NK PCMCIAMODEM AOPSN 4IK D/F/8 PCI AOPEH NK 0/F/Y 19A

148 158

SAMSUNG 8SIP/NISI

111 $55

USR 51KVN PCIMODEM

( CO ~ I VER HP 111 • I CORW HP 02mf 4X4X24 PANISOHIC8432 CORN

4AMSUNO lme/780NF

1141/110 $121 1148

OUAHTUM IAG FUJITSU • .40

117 •

$1.118 IR8$438 1518/548

MrTsuslsnl PROaalu

~CEL2liLR12 DRIVE

USR NKVoeDfp/YPCI LITCON 411

PANASOHIC EIII/SL70 MrTSUSISHI PLUSlef 72

$211 1171/181 lies/3311 11 • 11208 $121/288 1214/211

HAXTOR148/ 170 MAxTGR 13G/270P288) IIUANTUB 1$170

• ass/el • 1048/oee Nes/488 lese/ese

HECAlee/Eemr

2 I AE12 DRIVE

FUJITSU 136(7218rpm)

MY l bJLOIL Ases 11 DVD TO$H10Aex ovo

1108 9329

OT/GUEST GN/075 MAO XJ778T/FOTN NEC FE748/FK748

61,590 313 09

ASPERT e-Commerce

138111111 5458/481 lie • /313 $381/408

V/EWSOHICElse/PF771

MATROXearn DUALHEIDNAX 124 • /32 • ASU4usmc Osfsrss 240 Dslua Ill • $111 CREATIVELA0IHHIHILOTOR PRO

~EEL©lkKCPU Pill /550fem//13 CELEROHa13fieemee/113 AMlf ATHLONNefml 84M/128M/2NM SDRAM

VIEW40NIC 4771/Er/I

1148 3101 I\281321 1381

IDFX VO0D001 RN4 PCI

N4 •

lease 864!/$

Susiness SOLUTIONS

EI I 62E.

lese $285 I 3 08

lepx vooD00$ IN • 10M RDFXVOODOO3 3me

4141 151 129 N45 $155 $1R1 182 181

$ ggg9

Daomm mom Y ~O

ASU4 VN44 PURE 1RM ASUS VINO ULTRA IRM ATI RA6E FURY PRO Rln

115

8/N: ASP2K0301

AOD$218' INTELPBI600 PROCESSOR $1,1N H P02851CDRW NNLwl 5NImmn pnocEssoR $1, •Is HP NICCOLOR PRINTER A OD $249' NECASTelrMOWIOR A O D 5140' ensrraksts w/are(urnpumkass INTELCELERON 533PROCESSOR

Quantum 11181175 12181245

5/N:AsP2K9302

NIELCIERON4NPROCESSOR

~6 2XHEII PARD

GAIVX-41

12ml 180MHr SCRIM PANASONICIA IM FLOPPY OR(VE dXOVOROM 20GATA Nl7288RPM HARD DRIVE ATI RAGE120 FURY 32M CREATIVELIVEVALUE( FUJITSU4725PS/2 K/0 LOG(TECHPS/2MOUSE ISPERTMIDTOWER CASE

• ex cDRGM

sl,e48

AopENA/m3pRC GIGAOYTE0X-2me

INTELpnl518pnocEssoa

InlERNETWHEEL PS/2MOUSE UsaSIK PCIVeeMODEM MIDTOWER ATX CASE MULTIMEDIASTEREO SPEAKER NECAsle\r LRTMDNITOR 15 4.21 SVGAMONITOR LATED2411SPEAKER W/SUOWOOFER FREEN NOOWS slSECDSMmn/AL On LEXMMIK211Ime 4pl coLORPRINTER

sm:AsPRK0385 $ $ 898 $1,589

AOITOEI 2.8/OF4 A4US PRICE/24N

ATA 88 133MHZ MOTH ERDOARD

ITI 48113MHR MOTNERSAORD INTELCELERON ma P/IOCESSOR 44MPC 155HHR SO/Um PANASONICIAi FLOPPY DRIVE

ATA 66133MHZ MOTHERBOARD INTEL PIII550 PROCESSOR 64M SDRAM MEMORY PANASONIC 1.44 FLOPPY DRIVE 40X CDROINDRIVE 15G ULTRA ATA HARD DRIVE ATI RAGE 12016M AGP VIDEO SB ENSONIQ PCI128 SOUND USR 56KPCIV90 SIODEM WINDOWS 98 PS/2KEYBOARD INTERNET WHEEL MOUSE MIDTOWER ATX CASE 100W MULTIMEDIA SPEAKER 17' 0.27SVGA MONITOR FREEWIndowe00SEor LEXMARKZ11 Color Pdntor

Rl • • rrrr •

WE OFPEIb REPAIR UPGRADE MAINTENANCE NETVVOR(ONG SUPPORT INSTALLATION '

•

i 32M LAPTOP MEMORY i SGM LAPTOP MEM O R Y i S.GG LAPTOP HARD DR(YS ' tOG LAPTOP HARD OR(VE

, SERVICEuonrnLY SPECIAL. Tune Hp your system •

•

• I I

•

$11

lththloeoMpon t

8SS 8 179

6 319 6 41O

i i

e HANDS O N 0

Desktop video pmoessinB softwnm Continuedfrom page72 In6nity are new in this version. Each has agreat deal to olfer, and there is a lot to learn before you can truly master this suite to become aproficient eff ccts w izard.

• a

•

tw sw v a wv te e' iar uIv

z M

JJ si l g tlw)N)BIvB i16()BLS:

.aaaswumawa~

~ Q

With auto-backup, and 99 undo levels, there is very litic chanceyou'6 losework or sleep. The capture program includes sophisticated colour adjustment tools, emulating the hardware devices that video technicians use to calibrate tapes recorded on location or at other studios. Unless you have a camera or other source that generates colour bars for your recordings, unfortunately this won't be much use. The video editor's timeline display takes the whole screen, with Boating palettes, toolbars, scratch pad, trim and preview windows providing access to specific featurm and functions. Like Premiere, it takes some gening used to. The scratch pad's jog and shuttle controller emulates its real-world equivalent nicely. The

ability to scrubwould be even nicer.

'js~ e O'Jl i'

YER

a ii a

Video Editor includes a wide range of 2D and 3D transitions to use between scenes. There are lots of controls to ZMZMZiSsriawizzr &BSMMMtgisw make tine adjustments to the transitions, and like Premiere, you can preview the transition with the actual images. MediaShxfkysvideoaiiads library iaciadss avanietyof waysta traasiarm yourvideo. Each Another series of effects, called motion paths, superimpose hasmaisbiecmtiai samagsta customizethe agael one clip over another. An experienced Premiere editor could likely recreate the advanced effects, like cylinder and sphere, that you can simply select from the Media Studio menu in this program. You can create up to 99 tracks to superimpose more clips, although audio and video tracks can't be added independently. There are filters for both video and audio effects. Like Premiere, you must pre-render a scene to be able to prev view it. Unlike Premiere, you can set a specific quality — indudMMiwvup ing frame rate and size —for the previews. This can cut down the I • time you spend waiting for previews. To further speed up your • M taniw work, the editor can create "proxy filesy These are smaller (with wwwr reduced colour and kame rate) versions of your original «apgwwwe tures that are used to preview. When you create your final movie, MMwwus the original ffies are used. The editor's text module is a pleasure to use. Full frame and Q rvw ow superimposed titles, as weB asscrolling credits are created with g+ rwl in ease. The editor does have afi of the features to manipulate Q vw ivs images, text and sound. This means Video Paint, CG Infinity and Audio Editor are high-end luxury programs you might never use, or miss. CG Infinity is a vector-art program, with

'®I: 'icro

• Get Internet music in your palm • Portable, lightweight, digital audio playerwhich can store and playback MP3 files • CD quality music without skipping • Record and play voice messages • Informative LCD display • Weight only 99 gm with batteries • Available 32/64 MB version • Optional digital camera module

speci6c capabilities for creating andanimating objectsand text. Even its basic capabilities are beyond anything else in this MM'sVideoWava ii imerizce lookslike a high-tadt videoappgmcs review. Video Paint is used to paint on, and place effects on a scene, frame by frame. This technique is usually referred to as "roto-

RO DRIVE

• re

scopingy Theprospect of working frame bykame seemsdaunting and complmi, but once you' ve worked through the tutorial you' ll bc adding kaleidoscope effects and airbrushing out moun-

tains like apro. The macro recording capability reducessomeof the repetitive work Audio Editor afiows you to fine tune music, narration and dfects recordings. There is a variety of 6lters, most of which arc duplicates of those found in the video editor. They' re easier to use andadjust in this module. Media Studio can create AVI, QuickTime, RealMcdia and Microsoft streaming files.

8 ~ 4

PJ ceaowi gr ww

Also noted I did look at two other applications as a part of this review. Avid Cinema ($125) provides a great deal of guidance to beginning producers. An entire module is devoted to developing a storyboard, which you can use to plan a movie before you start shooting. The manual is filled with good beginner information, such as how to connect camcorders to computers. Cinema looks very attractive onscrmn, but can't trim accurately and other than a good list of transitions, there's not much you can do effects-wise. The title editor is very basic and there arc only three audio tracks. Avid is working on a new version, or a whole new application, that should appear within the next few months. Considering that this company's professional products have an excellent reputation, 1«t'shope it does a better job for consumers next time out. Ulcad's other video editing software Videogtudio (g90) has little to recommend it. There are actuagy two applications, Video Wizard and Video Studio. Understanding where on«

snzB BN+ v

vwsw

• High data transfer rate • Superior error recovery from scratched lfiscs • Read DVD format and afi CD formats • One-touch audio piay function

Vidmwava'scaatns Paiettss, like thisaaaiar tmt, appear aroundthevideo playbackwindaw,which keepsthe useriatsrtace simple.

1-877-DAYTEK-1 Z 2 9 S Z S

ends and the other starts has me confused. The user interface is pretty, but seems designed to confuse rather than help. There's good support for DV

and MPEG, but with only ID transitions (induding somenice 3D options), and only two audio tracks, its simplicity can be frustrating even for beginners. C3 Maariea Heilbronis iheaaihoi oi Mzsiwinywindows95/9B vicmzfiy aad a bio)act manager ai EziendMedia. Hareplies io email seat io maarter4heilbraa.cam.

Wab: http://www.daytek.ca E-ma(I: info(Mdaytek.ca

DAYTEff

znwlzro coMpANY

V anc ou ve r • T o r o n t o

www.cnwmcompvtss.cam vrtECOMPVIER pAPEn eC EnnlON APRIL IO

Co IIIPltSP PA PER ~

L'~

Tech Enterprise T ec h n o l o g y

S o l u t i o n s f o r S ma l l S u s i n e s s • Co n n e c t ing H o m e

Systems for collaboration, teamwork Teamwork is always animportant component for companies searching fora competitive advantage.Overthe past20 years,ithasbeenenhanced with increasingly adept email, messaging, and nowteam- andworkgroup-basedsoftware lnformagon systems 101

By Jacques Buweyer

All organizations tend to progress toward similar pmven information system (15) structures that support

'th the Internet, a

company's in-house

basi c manufacturing,service provision, sales and marketing, and human

team connectionscan be thrust outward to suppliers, cus-

resources functions. In

tomers, and clients to develop new ness.This ability is part of the e-business frenzysweeping companies big and smalL The Net changes everything

collaboration and teamwork systems.

In fact, with all the emphasis on e-business,some of the internal collaboration and teamwork opportunities being offered by good old-fashioned networhng systemsmay get unfairly ignored when an eyes are on Internet and intranet programs. For example. the next online revolution is targeting learning and problem solving—particularly the latter —thmugh various levels of collaboration and teamwork Think of team problem solving as the next Net frontier. But before we rushoff towards it, it is worth examining how information technology is organized and where collaboration and teamwork systems Bt in.

are an interestinguseof internet technology. poviding teams with some essential communications glue Takeforexample,Thoughtweu's QuickTeam Wsb site ONpyhww.qsicktsam,co rn), which allows users to set up free team sev-

ices, includinggroup calendars, discussions. Snd event tracking. The site can

accommodate asmanytearrVgroup users as you want and the first 25 MB of disk

space used isfree.

ales • eau •8

1. Mail and massaging:hasits roots ia older mail servicesandtelecomnnlnlcstlons.

2. Knowledgemansgeneau has its mots ia Sing, plus records management andarciving services. 3. Businessmhgigencu hasih motsin accounting andplanniag sevices. Then are callel collaboration services for two reasons, First, they pmvidecommon services used acmss ag the functions.In fash ifwe were to superimpose other common organizational dimensions, such as line of business (Chevy, Buick, Cadillac, and other divisions at Geaeral Continual on pageyy

E-smith server R gateway A Linux solution for small business At tbe end of the installation, assuming he Linux situa- can avoid learning about Linus, and concencompatible and sopportel hardware,you are trate on reaping its benc&ts. t ion toda y The e-smith server fir gateway is a cus- just minutes awayBorn using tbe server. It reminds me a lot of the Internet situation tomized version of the Red Hat distribution. boots into a text-based modSe, where you of about six yearsagrx At All of the fiexibility has been taken away. The are presented with various choices. It can be run in server only mode,which is that time, everyone had iastallation procedure scrubs the hard disk, ate ifyou already havea gateway.I heud of the Internet. and taltes it over completely. At the cnd of the appropri 'Ihe term "information pmcess, the computer is an internet gateway, a choseserverand gateway made, and then I highway" was already mail server, snd a Ble,Weband collaboration chose dedicated connection mode. B-smith overuseL Most people server. That's it. Nothing more. It can't be used will manage your internet connection, had opinions, one way to run other applications or for any other pur- regardless of whether it's high-speed and

pose.Thisenhances itspaformsnce and sta- delicated (as is mycase) or a dialup connecbiTity, but makes it impossible to evaluate tion with a 55.6Kbpsmodem. Next you assign a local IP number unlessyou're prepared to dedicate a computer (192.165.1.1 is suggested) and a local subnet to the job. The developershavesimpliged the standard mask (255.255.255.0). You can conggure the people wodd like to uy using it. but getting Unux installation by making decisions in server to provide DHCP services to the LAN, started isn't easy. I' ve found a Linux server advance.They have decided how to partition or not. Youcan assigna nameto theWebservwhich can be tbe IP address.There is a bit proust fmm asmagcompanyin Ottawathat the disk, how to organize directories, which er, is extremely useful, and makes it easy to get serve packages to install, and how to set per- more congguration work related to the nature Continuedonpsgs59 into LInun ln fact, it makes it so easy that you missions and security. or the other, but vey few hadactual aperienccwith the Internet, and even fewerhadInternet acmunts. Everyone has heard of Linux by now. Everyone seems to have an opinion. Many

e b-based ~ toot s , oken refensd to as team portals,

aitical special functions such astransportation or distribution. Aclcus the traditional functions are three key collaborationsystemsfsupport services thatare used in each functional arcs:

about how business isand will be done. But how do you use it to help make your organization an overall winner,

not just ane-business success?One key is

Free team Web portals

government

organizations,salesandmarketing may be absorbed into service provision, while other organizations might have

and more efifective ways of doing busi-

g W o rk

elhThoughtwam hah None.Team INeb portals ae aopping up 85 over the utah. In

akfitkm toOuhkTeam,thee huuhkphce gNpyheawquckpbm.con) fiom lotus, and ERoom getryhweveccemm) finm instincfive. Users of both services lsnp sewer apens for their teams. On the feeble front, then Is

AnyDay (tzqrjhwe.sardsymm).wis mhat cakmdar and event unchng, and Beeugwm (htqryhwav.senltkwecce). wtvch allowsuses to plan and manageevents on the Net (as long as ackvifies do not Include cofiecting donsxons, andror charging for sevhes fike ticketing and faxing). The most Important thing to nots is lhst these flea" lfihb pohais ofier basic team or eofiabora5on services at no charge, while makingmoney on optionalvalue-added sslvices, isl58.scale operstiohs, Iu uvough advetising. Hee h 8 list of feakses these free sites typically oNer. • a gathering place on the Webthat h

aocesslbie to 85 teammembers. • the ability to eustomhe the look and feel of a team site; • Nle shyhy to contlul who csn Uss Nle teanl site ahd its selvcex

• anda rangeofsimplesenr ices,suchas caIehdaing, shat featums, and event

planning. The description of services ofiered by

Thoughtware'sQuickTeamsite, for example. is veryimpressive: • Admin,Contact. Memhes: These tooh

Cenrfnurd enpage91

c TECH EMTERPRISE v Systemsfor oogaboralon, teamwork

In this article we' ll review how each of the «ofiaboration systems and services hasevolved and what new services they pmvide with a parCentral, Southern, etc„or regionsfor a provin- ticukw eye to online learning and team probcial minisny), the three collaboration system s lem solving. Finagy, it is worthwhile to underCommon Collaboration FeatUre S sta nd the underlying technical drivamong Overlspptnp gphems of Influence ers.The new collaboration services are bolstered by ever evolving networking capabilities and the huge available surplus of communication bandwidth. Communication «osts are dropping faster than computing It . el%tave«en svl costs. Fiber optics, sategites, routing . Wvvwr av nWnwv Real hardware and sophisticated multiJhsahae. . 4$%4u|jKu vv vlpsws plexingof radio and other frequen. covtvov tart Vvtwne wvruvv «y spectra now outpaces Moore's . uvu alla evvv dNxsNal law for CPD improvements (in . nnhn convvt vv uvvve docs . Ow pal iv lvvll IOllbsl% 1965, Intel co-founder Gordon . cDlwlÃ ckuaus ew Moore rightly predicted that the number of transistors on a chip would double every 18 months). Currently, communication bands«v f'» width more than doubles in capaciBI • Business lntetlvtnin~ - do«talon oriented ty every 12 to 14 months while the vw Y . w w tv' 1FS&If'I IM i ( u t• r. ' I i mt) i: > r priceremains thesame. Mtkist. Ntatl tk Massaging - core of cofiabora tton The result is that the underlynoted abovewould still appear in the ISstre«tore ing capacity of the communication backbecausetheircommon services,such asemailor bone continues to outpace usage. Red document management, are shared and critical Herring magazine estimated that as of the in theseorganizational a«sings as well. end of 1999, on average, less than half of the The second reason why they are called col- capacity of North America's communication laboration services is because they also provide backbone was being utilized. Indeed, despite critical linking or interface services. In account- the huge uptick in Internet use, Bed Herring ing (business intelligence), for example, think expectsthe usage per«entage to drop in the of the interf aces between order-entry and next two years as huge capacity increases work-in-process systems. Further, in a docu- continue to come online. ment management (or knowledge manageAs a rmult. networking software and the ment) example document archives created by myriad forms of «ommunication hardwareproduct delivery and fulfifiment may be later including personal digital assistants, modemutilized by warranty aad maintenance services. enabled notebooks, xDSL lines to desktops, Also, thesesystems foster collaboration by pro- wireless and ceUular phones, and sateUite-drivviding such group faciTities asshared databases, en networks —are trying to take advantage of discussion groups and online chat.plus other the capacity increasesand passcost savings to tools for direct collaboration. «lients and consumers. Many of these tools Continuedfrom page 76 Motors), or geographical boundaries (Northern,

Common mailand messaging services Merosea axananse 5.6

Outnt«browser, useseislestopnas. Ostusscri at.«sn. Saasssw.Iivsl, ovlr«siss,a«t, sr«inane,sst villi.

Java. Kerr,uasstu8$, cadi«ates, Iar noww.

PDAinput.

1st, wcs Illsil,

nie«nir Iuscslslsauesavwsalnap plus fans await isiNslsurpntna/era. tuava slsanns: ares ialnsnmlsswile Mtuai. MsExcesses,nslai. «csail trsvsviw. au tvse, xela bsisssiilsni tsva alki cuslnliallnl linn ud.sssanaee ssa. cseesvssoa1stcsnaiw, sssrunessa,astssplus: rema, dsisssss ianrai. Slwve sicanona shasnaw. soswlu, isus plus catsnsm, oasis Siswsateenforaiisct ctei, as«ness Vss. tyssas,xntv svssnvtn: sisw-svse ntysant'mtsreslsaass,wrasm: Wh. amen st «tssinssasvalsenetware; ti.z via«a

tsar«xDascssnsn», iass)

«en asiassiasrmnaa iwsi 3yeast (tss«e saaatrQnu, t9trt

Novell araupwtae SB nslwsiltosr.

assaiInasl.

nts. vei.

os«vus, asnaa. asia. Ort rssisaa false.

Yss.

wsannvwlr. 4.5 ncaa

sia Special ssatwas osisasssntaxassa,tel usaee sailnniul. ttsassctin us«assisa issssnn wla M'cisssii osis. taws ia-tzu,tats encavyislstisanr

tvevlsias bvlnein Wasnsvsais.

ss maoa

provide a rich set of potential services for

com panies, hoping to grasp the brass ring of knowledge teamwork and coUaboration. And

management or business intelligence have been quick to supply a whole host of new collaboration and teamwork services.

Mgdd:mailand massaging While workingforBell in the late '60s andagain in the early '70s, I can remember trying to bypasswaiting for the mail cart that came in the

morning andafternoon.Workingatthespeedof the mail mrt delivery system could be most vexing. Thus, it came as no surprise that the most popular service on the computer time-sharing system was IBM's venerable and caatankerous email and scheduling system, PROFS. Despite its eccentricitiis, PROFSeven beat the telephone becauseonecould not only deliver the 6nished work (usuafiy in some 6les, or posted, printed output) but alsosupply a quick explanatory message. There was no need to engage in telephone tag,and there was also a record of exactly when the work wassent for delivery. The «verexpanding email service hasbeen a key driverfor the a«ceptance of PC LANs (cheaper internal email, plus shared file/program services), and then the Web ( fee external email conne«tions to dients, customers, suppliers, etc.). The current technical drivers in the massaging arena are convergence to Internet Protocol (IP) and specialized packet deli very ofa broad range of media— text/data, audio, video, telephone, voice, and othersover the same wire. Thus it is worthwhile to pro6le what the state of the art is in MgtM services with particular emphasis on the throe m ajor ve n dors' off erings: Lo t us Notes/Domino RS, Microsoft Exchange 5.5, and Novdl Groupwise 5.5. Table I lists those features and some distinctive offerings from each mail massaging vendor.We could also easily have included software firom Netscape, Sendmail and half a dozen others, but have focused on the Big Three for thc sake of simplicity. If we follow trends in the massaging arena shown on Table I, three stand out. First, messaging has constantly cast the net wider. Early services werc proprietary and could not talk to each other. Now it is almost a requirement that a mail scrvicc not only supports Internet mail but talks to a wide range of other massaging services. In that respect, Novell leads the way with a universal inbox that accepts faxes, voice mail, and pager notes, along with traditional and Internet emaiL The Net has also had a democratizing effect: Internet email is so cheap (it's free with browser sofiware and Net access) that it is also used as the internal massaging service for many smaU- to medium-sized businesses. The same phenomenon may now be occurring in groupware and teamwork. The second trend, led by Lotus, is the increasing customization and programmability of both the interface and the services offered in an M&M system. From the outset, Notes has been adocument database,w ith either usersor experts adding sorting, searching, reconciling, and other features— in effeob developing applications around Notes' M&M services. Microsoft, with its Outlook client, set a high standard for default services— induding contacts, calendaring, and scheduling —that the other vendors have had to fallow. Now lotus is upping the ante by making Notes an Internet browser dient through its embedded Domino server. This means, with the addition of Mobile Notes, that Notes applications can run on any device that operates browser, induding person-

al digital assistants, such as cegphones and Palm or other handheldcom putingdevices. Groupware and collaboration services have also been pioneered by Lotus Notes, including such team features as discussion groups, shared files/documents, replication and reconciliation for semi-attached road warriors, like sale reps and other mobile field agents. The e group collaboration features mark the third trend, and are fast becoming the norm. In fact, the «ompetition on the Net is so 6erce that Lotushas had to produce a specially configured Domino engine, called QuickPlace, to compete in that rapidly evolving market. Teamworkand cogaboration extend beyond shared notes, calendars and schedules. AB the vendors, led by Microsoft and Lotus, have made it simpler to collaborate directly on documents (or versions of documents) including spreadsheets,databases, presentations, and text files. The next step, automated workfiow

and messaging, is already provided for. However this gets into the complex realm of team problem solving, such as creative design, insurance claim adjustment, or product warraniy and support services. Here the situations are more fluid and/or complex. Finally massaging is exploding in two areas. The first is the live, direct contact of chat and video meeting services. AO L I n stant Massaging, Micmsoft Net Meeting, ICQ Chat, and Lotus SameTime are examples of the diverseservices available.The second area of innovation is software agents—computer programs that act as agents For teams or individuals, searching the Net for information. making bids under set pre-conditions, or offering trades, etc. Financial markets have been using such agents for years, but now the Net has broadened the scope of this technology. Products,like Hewlett-Packard's eSpeak, are making intelligent agents part of teamwork and collaboration solutions.

KM: knowledge management My 6rst job was on the other side of the mail cart, taking documents to be 6led in ar«hives or sentto the micrographics department for photo reduction and storage on fiche. We had

a lot of colourful namesfor our Sing area: the Sepulcher, the Catacombs, and the King's Mail End in honor of Bvis Presley's "Return To Sender." To our surprise, Presley's refrain could dominate some of our days. as outgoing requests would easily outnumber incoming documents, especiafiy around the time of government hearings. or planning and budgeting. Even today, people tend to underestimate the value of good document and knowledge management. But in many cases.with mergers, acquisitions, and re-engineering layolfs, KM systems are the last resort for rganizational decision context and history. But of course, KM is much more than a bomb shelter against system disaster or merger and acquisition madness. KM has slowly evolved into a wider set of roles from its document management origins. Search and retri eval from archives has been a stapl«of document management. The plunging costs of hardware and more sophisticated software

rec apturingo

(especiafiy databaseand indexing technology) have brought more documents and fdes out of cabinets and microfiche and into online storage. It has abo brought wondrous increasesin functionality, as shown in Table 2. As one might imagine with such a rich set of services, it has become a daunting task to

define exactly what KM is; or more pointedly, Continued an page 80

• •

e I

•

ursus' • 56K dial-upaccess • Free 5NBpersonal website e Nosetupfee ' No hourlycharges • No primetimerestrictions ® Over2300 modem lines

150 hours per month

Flat monthlyfooofggg

LV eV ParsuaalPIII

~staff@intergate.ca

300 hours permonth

Flat monthlyfooofggg

~%i •

FateirePersoual •

•I •I

•

• High speed Internet access up to l.5 I4bps • 5 email addresses • 5 I48 personal website ' 5 hours of dial-up access • 2 dynamic IP addresses

•

• Icr

•

'lr

•

Fatwire is a newand exciting division of Internet Gateway,focusing solely on providing high-speed Internet access for your home. It's a 24/7 "always on" Internet connection that is muchfaster than regular dial-up.

Nonthly fee of

•

Please chechwww.fatwire.eet for the latest epdntes on Fatwire.

' •

d Surf fhBNBf nr'anooo reer fthonohllo.

~ info©fatwire.net

'Modem andtraffic charges noi included

• I

ttrtffrw.intergate.ca

•T

fe •

c••

• •

•

I I

•

' I

•

r:v

• 5 MB webstorage • Customdomain name (www.yourcompany.cor n) • 5 POPaccounts • Unlimited emaial l iases • No traffic charges

•

g-C~ IlltnrWet Iowa

i I

I I

n e me

• State-of-the-art server facilities ~ HighspeedOC3 backbone • Static IP addresses • No setup fee

N S mamz

•

Wakfaesr ~acme

• •

•

•Webdesignandhosting •Web-basedinventorymanagement • Shopping cart • Credit card transactions ~ Intranet andExtranet ~ Site promotions

•

• Includesall benefits of the INTRO WEB PAC KAGEbut with 15 MBwebstorage

•

I •

~R ~ «ee~~cmu •

~ corporate@intergate.ca

~ 56Kdial-up access • Up to 300 hrs/month usage • 10 MB web storage • 2 POPaccounts • No traffic charges Q.

I'I'f

Fatwire is anewdivision focusing on high-speedinternet access. NewFatwire Packageswith virtual server nowavailable starting at $64.50 permonth.

iurwaMa

0 C I

X I

Please checkwww.fatwire.net for the latest updates on Fatwire.

•I • I' • 'I •

•

• Includesall benefits of the BASI CPACKAGE plusacustom domain name(www.yourcompany.corn)

~ info@fatwire.net

Web Design and Development

•

Our team of graphics designers, marketing professionals, and programmers will partner with you to develop a successful online strategy. Call for a free consultation today!

~ ebnsiness®intergate.ca e

www.interLrate.ca

e I ~

•

c TECH ENTERPRISE w

• collaboration and instant massaging for plus teamcollaboration thmugh chat and verresolving check in/check out and other sion contml In addition, mom Imowledge management solution vendors are supplying Issllcn • divwre viewers for many standard docu- diSmcat viewers, indudingWeb-basedbmwsment types induding visual desigas snd er aoreasto their pmgrama This is imponant as wetrack the convergenceof MtiM, KM aud images;and • workgow and teamcoSaboration on docu- businessinteRigcnce syuems. ment assemblyand mmposition.

Systemsfor oogabomaon, teamwork

Gsnri nucd/mm pete 77 to determine what core funcrionsKM systems must pnuiide. Nonetheless,Fonester Research has degnedthebasic features it feels a KM system should have: • dassic document management fuactions. such ssarchivinglbsckup,catsloguing,and Sk businessInteagenoe vctrion contmh 'Ihe interesting trend here is the availabilky Working in the Ml archiwu at the King's Mail • tint searchand retrieval &om automatimSy of database features for indexing snd retrieval, End, Sing and refiling more than six dozes updated indexeslcataloguesof documents;

High Speed Fiber Optic Backbone

pills 01-Line: http: //lsp.lynx.net/apply

Dial Up Internet Access . No Setup Fee . No Prime-Time Restriction . Free Personal Web Page .33.6Kbps / K56 Flex /V.SO

L ite

Reeu l a r

$1 Opermone

$ 2 0 p er mon e

30 Hours

150 Hours

. 650 Setup Fee . No Prime-Time Restriction . Domain Hosting

I f Il

Business

6 04.63 8 . 1818 fax

Sio..

6 0 4. 6 3 8. 1 0 10

. K56 Flex / V.gg / ISDN

200 Hours

I oth Worlds,OneSolution. •

•

Buys On-Line

Merchant Service . Sell Your Preducts Online . Complete Inventory Control . User Friendly Preduct Management System . Secure Online Transactlen

tested.

From these trends and fomcssts, diverse models are made that may help pnaSct any number of usefiii things: how competitors are likely to ream to a new product or price

Join Lynxcity Now, the fastest Srowinl e-commerce community in town.

change, how manynew positionsarc going to be required in a aew divisioir, or how pmf-

Introductory Offer as low as850pw

w.l y nxcltyicorn/slenup

professio i

Thinkof the Sow of data &om accounting, manufacnsing, and other aspectsof businms, down thmugh the various stages. Not only doesthe data get regned, with ermrscorrectnt and simple consolidations made, it is also transformed into actionable informationtrends and patternsare obseivrzk defined and

. Mess Media Preduct Prernetlen

II I I I a-Liae: $.

variations on accounting for dediaing capital ross hardly conjured up the imageofbmdness integigence. Instead, we envisioned deems of accounting devils dancing on the head of a pin. But accounting, planning, dcdrion support and agthe other activitiessurrounding BI have undergone a revolution — especially in the late'90s. Bl indudes aS those pmcesses thatsupport planning, pmblemsolving, anddmtsion making. Most Sl components and systemshmm their origins in Snance and accounting, although these are stmng inSucnces &om database mansgemmt systems and management science. Thc following are key components of Sh 1. Database management: underlying data store for operational systemslihe imantory, payablesand general ledger. 2.Datadeaaing,transferend loading aggregation, validation andlor movement of data to marts andwarehouses. K Data marts and warehouses intermmSate store sndaccesspoints of data consolidated &om operational systems. 6.Database query and rctrievah basicaccess thmugh data mats and warehouses, and even to original databases. 5. Data reporting and visuaSzetiom increasingly innovative ways of reporting, that indude exceptions, alerts, cmss-tabs, and summary plots. 6. Data mining:exploration, analysisaud dassi6iation of data using several automated statistical and arti6cial inteSigence techniques. 7. Data analysis and intnprctatiom analysis usingdatamining andoriginal data to identii'y patternsand trends. 8. Planning simulation and modelins taking information fiom steps3, 6, and 7for deriving and testing predictivemmlels. 9. Dcdsion optimization and verigcetioru taking information fiom steps3, 6, 7, snd 8 and doingwhat iflwhat's besttesta

Des n + E-Commerce •

•

itable an organization will be at a particular point in the future. Sut do not think of the Sow as an imerted

pyramid to some isolated top ciecutive echelon. Rather, in most modern organizations, decision making and pmblem solving are being pushedout to the taskgmups and centres of responsibility. Sothe d ~ Sow is also outward st many stages;hence the growing interest in enterpris informatioa portals. These are refinements of intranet systems that allow orgsrrizsrions to tsp into the various

stagesof BI processing and make the relevant data available to gmups aad individuals who need it, The trick is topresent the right data in a modifi ed browserformat thatis msyto use snd can be customized to the user's sstis&ctloll.

s ma l l s es • 8 3 8 n o w o s t .

I n f o© ly nx . net

Dow n t o w n v a n c o u v e r

S .c. c a n ad a

v ez 1 u e

Hummingbird's Enterprise Information Ponal (Eip) is an example of a BI system.The

< TECH E NTERPRISE u

kcy insight from BI is not just to make any data available anywhere. any time to anyone (the so-caUed Web mantra), but to make relevant information and tools accessible to authorized teams in formats and quantitics that they can use to make robust decisions or to salve problems quiddy. Bl, after much cost and anguish, is starting to deliver these capab ilities; a n d po r tal s o lutions, l i ke

Hummingbird's, are akey ingredient.

port such collaboration features as version contml, document sharing, output to team members, and database-controlled shared objects and worhpaces. Even more important to small businessesand individual devdopcrs, many software companies are giving away either time-limited (30 to 60 days, typically) trial versions of their programs, or free versions of their standalone software, charging only for the sharecLcollaborative versions of the application. In the Bl fteld. check out free downloads from Brio and Seagate; in

completely

Common threads If you carefully consider MsrM, KM, and BI KM, check out keebies from Hummingbird systems,you'll seeseveral common threads. and Lotus; and in M 8I M, everybody knows Among ag information technology systems about the freeware from ICQ. Microsoft, there are tmnds towards standard features: the Gul browser interface for ease of learning

Netscape, RealNetworks and many others.

IS-Information System Structure

Coilnboragon and teamwork summary

vhs casahsrauonsystems- NaN, un, st

MaM • Nsaa umesovasdse St.aesissss Merssaias Iosseavsat ra l esiasaca

Just btzause collaboration features are beginning to show up in a consistent fashion across software, do not presume everything ispeachy. The competition is becoming downright vicious. This situation could yet spin out of control, like the browserwars between Micmsoft and Netscape, or the Java wars betwc«n Microsoft and Sun. In turn, this could set back

massagingand groupware software, delaying a aumber of pending collaborative standards, such as XML/XMI, XMUXSL, LDAP2, just to name three that are still awaiting approval.

Second, maintaining ahealthy, working «ol-

tluee-tier architecture for reliability, performance and mlaptability; and user customization

though pmperty scmngsestablished on initial load and/or setdynamicagywith maao saipts

laborativc environment is a tough challenge. Remember the rule: good collaborative tools are a necessary but not a sufgcient condition to ensure good teamwork practices. So the huge surplus of communication bandwidth coupled with rapid innovation on the internet and a whole host of networkml devices like pagers, ceUphones, and other wired "smart" devices will present unimagined

•

opportunities for teamwork and cogabora-

tion. Won't it be interesting when we discover

hter. But now the comnmn set of collaboration

that was thceasypart. The rnd challenge will featuresarea utingtoappear~ chance orby be to create a social envimnment conducive to design-in MfkM, KM, and BI software systems. sustainwl co-operation. 0 For cmunple, Microsoft Pmjcct 2000 and Primavwa Planner ase much more attractive JacqaesSu/vsyw is a cwnuhsnt amlwriier; tell himii

•

• •

•

pmjea managementtoolsbecause they sup- Iu madeIhatssmat htipy/wnw.iaisramp.neil-ibsuw.

Hillcnnium Special

Document managmentto knowledge management: Ehe evolution of services

Full Features Web Hosting Service For ONLY $5/month r

, Register'Nraw

Oocumwiiera/M89/access 1960 Ioncw: AulomaiedcaisiepmmIw acosssinio fiu/fein archives. 1960 Io nou: Tspabackup18data and8/sieIm Iur recovery.

1970 tshow: Imraask/9percentageof documents shred onhardSskfor supwier

•

ssalch, swi, sizl mt/isval 88psblfiilss. Fast, Isimbl8, amdifnble nhli8 . '

nuddsgonhugedatabasesaad smhivss. 1980 to asw: Iawmslabiy ssphisdcaied Iexi Iadexop ior m/ukw search/access.

1990 toaee: Automatic docummi contentclassificaikmasdwsss-refereaciap. 1950 Io aow: Output and reports tmmacceuaiiad md ether business systems.

1960 tsaew: Increasiadps/cearadeof wihsn documents donesacomputer. 1970 to mol siuepdnts,Imsdes,shddssibnwwk dern onwwkstadoas/PCs. 1980 ta seve PCfar Idea/document creadea fmm templates ssd other Seu/CSS.

1990 toasni Incrmsihpeaseof ersci ideacapturewdhelscirenic whbeboards, dkisfiensadvcics recegaiiion, resi imageImhs/er sic, owsmkmfdhsbminsiioa

1950 18acw: Ouipui 18fiis fcr cosscfidabon,fa/masind scdpriafiap.

, and get all these feaiufes:

• www.yourname.corn i.nel, .org or .cai • 20 MB of Web Storage • 20 youlyourname.cornEmail A ccounts • 20 Configurable Email Forward • Email Autoresponders • Unlimited Email Alias • Unlimited Traffic/Hits/Updates • Unlimited FTP Access • Detail Site Statistic • 24/7 Access To Web Content • Web-based Account Control Panel • Ujirafasi Fibre Optic Backbone • One-time Setup Fee: $15 • Pre-pay Period: 12 months 'usg70 rag/simianfaa h nquimd by ktkvNic for .corn, .am, .ag demain namemg/srotcn.

1960 18aou: Ouipsi aver heiwwk Iw dist/ibuboa in files or pdaiiad. 1970 Ia nue: More diversedireCtOutput fax, wasil. imafie, nfice, video,Wsb, 1980 Io soo; occumeiii amtmn, 18/msi sad delivery a%ambleddynamically. Oscaul881sh8/hlg

dollarhost

1960 Ionweiywskmcaahoi aaddocument sharing,check w/I/check In. 1970 10 hoe:Ohhmce codabef8808owf 88teslks81mw Imw Cssls. 1980 lo now: collanmfieh by teamcontent aanoiafieh, Is/o/maiiinp aad refii.

info©doilafhost.corn - www.doliarhost.corn - 604.608.68('78

1980 ionsw: Mulbplsviews8/uhaldf cpfiwn embeshared, musd, asdmsud, whfia sbhsIshstmtly clngag evu ssfwwkstzmi Ietsfisukl ezpwkncs. •

wstw . ~

as.c om THE COMPUTER PAPER 0C EDITION APRIL2000 Bfi

PAPER l~

Platform News Win dows • Pa lm • Emer gi n g Tre nd s

M a c in tos h • L i n u x •

Exploring Windows 2000 The heir to the NTmantle is a significant product, one Microsoft has bet a largepart of its future on. Our first hands-on look atthe productrevealsconsiderablestrengths— ata cost

Apple unveils graphite iBook KYO-AFPIe Computer Ine. chal execuSve oucer Steve Jobs unveled new iBook consumer po rtable computers. Poweraooka and the latest range of Power Mac G4s during his keynote pssnnarkm at the MacWorld Expo in Tokyo in February.

Individual users and

businesses arc going to f the three new Windows 2000 oper-

•

have to sharpen their pcndls to see if Windows 2000

•

sting system programs—Server, I

Pm makes cents (and sense).

III ~

New hvel ot robustness Despite four years of

Advanced Server, and th c n ew

Professional Desktop—it appears that the latter may be the most attractive. Windows 2000

Pro's improvements in speak reliability and usability arc less tbrcatenel by the cost of 29

migion lines of newcade. Windows 8000 Pmtessionsl Desktop fram: Mlcrcssil kgpihwmmicrssclLccm /wiadews2000/ Skml prknw$440,$240 (Nndowsgs upgrade), $140gfl 3.51 or4.0 upgrade) Cremez uphie ciTsnsursNT4.0 ma baserrrthktNT,sssllily amlpsrlsrmancsai a higherprke. Fms:Muchdoserte what NT4.0 shouldhave been wiik Windows98 emblliiy.

Cans:0khrssiiwareandhardware may nei wek (checkII cul). Mereaqwaslwi. Crsrallratag:4 cst of5 Serverbased features, such as Active

Directory

Services (ADS), Windows

, Management Services, C OM+-based Application Services and the new-look Micmmft Management Console will make Windows 2000 Server upgrades and operation a much more challengbtg task

But even so, Microsoft presents dednop users with a trad» ofE the street price of

• i.~

development, 29 migion linesof new code and the many enhancenents and changes. Windows 2000 is not strictly speaking a new

OS. It is built from the i

foun dation of NT — the Microsoft OS with the woo%a best reputation for rdiaWindows 2000 Pro is about four times bility and robustness. However,even that reputation may bc Windows 98 (although upgrades from Windows 98 are about $240). So the trade olf somewhat light, as Microsoft itself is quoting appears to be better performance for a higher ZDNet results of 2.5 days between reboots for OS price and possibly CPU and memory W indows 95, 5.1 days bctwecn r«boots for upgrades. And at $440, Windows 2000 Pro Windows NT 4.0. Meanwhile, the new can sometimes cost as much as the hardware Windows 2000, undergoing ZDNet's stress it is instal)ed on. bendunarks, had yet to fail in 90 days of testHowever, for many organizations —IBM, ing, acconling to Micmsol't Canada general manager Simon Witts, when Windows 2000 Dell, and EDS Systemhouse—the attraction of a more mbust and reliable desktop is more wai ofgchlly launched in mid-February. If than worth the extra price. IBM, For example, these testscarry through, Microsoft will finalwil lbedeployingm orcthan 300,000 copiesof ly have a dmktop OS that can start to match Wiadows 2000, making it one of the largest Linuxaad OS/2lorrobustperformance. sites for Microsoft's newest desktop OS. Continued on page 85

The thee new iaook modeh each come with 64 MB of memory and a 0 GB hed dme, while the graphkecoloured iaook Special Eduon includes a faster 366 MHz PowerPC G3 pmcessor. Tbe igook SE will cost US$1,799, while the slower tangerine and biuebeny models are

Prtced mUsgt,S99. Ihe iaook has been a big kit with consumers, studems snd educators, and we want to make it even better. said Jobs. Ihe new Iaook Speeal

Eduon h themost elegant iaookever. A mer atmedia snd eeafivs ~

,th e

mes prawn/ulPowearxmnowocnlahs PowePC 63 Processora running at speeds of up to 500

MHz. caberieakres indude10bourn ofbattey us.

Anticipating Linux 2.4 and KDE 2.0 her the rather

works-in-progress—the construction site for the next general release. in the corporate world of software developpment t i me betwinn Linux 2.0 and ment xxpmmental releasesare hidden behind a 2.2, Linus Torvalds wall of secrecy, but Linux is open source and promised s horter even the latestexpeimcntal kernds are available development ryder to anyone who wants to try them out —anyone

lenyhy devcl-

benvesn major kernel wiging toput up with bugsand other degcien-

course, that cvcry single bug hasbeen spotted and removed,but theobvious ones have beeo excised. The 23 experimental rates is almost nearing its end. Fmm this will emerge, very soon, the 2.4 general series. As bugsare spotted and upgradesare made to the general rdcsse, it will cvolvc with sub-releases —such as 2.4.l, 2.4.6, 2.4. I I ... you kninv thc drilL And ai soon ss the 2X general series is released, a ncw 25 espeimental series will

cies. Nobody runs these rdcases on production" machines—workstations or serves that have to stay up and running to perform cridcal functions. Many Linus vets run experimental bqpn.Thus theLhux kernelkeepsevolving. releasesin a separate partition to keep abreastof Keep in mind that linux kernd numbering new developments. or to mntributc feedback m ' usuallybees norchtionship to thenmnbering schemesused by Linux packagera Red Hat tbe kenr) devdopment teens Once an experimental vs(ease has been Linux 5.1, for instance, is based on thc Linux First a word about re)ease numbering:

releases. True to his w ord, Linux 2.4 i s almost upon us. Justas Linux 2.2 introduced major improvements over 2.0, 2.4 pmmises err n greater steps forward for the Linux operating system.

Linux kernel releasescome in two types of series—even-numbered and odd-nmnbercd.

declared stable, and the kernel development 22 kemeL Hence it is inconect to sdk about team hasme its major goals, sometouchups Linux 5. I when you actually mesc Bel Hat 6.1.

Now, on to the new features of Linux 24L Tbe odd-numbcrcd series, such as 2.3 and and deanups are done to the rdease and it is sub-series re)easessuch as 23.54, are calhd intmduced as a stable even-series release, As always,with thesekernel updates, myspeGmrinued enpage85 devdoper,orexperimental,rdcares.Theyare reuly for grmcral usc. This docs not mom, of

two built-m FimWire puris, and Apph's Final Cut Pm 1 8 vktaoodibng soitwee. Prhes for randem conligwsfhns-with a 400 MHz nocessor and 64 MB ot SCRAM-start at about US$2.499. "The new Powergook is the best tool in the world for creasve pmiessionals," said Jobs. 'For

example, with Final Cut Pro video-edung softwes, it'8 the ulsmate mobile movie studio." Apple' k Power Mac G4 fine now kas ~ nmmng at 400, 450, end 500 MHz. AI of gw new mooch-iBcrsm, ~ snd 6 4 s- eLo sup. port Apple's A'rport wimkns netoking schecn. Of parkcular inteest to his Japanese audience, Jobs ~ that the forthcomin Mac OS X

wtl hclude taghquality Japanesetunis, svough an stpeenam with Japanese font developer Oainippon Saeen M~ Co Ltd . The Mac fonts es based onOainippon's Hksginofont. "Capturing tns beauty snd rtchness ol the

Japanese language and ken)i caractes has alwaysbeen beyond sw capsbillses ol personal computem." said Jobs "Now, with premium

quality fontsand the tegmt chamcter sets ever, Msc OS X wig make hlgivquality publishing a

reality h Japan tor as ~ and grat-time users sk1ie."

, pm fessionah

«P L A T FORM N EWS o

AntlclpnllnO Unux EA andKDE 9.0 comes to Eruition, but the hooks have been Conrinued from page 82 planted in the kernel. cial thanks go to JoePranevich. Joehasbecome Parallel port and infiured connectivity supthecommunity spokesperson forkerneldevel- porthave been improved in the 2.4 kerneL opment news. What follows is a summary of

Enhanced parallel support using UDMA, for faster input/output, is now supportml.

those who run Web servers on Linux. A new ready —there are no artificial marketing deadkernel Web daemon, khttpd, can process lines to meet—soexpect it when it arrhms. The HTI'P requests without having to communi- signs indicate a potential release by spring. By cate with any server, such as Apache. It is not designed to replace Apache, but to pmvide

the thne this column hits print, release should

be imminent if it hasn't already happened. extremdy rapid delivery of static Web pages. It usually takes the packagers a kw months Support for speech synthesizer cards, which This will make Linux-powered Web sites even to incorporate the newkernel in their distribuday rom/StorieS/I5038.himi). beganinsome later editions ofthe 2.2 kernel, snappier than they are currently. tions. Unfortunately it looks as if Debian has been enhanced. Likewtw, there is additionWhen will all this be availablel The kernel GNU/Liaux will only just be getting amund to Entetprteo enhancements alsupport forsound,TV and radiocards. development team doesn't release to even releasing the 2.2 kernel by the time 2.4 is ready. Although it doesn't a/fe«t home users, there Linux 2A offers a significant new feature for numbers until they think everything is Continued onpage SS some of the new kernel features (for a full, detailml report, see Joe's report at hap://Saorio

were some restrictions in Linux 2.2 that have

hindered the incorporation of Linux into enterprise (read "big business") systems.

71$-SSSS

Previous versions of Linux restricted the num-

berof simultaneously executing processes as wellasthe number ofunique users on a sys-

faX

m um numberof users to approximately 4.2 million. This, along with improvements in the

00 4 713-8539

email nextgen©axion.net Mon-Frl 10:30amd:00pm

tem. Linux 2.4 provides a scalable, configurable process limit and increases the maxi-

•

Sat

VISA Leasing 4 finnncino Aveaabie.

;-W5-13,3, %esg'Birt)ttdWW)r,

10:3 0am-5:30pm . ")/anCONVEr, BX. V5Y: 1P4.

Linux schedular e/Eciency, allows Linux to better handle large numbers of concurrent

processes, such as you would get when running a large-scale database doing large numbers of online transactions. Likewise, on a machine that can handle it, Linux 2A «an utilize more than 4 GB of RAM, more than 16 Ethernet cards. more than IO

IDE controllers, and multiple IO-APICs (advanced programmable interrupt controllers). As always, the number of supported hardware device drivers has increased significantlyfmm previous releases. On the multiple-CPU side of things, the Linux2.4 subsystems have been optimized for eight or more processors. Look out Vtrindows I4T, or 2000, or whatever your name is this week —the new kid on the block is on a tear.

If you' re looking ahead towards deployment of the Intel Merced IA64, 64-bit processor, rest assured Unux 2.4 will be one of the fitvt operating systemsavailable for the new chip. Intel itself has been using Linux for testing the processor, and the kernel development team is already familiar with the 64-bit architectures of the Compaq Alpha and SunSparc64 processors. And, of course, Linux will be supported by the new Crusoe chipset from Transmeta. After all, Linus Torvalds works for Transmeta. Linux

on the Crusoe has already been publicly demonstrated. plii9 'ii Plat/i UOEI FlreWire support

Linux 2.4 offersimproved support for Plug 'n' Play devices. Previous releasessupported Plug 'n' Play devices through a user-mode utility, but Linux 2.4 allows these devices to be used

during the boot process and configuration of the devices is now done automatically. The new kernel also supports l20 (intelligent input/output), a super-set of PCL With these

two changes, Unux 2.4 supports many additional pieces ol PC hardware.

The long-awaited support for USB (universal serial bus) has arrived. Linux support for USB devices is still in its early stages, but the

2.4kernel supports a large number of USB devic es,induding keyboards,m iceand speakers. USBsupport will continue to improve and evolve during the development cyde of 2.4. Equally important to power users, FireWire supporthasbeen added to thekemeL FireWire, which is steadgy growing in popularity, isan option for many high-bandwidth devices. Other Im pmvemenle Oa a small, experimental scale, support is beiag developed for "WinModems" or "softmodems." It will be a while yet before this

: ADPsnintel IBIOChifsst M/beard 32 MBSDRAMPCTN 6.4GBUltra DMA66 T.04 MB floppy - aax CD-ROM Wirdowi Ksrbssrri T6kit PGSossdCsiri 4MB 3DAGPVideo Accelerator I 40 WMultimedia StereoSpeakers T6 ATXTower Case

Celeron 4N $549 Celeron 433/466 $559569 Celeran 5N/ S33 $589/645

Svper7 100MHzMatsooic M/0 32 MB PC100 DIMM 6AGB Hard Driive I 40 Watt Speakers BM AGP MPSGVideo 44x CD-ROM / I A4MaFiofp Windows enhanced Keyboard 56K V 90 Modem /Tower Case

AMD 56Bl5N/ S33 SS29/S79 AMO66.II SSB Call IBM333/4N $49S /515 Pentlum 233MMX $ 505

Gipktt e6VXE+/SVX7+ PO33 ATA66 GiOtbyte 5AXSuper 7ATA66 64MBSDRAMPC100 ii 1060 Hard Dnve

I A4 MBFloppy Drive Windows98Keyboard

56K Iat.V90 PCIFax Modem

Crystal PCISoundCardw/wsvetsble 3D ProAGPBMBVideo Accelerator 44x CD-ROM /Amplified Speakers 17" Moaitar Indusive/Tower Case

OneMonth Freeinternet P48 SN/SSN400$1179/121%1149 P-lg 6SB/7 N $14 65/1609 P-HI 733/750 $17 69/1039 K64N39) SN/ 533 $91 5/959 K6 ll(SD) 5SO Call IntelCeleran433/466 $945/955 Intel CeleronSBN N3 $979/1019

Asus KTMSist A 200MHz FSB ATA66,2 USB,2 SsraB, I Parallel Port 64 MB PC100 I 0.060 Hard Drive 48z CD-ROM ,ii

StereoSpeaks/0

Windows 98 Keyboard

TA4 MBPanasooic Floppy ATI RagePro 3D, BMIL AGP

AurealVortexAdvsntageSVS/card T9" TowerCasew/300W0/soppiy Moosew/pad Athlon Ne/650 $1049/1089 Athlon 700/750 $1159/9199 Athlon 800/050

$1 569/1N9

Intel CPU PacknOe AMD K6 3D CPUPackaOe Gioaorte Socket 370 ATioaMHr M/0 Masonictvorrt tmasnz Ma 22MBPCtooSDRAM BMBAGPVideo, 22MBIDRAM Celeron 40N43 3 516 5/200Oe BoardPOtovaa 66XVao Modem Celer on 466/500/3335200/315/375 K6-8 (SO) 500/S33 $255/305 +trt trSututm Caa0nr tr FOtrundree K6-RI QD) 550 Call

Azuz PIC2000i020 Oiarn ATA66I 33F60 Aios PSAATX I 00MHr M/0 lor K6 0 'l28 MB SDRAMPCT00 20.060 Hard Drive Asus SOX CD ROM

Windows 98Keyboard 56KV90 Fax/Modem T.44 MB Panasonic Flappy ATI Xpert2000, Rage 128, 32MB

MultimediaSpeakersw/ Subwoolsr Creative labs Sound Starter PCI-128 19" AIX Tower Casew/300W0/ivpfiy L09aech PS/2 Mouse

OneMonth FreeInternet MI SBNSSNSN $130NISN/taN P-NI650/ 7N $ 1569I1715 P-NI 733/ 750 $1869/1949 K6-N (SD)SN/ 533 59SB/1009 K6-NISD)550 Call IntelCeleron 433/466 $1105/11N 149/'l189 Intel Celeron SN/533 $1

With new syagerrt:onl)I;

veoriows902mi 66CDB.Mated Work Swte 00

i.; , , , . . . . . .$13

co/sfWeri periectsvite.2000Otts $3

--------CRERRRt---. Fviiuuls/13/t760ATA6ri ...4161/170/100 Wo UOM Ai 02/is/20 2M00veer Strsites/206 mailu 10/I20$22 tezzifm . Stmntsoasam msilsi ttrtt/20720mna tuiei .. Stmnmom laM2006eevsssm 7200afm tuiri .Qss/csa tt.i20 later fisefr Drive .......... . ... 300 2ip Oaw100/260M01st .... . . . . ..1st/t60

Critics Smw/oigsbrreATisa Miu M0..... 5203 CamaOIWiv/aetmAT Irauni Nl . 6220000 csiusn 600w/oissbrlr ATioo Mo Ba 0... 6260 Pisaum-ai600w/oigsbylem.a .......... 0000 firn/em.ai560w/Giostrtr Ma .......... 1000 Pimfvm.oi600 w/oiostrie M.a .......... 5520 rvmfumMt Mtsx w/ super7Mx....... Stee AM0 z6 ii60000i w/Inmr 7Mx..., .., ..Stra Amo x6 ii 62300i w/tnmrr M.s......... 1220 AMOZ6 i 55090) w/t amil M 0...... . . . . Cell AM0 Aihiosaaal660/200w/ M.a.. 6009/020/600 Ctris Ma333/400......... . . . . . .. 6100/106

-;„--------- CI55%----------0/0/ i6/32M 60012 pin...... . . . . . . . . eaa 32/60 I 120M60INM ....... . . . . . . . . . .Call

KT0032lsa/izs/256msoiiam .......Csa

-------- CERRII

F-------

Aee rts-first 2000 .......... . ...Stanzta AwsP200Aix/000AT Slot i ...... Atauteo

Atn are Isun I stoa / sfs .Stisiisz/zm/zm Aun VIAChipist M/asfor r-iii / Csisam ....Call svfrrl's ATtrt / Giosartr ATA66 .... 406/Its tvprir's ATX fx m tot 3 /Assi PSA ....Stze/126 •

•

tkvois Seruuss ssr lairs Snr......566/00/60 Tashem an I arer Sor/ Aiei 62r..... 370/60/60 casern I 0Weumk sseesvmuezr 366/00/00 TsikibsSar tmi I Pioneer26r SCSI ....Stze/toa

Caen tsar I rsm ska / I/mvu ............Call

Cmsaw/ HewlettPsdisie CORWIDE.......Caa 000 itorieor) Pkmeu/Aofea .......6100H60 0VDAOMTsrmm sr / te sr ........,STM/020

SissM0 lamami ....... . . . . . . . . . . . .000/00 Ati aaaeiic 4M/ sm,A0P .......... . .. 30750 Ati Zpra 00 iieet fmf 00 iistr 120 Aof Nl „600/00 At/ Xfrii i20AGPtnasAGP ...,.... . . . . .5110 ATi Xsen after AGP SM ......... . . . . . . ...100 AT/zpsntmoaef2X3?Meaatst20 ......500 Ati RageFury 32M0AGI' w/TVOUT.........Stre tmdiaTHT2Yarns ism Stsuttm ...... 306/tzs msereee00T6 IS/32IA Aaf ....... ..Stm/220 sttsvsosSAGP32M0 ........ . . . . . . ...Site Graphicsa/aster airs THT2Value32M .......6160 tlsaiih iii Savage4514032M0Aof...... ...ST to twain/it SIS032M0K/trad ... . . . . . . ..Stao Vipu iitieo32M0Sulk52Ssvi aetssaSZA... 4200 auo 02000M64/Tni2 uilia nse ...... Atlsnee

soundcard t60it / pci.......... . . ...St a/22 Oesare tannic Kiet m ........ . . ... 333 soundsnnu fcl i20 /Urs valueoitilai 647/70 Diamond Maailsr 60000 30, Pcl ........ 400 tssstro 60 600/20i os with rv/mmo/ro 000/SZ

Airer isiaies Actss-2iielsia /Arsis ..100/taa Mllilimuas0ssui tlriesae tpmtu trave ..100

Awrerrumzssooafveztm .......,....Qae

----------- CiEERS---------Aoc is' I ir' i0.2000i......... . ..1170/zla frovirwis'ii r ' / i s ' . . . . . ..Stm/Zm/000 tamnme16 Otini/ir Dtssi, . ...stas/000 Aoi it sr / ii'vf I is'666 ... 4260/200/020 mao I 7' x/700TI2600) / xl7006 I.2600) ..Cell sssisnir it' tiei.tr/i e'Stso.26 .0310/600 Sonyit' tiso/ir' B00 ........ . ...6020/600 assistit'2000 I tt' TIOP,....... $2iaats Vieruok 1 ofstiui ..... . . . . . . . . . . . . ..CaN

This MOSBt33'O Sgaedal ~ Book pC Bate Bone System indudes Case, 6-370 IWB, Onboard Video. Sound, Modem, Network, TV~et FloppyDrive 6 52X CD-ROM

Metworkirle products also'aveannie;

Corporate ClientsWekome.

INhrvver leiavrmiivE4lsrosooemevl..rmmsvrurlv~

Cirsars alVATnT2Uilis 32M Aor ......, ..5200 tisms HolywoodOeroeei Care...,..... . ...Btzs totiimh tze.Ca sern/Shsip PCCamera .. 100/Cae Ati TVWoe/si PCI/TVTuner w/rm ISA ...000/tv a il"

areitrsa620FI 620PT........... . ..Stzzizaa' Armtraa620U/620UT.......... . ...Stat/teo' smeei/tsmrvettsssrfristei ....... . . . ...Call 0/C i000/20/056Piisnr..... . . . . . . . 460/tte' tpisll 440/660/700 piiaiu..... Ataznm/zm imrasik Zti I ztt /261 Primer.... 8100/230/320 HP340/sist/030C/MK/M6QSPriaisr ...Call 'nam iearr Mallwzaala

-------- CEREES-- -----. 66kVso with roke ........ . . . . . . . . . . . ... $20 Uta 666ikn 000voiie I wiiksvt wke ......106/03 Amv060 wter avatsteaasre PCI/ ISA,Sstrar vrm uivervarrrrirsriviauvvairirmvramvmvm' Ni '

III I C 0Illl t

tdo-ddyr No.d Read,Richmonlg BC,Canada V6V IPS Tel (604) Sm-msS Pexl (6od) Bsmogrg Webl http://unuw.dmac.bc.ca Emak sa)mGdmoc.bc,ca Hours:¹n-Fr(roam -6pm,Sotipm -dpm *gg

•

' I

to/ioogaseTBuilt-in Bhernet pon

• • • •

•

$2d.%0

interns) V.go56KModem TwoUSBPorls Nmmssem hue' Tines High. Speed Firewirn Ports USBKeyboard andMouse Mac OS0 IR StOCk! Internal tooMS Zip Drive Internal PCI SCSI Cord Appiety' Studio Ihspiay

•

egg

$39y

$2549

II I

- '•e

Apple GS/400 PowerBook 4ooMH3 GSPowerPC Pmmassor LNBBackside Level 2Cache hht" TIT Active Matrix Display • 8SMBMemory SNB VideoSGRAN 6GB Hard Drive DVD-ROM w/ Video Playback d)b~ to/too SaseTSuBt-in Bhemet Part 'l aeieg see hie' Inter nalK565lex/V.gu56K Modem S.Video and VGAOutput Two USBPons Two Firewire Ports One PCCmd Slot In(rand technologyport (4-Nb ps IrDA) Apple Trackpsd

AppieGS/SooiBoak gooMHS GSPowerPC Procesfmv gmK Back sidelevela Cache m.t" Tpf Active Nstrh Display 33NB Memory 4NB VideoSGRAN SAGBHardDrive adxepccd CD-ROMDrive to/tooBsseTBuilt in Ethernet Part 'lmrihsia&e Internal KEgplex/v go56K Modem Single build-in monospeaker td-bit stereosound output OneUSSPons Optional it-NSS Air Pott wirelessnetworking card Apple Trackpad Software Bundle Apple AirPort Card for wireless network

• •

AppleG4/4GONinitower dooBIHsG4 PowerPC Procemmr IN BacksideLaCache uSMS PCgooSDRAM toGB Hen) Drive DVD-ROM w/ V(dao Piayhack ATI Rage ug Pro w/16M AGPax to/IooBaseTBuilt-in Bhernet Port

I'f

•

Syeuelriufhwueiieer: sfarce, lu cw,Hammerneeese, Tenue Iemeuiee, healers, ee.

m yum maeetenaehdiuuuui red Meeehjue teehesgem'thuneeuu. Aa Ixeuh,leon,eedledemuhemeee Smyuua eitherMenmeehehhm

•

Mnffie lextmRmeenn Meuveudh Nuolgnn, ue

tg" ColorSyncDispisy Stwao Speakemby Herman Kardon Two USBPorts Two Firewire Ports USBKeyboard and Mouse NacOSgl Sohware Sued)a AGFA SnnpscangaanU Fiathmi Scanner K peonStylus Color 74oi ildt! ct Prhlter (Bonus:UgggoMail-in Rebsles) I e•

yriwufieeelgiyhmmf

mmmm

• I

Ap pieColor iNac 4ooMHs GSPowerPC Processor B2K Backside LaCache 64MS Memory AGP mi, SMB Video SGRAM soGB Hard Drive Siot-loading DVD-ROM Drive InternalV0056K Nodem

AppleAirPort Cardfor wire)assnetwork

140 32MB72pin SIMM 109 HermanKaxlcn ISub 129 MacOS9 139 32MB160pinDIMM 125 64MB160ninDIMM 219 IBMVeaVoice 79 Epmn5700iUSSLacer prinle f 599 32MSSDRAM 59 64MBSDRMI 99 EA MaddenNpl NN 190 MTOSpkn 0 Accmmfhh 249 120MSSDRAM 390 Nmtmi Ulil 5 andAuli Vhus0 Bundle 169 250MSSDRAM 79 WacanlGmyhifo 4x5USSTable t 139 32MSSODIMM 119 64MSSODIMM 149 Aladdinstum oehm 55 59 128MBSO.DIMM 329 EdicsTombRakiei 01 GT UnfealTimmament 05 Slat Wars:EpisodeI Racer 09 3!8 IREZKfiaei USSCamera 169 Ciesemlo300MHt/512KLgG3 3N 240266)512KNuSusG3 Apple AiiponCmd 149 Ciesmeo Cressndo300MHr)512KPCI G3 380 449 AppleAiuen Sess Slatisn 10N 500MHrnMPC!G3 A TI XciaimVR128 PCITheo Cenl 3 1 9 Cnusfeo XtnoMachCmiim G3400MHx 718 Intuil OuckenDelve 2000 N XLR0MachCarder G4350MHz 1079 I XLRBMachDanie G3184PCICard 219 E ysonSlylus 7401(USgN Rebels) 2 79 E pcsnSlylus 740(US550Aebale) 2 4 9Apple Inl 56KModem 155 EpscnStylus Photo1200USBInk)st 739 GlobalVisagetnt. 50KModem 155 E psunStylus Plein 750USS Ink)el 4 4 9 SesidstaUSBEe. 56KModem 150 105 MicfclechUSB.SC81AdaPter 145 Sscnsler Exl. 56K B fulhsf HL-1050 USBlaser Piinlsf 5 9 9USR GlobalVillageTeleport ExL50K 105 Lmjaech tbbbcu VC 109 OlamcndguymEmfess ExL50K 145 39 GfavlsGamepadpe USS Viuug50KPCCard Madam 179 keegs 250MBExt. USBZip Sie 2N I 35 Macagy)Meum Macagy18sg 50 Lacle cx4XI4USBCDAW 449 65 lomsgs MscsgyIxsybmfd 250MB Exl.SCSIZipDme 249 Intmexcsxxt USSHub(Newlaw Price) 39 hmega2GBExLsax Ofue 409 AghSnayScsn12QUScafx w 169 I BM Uamslsf 0.1GBUgfaSCSI HD 4 49 AssnteTalkEsemsl to Lccalyal k 149 9.1GBSameudaU2WSCSIH D 41 8 149 powsfpfinlUSBlpafagelCahe 10GSBarracudaU2WSCSI H D 749 logilech USBWheel Mouse 55 Vsmsha0424CDRWExl. wfToast (New)599 110 KeysnanUSWSefisl Adaplef igcck dgacStand 239 69 Asante HV100PCI Ethernet Card Asauie 108TNuBusEdenei Cent 129 Its 139 Asaule 108TPOSEthernet Card Adcoiec2930USCSI Card 79 Assnle 108TComSlct EthernetCaid 109 Adsnlec2906SCSI Card t25 Netgesf4-PortINT Hub 59 OfaxgeMWS030USCSICard 4N Iegh MilesBlusnuteSCSICard 129 AlliedTelesynbien IN10087 Hub

POwerWGI!O)IGI!GAfOr An!MGI!OS GBd3D 6IGf)h!N

SuPreme SyStemfOr!)76f855!GOBI BGB.I!ABBr tnli!IAI

ASUS93OD Oval Penrlum Sl IN/133MHxAIX metherboard Intel 020chlslet rupsensUOMASfi, 48 AGPend Samhn SAM Duel lntelh Psnnumm IS NOMHxCPU Bmmd mode)) 25dMSINpin 02100SOEAM DIMM w/5PD EEPEOM

ASUS928-D 4400XAGPDuo) PcntlumBlmcihsdeofd Ouol tnMN penuumB111550MHx58U(boxed model) ZgdMBIdgoln Etc PctN 502AM OIMMw/5PD EEP80M pomuonlclsl20 120MSDuppysnd 6585 408 Inlemol CD-ROM (anoyusXolodeAGPVideo cordw/32MBRAM Ouanhmfleabag 13569 UitreATA66 systemdrho Adoslm1st&0Ultm IN 5(51 canna)let Duenlum Agcy IV36GSUbm IN SCSI videodrim fonsyurDV-nesOV/AnaloOvideo capture cardw/ETepnon In-uln Dyu 24' full Atx tuneruucw/300w sewerMeylr

panayunuLg-120120MBSoppydries SD)einOxygenGV32)0 w/44MBRAMand duol msnltor suppsn Guantumeh)ox IVMGB Ubra IN 5(51 HD (7Z00RPM, INMB/xsc) Pfmtor Ubmolca NX Inlsmal UltmSCSICD-EOM AdaplacUltro lN scsl amlreOer ln.win24 tuBAIX tower w/3NW Rsusr supply yulileu4725 INkoy koyboani andloginnb 3 bunon macle SonyG500 21 yD dlgiiel monitor (sgc, 2IH0815361B)yyih) WlndsusNTWsrhtation VA(FREEupamdc lo Nndcwe20N) 2Tearveffanly (pens6 labour)

Mlaumft2-huronIntel bmouseond Intefnei keyboang WlwdeweNTWefhiotlen V4 (FAN uaaredo Io Wlndeus2N9) Viswfonif rS15 21 digusl menlmr 2 Tcorwarfoely (Poem0, labour)

IP~

IK5HI Olerfa I 7 wince Iruegleee wmri

ranee hefhCu emlSeriec cemee

rwameeaml mwefgeswince elmllme seyywfeoyeestnu,nlmenuseecumu

cowe r MrgGOlaprheumlefaco,

CeeyemOrmc Seelesecuus • memelweIedeeel

l k 'L'k

e ameyneeel • hneeeeeIa eehmmm ~

hdagros RT2008

hehle»eeeaeeerwauecrelease amwhalCeeicr3Sma ees32 humxeeumummleeewl • llphh Ie eculm mus alla emhllewe. MygGgeefeeflee Ws • Iheru,

w 'I') ll

Ge eyefeme(eee, ese. • ed seeMue) hee Illmecy&lfi eel et oMC

Mew rteewlm Gs Oewaueeh

lhe new eee eec Mmmhern reaeuak Me eew eeelyedwah helh.ie FI~

eew

Ihet allow yee Ie ecu

your w'cee eeywheee. wlynleu.

Mewomolrile meem leech Ihe heefeeuleg mlehat afllmme ulel

ayleeed Ihe eirit of Ihe IMee-ees cene e few hewn m ril-m gives Iwe twhe Ihe

memory, I 'ee I he

ewmefy eeyeesehiaty. • es • 1 gigehlee hem cleu Thenewramie GX laces Sa I • eew dfleewl Ie yeueCleelae

alee.nmeu .

With iveeh, yee can cute Ihe Imwen eefef fw yea dlnhwl, wma

Sleece wlm your ewe

Orner.eem e

lail

• reach chere +lie Shaw ewl IMerim we cere eleele nele ewe

weh me. seer of es, Weele eeeSeefor Mee

Gecawe Gus eery ef Mee Ges ma ees el+I

ee et wwwasriealll

tedeyl MeeGeC- ees

Veu mey eew eleii we eh eee ei eee aw demefw hum/f~.dww.hea

0(10Q O

OXFOEN G VX210 Seel meeuee weeefl

maelhmch gn afhen

— msmekM cM"digitsaeoff btds oscenter

OIIG417INegbmLgkhmd ocvmlm TelemiaRHMfmeohgRM13 ,Mus Wchonnmfexgscolmlu .ress Gmag:

mecfomedia

IS)eh(mecu/pole(h363MBEA B 200 3D)slslhygssAQS/ihmulis288ESIEIIB i iy 3D)shgxScsVHu/EUEf N(78 &3268!hulk! 3)9 304dsgxygmNSAEPu/SU)EM,S) SIIIS )058 3D)chgxScnETS PGu/6UBTEI,G) SISS )dig 30)clsgrSssSygiigv/dluiiyg 6MN 208 2)00 Oiocssdyimgl) s/1082MkitgrspbiaeSiae )259 ghhmggmshmg(NI4ar dudnmbnu/(Big 3H BSSMMBNxm)dm sEig Rmmo/ymslse 8T )NI 865Ug)ofhg )SI v)3)M))6EBUacgs)H9 Rl 590 Bi Tsmads 3Nu/IBB 6EBUmaga)IN (PS )MO Alii)I is umdm)Hu)IBBan)IVTom 359 R cuhihdic800+ POnhomykmaml 3 ) S piaanisihdcNyifsefelbhseyhemd 2)0 Rcmuhiheiictty)gu/nalbacBPM)medley 379 y immhilulis68mhmsirihsagmncdnln IN B iisyhho OOBBnsitimsgyig 2oedei 33 W BiidK30pe s/ynmiseS.I 6 bnaiautha ) )B I B irsyibu 8(No/Rsm'Mhiglftsf s Nsa 2 5N 6' Bdm BT BSu/A(s) Rcnbmi.) Mg Slm86egySgu/A&bshsmisegi )NO 13% BIMBIMMRBu/Adshsyemins51 h asyulAmlur 878Reedmu/gy)hggB Hy g fsmymNgsxdg)N/AmhgaVhxsae i 3NO ( sssymDR)sylMNaghfsu/ynmkmS) i )3 0 (sscyegygcylariIMeyhmu/hsmhmif gi )Al Gmspafylnbmhou)IBBae)Bsihampm 748 hssye gstygbighVsul B egntmbofsrgss A B hssymTfmms isnu Vdeedmhfms s/4S) 4 5 Byiibnsyfbs8dmlheehrpy)LIB B Hgg )gph) SrighSchMBrdioggo/ramiereS.) igig S t)gdgri)gagchME)(rislNhsnplesenl 5 0 0 )186 BuisoYidcsgddIN82)Niptaa BcfmfdwgsMS)N4/R Ipha Igyg 4470 BairnTdegsM)IN4//0 Hiplsm B ubopdm)h)d)NMU)QI)liphm 743 5

:~ i i k Xk

rewelem4tgeel wwemweefhwIw eeyeseew calcu iwcereusmwisehhnrco 3 my GyxeeelIgst I gmIfe ereelee

Ium Geeewey eecMslelegsueeemee . IhelGumluhmrimnemmmeGrcyu Mml cASewlMme vlmwlreaea

me «eh elec meemies eyelhee • lee ewl eehg Mmelleehue dmrihxm

DCC

- , M' MEGA Bundle

OVewaeS«hue«Suer uuewwfaf eyuee Xylede coSar mhefeel wignm myyemmela dweeelmae

ereaeIhwlree*le enef41MSgems

acetous, acheGveaxes eeleikm newleweOr mhe

vhe neat seeeailee of

I I

Ieufecleegnash we lewmmeuaewr

MewSewer SheGm

0(l000

Iedwlwblahceeslyhwakwa hex

• eencewshmhhereeulwe s let

GNyumonon HNINMu sl, Its g g ~ ~

4 N8tlOMtmit

bljHtl gblilg

e'.I ww wpuw PnallPftE ~ww

amaeaew • ceca mu

All pdmnllcdigb(AB)dimusL Si yrimesmhcuhdmGsmlhel scum M hsdrmsdameGcpnV«had gnir regmfnc bethe.

Rk cwame ' ' " S.

Same Location

Agmla 6ThlnhPad

Since 1993 •

•

I Ss C

. ~ Advanced Home PC:gl Professi onalPC — --" Intel PIII-750, "= Intel Pill-600MHz z

Office PC

Home PC Intel IntelPill-50 fx ~ C eleron 500$Hz AeuSP38F MSWi512K12CaChe ~ m en T w

hh' V/

Celemn500miz Processw 5370 MSwn28KL2Cactw is ATXTtwwCamW236WPS 64MBSORAMPC100 64GSEIDEHanl Disk 3,$1 44MBRoppy Omw 8MBAGPlfideo 19 t ( 48XCIHzOMDriv 3D I ail sourd 120WSpeakers 56K he V96Vi!Faximodem WnggKeyboanl, 6 PS!2manes Inc pais63 rin Ichorcairrm warnnty

Afx 16 Trnmcaseznwps

•

dgll

Gott CertlredSystegns

<N ™ scsezbdcezNowettndngee„

Awesome! 33499

otstlozt x

Microsoft -

•

IBM PC300GL & 300PLSeries

st arg'.

e Nettpa bie 6-29% when yon need ee p n . am. lthndowsNr C4 'Y0 Sety 211ce. rc .

~CS

Authorized

Bravo!~$2299

nternet Access /Web Page Design . 9Bhc

Aptvla 6 ThlnkPad Warranty Provider

xvi txvnvvi srxwn

Fant~l$19$9

•

10.0GBHDD dox CD4OM

ONLY 91299 wtnctorm 906 N

Q393tsst2

Pr osorlo 7469

Compaq Notebooks

== =

•

N/t,.

•

' '"'$2099.99

Gg~

0/42 00ltcnSQVI2.1TFT i!runt' csexiueexxr/wxii szaeeN 633NMNZ/64MS/6005!zcr/ggg/12tTIT INwlaxxsraovrniauei $2N O N N 6gala/sswwg.ggspcr/5$vt2.1 TFT • acixscriw Ieeix wwii) sm ssas

UGS from A to 2 330 99.09 eall for othar devices

PowerMac G4/000MH I

35049.99 EpeonQylue 740r(US$50rebate>

450MHz/I 28MB/2068/DVD/ZIP/I 6MBAGP/56K/I OOBT

50OMHz/256MB/27GB/DVD-RAM/ZI P/I6MB AGP/IOOBT i

Apple PowerMac G4Computers 5 Apple Displays .. $299 Apple ~ Computers....................... $299 AppleiMacDV/ SECampulers .............................. $1 59 Apple iBookCompulws ......................................... $229

Knowledgeabl eMac sales person required. Please dr op Gff resume.

Macaily iMouse

t pson Stylus Photo1200USSinkle l F tmsiwint USS to parallel cable tu l NewerTech uSCSI Adapter NewerTech uDrive 1.44MB GravisGamePad PmUSB hhcally iBag Macagy4Nrl USBHub KeyspanUSBlo Senal Adapter icockMac i SWW

$29 $299 $69 9 $13 9 $129 $149 539 $45 $69 $99 $219

Canon •

•

$1479.$9 iMac 8835IV64S.Grec/56K/15' Blue only $1479 iMac OV 400/64/IO IOVO/56K/I5 5 colds $1969 iMac SEcgtyf20/13 GIOVDISSK/I 5' Graphite $2249

~' eR

. . .

. .

•

NewerMAXFower G3240-266MHt 750w/512 Cache .. $449 NewerMAXPoww G4350MHr 7400w/I MS Cache ........ $999 SonnetCresendoG3/PCI 266MHI 512KCache .............$319 SonnetCrescndoG4/Pcl 350MHzIMB Cactn ............ $899 UpgradeTour olderPowernae wghNewer andSomek Call 436.2333for delag. MacOGS .............................................................. $139 AdobeinDesign............ .. $999 AdobeGoLiva ............................................ ......... $449 AdabsWebCollection .......................................... $1440 Adobepublishingcousclicn ..... .. $14N AdabsDesipiCogection.......................................$2279 Adobe~ /P hwoshapllltuslral«........ $729/878I549 AdobePholoshopupgmde ...................................... 52$9 Owk Xpress/FawlCwPm............................ $1189/1299 .

SS/400/84/8.068/BVB/565/7 4.1TFT ...., 53699 G3/500/128/I 2.898/DBB/EBK/74.1TFT ...$6890 GSPB BRM 32/84/TIBMB .......ST49/IBB/399x CsScxcxu axnvrm tsmrr nasafgiio — — Sz ¹l csswwi IcIuieiixuwwfstasnt/nt ... siio ISX-NSCGOur niurur fxr SCWdnxmnh PCZSSO U/AI- , Sss scsl xxwhmfaunforscsuosca nm ptcNI>.. —....sxr lml-Nscslsvxumciwihipa-w-scsllswsanUA) . ssc

AC8R$0

. .

LEXMttttK. ~

. .

400MHz!84MB/IOGIIIDYD/I6MBAGP/56K/IOOBT

Power Mac 94/400MH z

. .

laCieExt FiraWxeNGS HwdDisk .........., ..-...--- —..Nxe Seegem aanacwm26GSArnac72N Iaax ...., ....... .SCIO SseestsCheeiah3tl GaSCSNra 2te amRPhllCO .... 8153e l aCie 6416 CORWExt emmet -. . . .. $61e LaCeExLUSSIOGSNXI. ....NIS LsCwErc USS2aGBMs.. ....... I6CS Lace Eu US84xixd24xCOR -W....,....... ..MN

iMac SE. The Re-birth ef Cool!

32349.09 ~ Power Msc 94/400MH z 323 49.99

•

'M, rS .

'sc gi

•

PinnacleOV5N Res!-time. nslweediting eslulim ....... $1285 OyhaplarDVaxho6 vide eNny solugon ............... $1120 DigitalOrigoMwoDYSwdw.......,............. ......... $10N P3-500/64MS/noHDD/32x/IOOST/noMOD .... jtdgp mirovideoOV300 .... ..................................... $1070 Pg-550/64Mb/no HDD/MM/IOOST/noMOD.... . 2119 mirovidcoOCigN .................................................$34N FS MO/64MS/noHDD/whr/IOOSTlnu MOD ...... $2479RnnacleStudioDclg+ PCIVideocapers cent......... $310 RnnacleShxhoMPIOw/reNme MPEG!encoding, ........ $369

3D/Bra

•

HF33000/5200C. ......r .................... $189$lp Epson Sum2900/2500/Feri scgon610........$4lg!$429/tzcf Umm22080/NNU ....................................... $319/$5N AtfasnapScan1236U/1212U/1236S,.........$299/$169/$299 Mkrolek3NO/ V6USLScavm .............................. $169/$279 Kadsk/ Agla7Canon/ Futishi I O asis / Epson call farbestprlcel .

IBM Netfinit3/ 3000 tk 5000 Series Servers

- - m stttstt tttGHttgn Acegt 46' =

Lhhv)5

gaatczs

MaaXiafNSOFDFN

IBM IntnliStatioas PS-550/128/13. 5/dox/8400/IOOBT...... 52799 frS600/328/23, 5/dox/6400/100BT.. . 32999

Think PodiM21Cd~/32/6.0 /zcx/56K/Ik'HFA ttpp llunkPodi tcge CcW33/64/4 8/DVD/56K/HJTFT 2(N 9 ThinkPedin40CcW33/64/4.8/24x/5fi K/IZITPT .j2549 lhinkPodil54ICeWdfi/64/6.0/24x/56K/MJTFT 2039 Thhdpad390X Cel-HS/64/4.8/24x/56K/IZITFT .. 52649 ThhdPad390X P3-500/N/12/24x/56K/S.OTFT .. $4599 Th' hopedNOE P2-366/fic/Ikc/zcx/nomcd/13.3TFT ...54599 Think pud600X P3M50/64/6.0/24x/54K/13.3TFT .......$4439

(

Mnicayswam

MI9IMwlmwll9 SSNICN

eall 636-2333 for cunwnt promos 6 rahataa

IBM Notebooks

PrcsorioXLI02 K6/2M50/32/5.0/24x/56K/12.OPA . 1649 Prcsa rioXL107 Kd/2475/44/6.0/24x/SSK/13.0!en .. 2299 Prcwvio XL145P3-500/64/60/DVD/56K/14.llFT 33 Armodo1500CCel~ /32/4.0 /tcx/56K/Iz.aen 32H9

ONLY 91399 svan ceongnr

VwwwieEmllwiSUEateayrf iEI73 $2lel2 ~ ta VuwswicGsftalwllb ai3WU2g

lec FgrawFETNM Sannxne55aS//5aS NNasa SwnsmgTNNFmmaa30FTNSIFT Sstmecnela43N

Cn!500/64/30/noCD/noMOD/Win98 .... 1199

. -===a Ighll Aptho 220 ~e====h Kd-2/450MHt 64MS SDRAM

•

Opaymi OSU07007%85

SanyINGa21SGSE2NG?OO NECAfabv~

I BM PC SDOB L Cnl466/32/ID/noCD/no MOD/Win98...... 1019

•

P3-450/64/10/noCD/no MOD/Win98..... 1399 93-533/64/13. 5/dox/rw MOD/Mfm98..... 1699 I•

Caritas

IT SVGA.28mm cokrmwaor I Tr parle$3ti Isbor csnyht

Best Value! ~$899 •

y,';,

I.csin nappyDmu ATIXpwl200032kn AGP gxsxzzxCDR.WDme 3D 16bdSauwl Cent

19'Twmr case watow csn ps g~iksxsa

+W 45xw'e~

16'ATXTower Case250WPS 25MN SDRA M(exp. 1024MB) 12NN SORA MPC100 20 0GS7200RMPHant Disk 20.0GSBOE IR MA HantObk I Cshn3JFFkppy Drwe 1.4SNIRcppyDme MsbuxG480DualHead ATIRageFwy32NI AGP VideoCent DVD10XDrim 10 , Log gechinternet IN OEM3 i v • Logitech FS2hknnewhrhsel • a Ameal uperOuadSaund 1 OYOidIW 5 Vwnaha Speaker vnub Woale r. ;g o e Sxsxztx CD R . W DiwwwdV9056KlntPCI mn S ound Bl a shr Uve! Vckw OE M MSInternet KaybawdOEM CamtridgeSwmdWean PS/2Mouse CastdmSpmdos ITi pals6 3.WNbor canpm wanwny xvrsxxctvm sewn U s R 56K v90 lrn WFar!Modwn I+pamghtr WbercarrymW

Q'21tt/tdba-

128MBSDRAMPC168 130087200RPMHanlcnk

. 2/MS

IrcelPgtgggMHzProcmm

HBW L S l T

•

. .

i •

. .

•0•

c P LATFORM N E W S»

ffxploring Windows 2000 Continuedfrom page 82 So far in our tests, which have involved dozens of installs of new software and over IO different benchmark runs, Windows 2000 Pro

has crashed only twice in over 50 days of testing. In sum, Windows 9x users may want to ante up the Windows 2000 entry fee for the sheer pleasure of not having to reboot so often.

But before you do, wait for our upcoming benchmarksofthefree CorelLinux usingthe WINE emulator, which allows Windows programs to run in the open-source OS. However, even though Windows 2000 Pro

may be more robust, there are still some reliability problems associated with existing applications. During our tests, wc found that older Windows software — Adobe Photoshop 4.0, Coral WordPcrfect 8.0, Microsofi PowerPoint 95, Microsoft Visual Basi«4.0, Symantcc Visual Page I.I and about a dozen other programs-

had a tendency to bomb more ficquently in Windows 2000 Pro than in Windows 98. It

appearstheissuemay besome Windows 2000 API and .DLL changes that cause earlier versions of programs to bomb. So buyers beware:

make sure you test older versions of your applications before switching to the new OS. At Microsoft's site, you' ll find a Web page (htlp://wwwznicrcsoit.corn/windaws2000/upgrade/corn pat/cwupeeasp) listing afi programs identifiod

the new standards for Windows 2000 instafis Full Windows 08 interfuse

synchronization options and manipulations

(which reduce, if not eliminate, the need for Windows 2000 Pro borrows afi of the latest feareboots and the occurrence of . DLL confficts). tures of the Windows 98 and Office 2000 interCertification also verifies that the program Face, induding startup icons on the status bar; cantakeadvantageofnew Windows 2000 fea- TSR in the system tray at the right end of the tures, such as ADS, Kerberos security, and status bar, smart mmus that hide least-used Microsoft Management Console functions. As options; and right-mouse access to a number of of the end of February, only 20 programs had mn6guration options for the desktop. been certi6ed (some Microsoft stalwarts like Office 2000 are ready but not certi6ed). Having installed over 48 latest-version apps on »! a» Windows 2000 Pm, I have not had any problems Uav»v ! »»» with the install process other than reboots —the '%»» a»!» %!!» programs have worked pretty much Bawlessly. As %Ho »la J»I my tests are being done on a Ddl Inspiron 3700 nh w! »»I J I A S with 98 MB of RAM snd a 12 GB drive, a lot of n» t www i !» Al» softwarecan and has been tested. One would »!» fogy mpect conBicts at the outset as in the early n»! »!a days of NT; but so gu m goaL However, I haven't »»» oww »M tested any games, and this is where incompaubil! ! • »» » ities would be revesiwl if there were any. ln general,Windows 2000 Pro appears to A number of Windows utiTities have also have a good record for reliability and robustness except in two areas: running older bmn updated, induding Windows Explorer, Windows code, and reboots on installs. The which has bormwcd a number of ideas from ZDNet benchmsrks must not indude installs Internet Explorer such as the Search, Folders, because more than half of the software I and History windows on the lefi side of the

could be more conveniently done there.

,,raa

installed (notably Office 2000) required a reboot before the application could be run.

In addition, the Accessibility suite of pro-

grams have been enhanced with a hewer Magnifier, Narrator, and GUI Keyboard. The system tools have also improved with much b etter ut i l i ties for Bac kup, Dis k Defragmentation, and System Information. Task Manager can stop runaway applications

(and afi their child processes) more deanly than ever.Finally,for game freaks, there is a new Pinball game that shows off the sound and video features of Windows 2000 (or more

properly the new Ddl with an ATI Ragecard). One major point of contention: there is still

not a good program to manage the registry. I get spurious programs/icons appearing in the Systray or in the pufidown lists of Windows Explorer or sorus right-mouse options or startup programs that I would love to control.

In fact, Reginald Edit is a doofus program that is not halfway equal to the task of managing the registry. But at least the utilities of Windows 2000 Pro now match those of

Windows 98, so who am I to complain?

Setter runtime speed wt n prise screen. Windows Explorer now includes Installing Windows 2000 Pro was straightforIndexing Services, which considerably speeds ward on a number of machines, but not afi.

And when things went wrong it was a nightmare. Abo, Windows 2000 Pro did not always run well on afi of the PCs tested. We found that (and, even better in some cases,certified) as running Windows 2000 Pro on older Pentium Windows 2000 ready. A program is considered offline, then re-synchronize these files with the processors (200 Mhz or less combined with 48 Windows 2000 ready if, after vendor tesung, it installs properly and runs effectively in this area should improve. With Windows 2000 origktals when connected back to the LAN or MB or less RAM) was just not worthwhileWindows 2000. To be designated cerufietL the Pro, Microsoft appears poised to deliver the the Internet. This is a big mow up, but I would especially al'ter seeing the relatively fast same testing is done by a third party, Veritest, industrial-strength reliability on the desktop have liked to see the program incorporatol response time on the 464 MHz Deg with 94 right into Windows Explorer so some of the Continued oa page 90 which veri6es that an application adheres to that Linux and Unix users now enjoy.

This is less of a problem on the desluop, but is up searches for text in files. a real concern on the Windows 2000 Server side. As noted, Microsoft is making no-reboots on install one o f t h e requirements for Windows 2000 certification, so robustness in

There is also a new synchronization program that allows a user to download internet and/or shared network 6lcs, work with them

Mac S ta tion ~ ~v~~~ ~ c Lt /t !& /

A I X B) Qrj&oP c N CiCiL!

The Best Selection of Macintosh products /n Greater Vancouver

•®

We' re Expanding Again! ViSit offr neWeSt lOCatiOn at •

•

e •

•

1286Pacific Boulevard in Vancouver- right in the heart of YaletOWnl

Drivgff

Mac Station Btsrsuab)/ ¹207A - 3430 Brighton Avenue 420-5224 or 1-ffyy-900-MACS

tor Inn

Sknanl®~

Mac Station Maple Ridge 22353 Lougheed Highway 466-0190 or 1-800-563-MACS

' '

• •

Mac Station Vancouver 1286 Pgcific Blvd, 806-6227 aw»a»arrlC4» » r a w»»a

v»» ! ~

far! »c l fflgslCLI

•

c PLATFORM N EWS 0

Microsoft launches Windows 2000 ByJohn Saunders

Security is particularly vital for Internetbased business, said Erik Mofi, Windows 2000 program manager for Microsoft Canada, who was also present at the event. He saidthe security featureshave to be "possible and easy" for individual users as well as network administrators. However, industry analysts have cautioned corporate users against rushing to upgrade their entire enterprises to Windows 2000. While companies will see benefits

t's officiak Windows 2000 is open for business. On Feb. Iy, Microsoft Corp. released the latest installment of its cor-

porate operating systemamid fanfare and controversy. The launch of the OS represents a breakthrough for both desktop computers and servers. according to Simon Witts, president of MicrosoftCanada. Speaking at a luncheon at Toronto's Royal York Hotd. Witts said the new OS will play an integral part in reshaping businesses around the Internet. Having invested USSI billion on a development team of more than 5,000 staff over three and a half years, Microsoft bdieves Windows 2000 is as ready as it can bc, according to Wins. Windows 2000 gives us a tremendous amount of encouragement," he said at a press conference following the lunch.

process to spdl checking a word processing document, saying that not all fiaggcd words afc errors. Though he said Micmsol't is unaware of any specific problems, according to Witts, "It's got bugs. Computer science has not solved that

problem."

Hardware vendors are also promoting the release as a breakthrough. The new OS is "one of the most reliable and stable platforms," said

For home and consumer PC owners, officials warned against upgrading from Windows 9x to Windows 2000. Instead, users are advised to wait for Windows Millennium, which is from adopting the platform in an appropri- specifi cally geared towards consumer and at» manner, international Data Corp. says game use. That OS is due out later this year. the acceptance of Windows 2000 will be W itts suggested that g arners stick with slowed by organizational concerns about its Windows 98, for now." For graphics and games stability. support, the Windows 98 platform is much Gartner Group Inc. has aho warned against rich«r." widespread adoption of Windows 2000 Server Witts also said Microsoft is doing all it can prior to the first service pack rdease. to avoid confusion between the corporate and However, Microsoft noted that several consumerversions ofits platforms. Canadian firms are already using Windows With the rise in popularity of computing 2000. Quebec's lunetterie New Look is using devices, such as Internet-oriented products

He cited Windows 2000's support for hotswapping components of a computer without having to shut it down as an important feature. Other strengths touted by Microsoft include greater reliability and scalability, easier document and directory management, and stronger secunty.

Western Canadian telco, Talus, has also been ently given up on unifying its operating sysquick to upgrade. tems under the Windows 2000 moniker. Witts also downplayed reports stemming Differen platforms will be usedfor different from a leaked Microsoft memo that claimed systems, according to Witts. Windows 2000 suffers from thousands of When asked if the company is still looking glitches. Calling the reports "unfortunate," he to build an all-in-one OS, Witts replied with a compared the company's bug-hunting simple "No." 0

®ielawl~~ ISIOIIMOIOIIOI

Specifically, Microsoft released Windows Peter Ciceri, president of Compaq Canada the platform's virtual private network capabil- and handhelds, as well as more demanding 2000 Professional (for desktop and laptop Inc., who also spoke at the press conference. ities to help run its «yewear business, while high-end applications, Microsoft has apparPCs), Windows 2000 Server (for departmentaluse),and Windows 2000 Advanced Server (for Web and business-critical applications). A fourth product, Windows 2000 Datacenter Server, will be rdeased in about three or four months, according to the

company.

Set your kicks on Route 56 for less. Announcing new v.90 service rates from lnfomatch. 0

Use u p to 120 Hours - Month $1$.$5 Use up to 100 Hours - Month $17.$5 Use u p to 6 0 Hours - Month $14.$5

All seeounts Include S megabytes ef personal web spans + an extra small address. No sef up fees or prime time reselotlonm Taxes not Included.

Ouesnonsr-eman us st soeounts@lnfemstoh.eom.

421-3230 www.infomatch.corn

D RE.'A'MWE,B I

3 lo200MB-Flexible Peokages Free Domain Name Registration and Transfer

Interactive g e b s ite Design E-Gommerce Solution

Shopping Cart, CGI - Bin Direcloty Onsite.Online Training a Setup B FTpaCCeSS

Specialaized In Custom DataBase

Fme Form Mell&ouster, Search Engine Pmfesstonal/Aecsasnls Tschntcst Support

Multi pleinternet Ssckbons Conneoaons Fran(pageExfengnn,Real audioMdeo Dual Powered Ssakup eeaeratom

30 DAY Money Back Guarantee

mixed Script

W eb Hosti n g WWW.yOUr na m e . COm S t a r tiftgCM41

om Production,3D Animation

5 o OOCIIn

CALL T O D A Y ( 6 0 4 ) 2 1 4 - 9 5 9 2 www.esucucompules.ctva THECOMPlrtutnusfn SCEOITION APRILZOOOSy

c PLATFORM N EWS R

0( Of 'COHlplffl SPA?K8$ 2

Providing Total Networking Solutions

Affo rdableNetworkingServiceforHomesandBusinesses • Single line Internet sharing services for multiple computers • Qualified Professionals, Consultants aud Engineers • Design and Planning of Network for both homes and businesses

• Our installation services cover everything from installation, hardware, software to cabling • Sharing resources of network, data backup,

Internet connections, security control,

hackers aud virus prevention

• 24 hours on site support, maintenance, repair and service • Online olfsite backup, web design and development services

•

as an alternative Web browser,lava support will take the excellent KDE browser a significant step forward. While KDE I.l.2 introduced some ability to use themes, via a theme manager, KDE2 will be totally customixable. From minimalist to

K o ffice: KWord, K Spread,

K Presenter, K l a ustrator, K C hart an d KFormula. Two new applications join the

suite KlmageShop,afully fmtu red competitor to the GIMP, and KDatabase, a front end aimed at making database applications more accessible. The team is currently working on Microsoft Word 97 import filters for KWord. KDevelop, the K D E I D E ( I ntegrated Development Environment), is nearing readi-

KDE2 still uses CORBA (Common Object Request Broker Architecture) for distributed ness. It currently hassupport for Objective-C

•

Java and JavaScript support. Already popular "original"

like, and there are already themes availabl».

M r *~

il nlrfes W

+ efaren

We Provide service in English and Chinese •

In the Unix tradition, KDE uses plain text for aaits configuration files. This frequently creates You' ll need to use one of the commercial dis- unpleasant legs in launching programs. To work uibutions, such as Red Hat, SuSE, or Caldera, around this problem. KDE2 introduces KSycoca, theKDE system con6guration cache.The conto get an early look at Linux 2.4. figuration 6les are compiled into a 6wt-loading cache binary. Unlike Windows registry files, Here cornea KDE2 thebinary fi tesaresecondary.Ifthere's Even as the Linux kerad development team is however, a problan, KSycoca simply empties its cacheand readying Linux 2.4 for rdease, the KDE development team will soon be releasing KDE 2.0 re-compiles the plain-text configuration files. KOffice, a full open-source olfice suite in a (also known as KDE2). KDE2 promises to make the wea-nxeived K Desktop Environment even development stage, is progressing steadily and parts of it will be released with KDE2. The more useable than it is today. The KDE2 browser, for instance, will get full component parts indude all the parts in the

Gothic ,you canmake KDE2 look anywayyou

We arean authorized Rogeraathome vendor Prerenwd Partner of Axiom Imteraet Authorized Agent of lateraet Gateway

•

Antloipanna Unux 2A and KDE 2.0 Continuedfrom page83

•

dow in Kword.

•

• sr

and a class tree view. The KDE documentation team is switching from the obsolescent LinuxDOC SGML system to the industry-standard DocBook DTD SGMUXML used by many publishers. Additional details about KDE2 are available dow from Kspread into a word processor win- on the KDE Web site at bnp:/Awnv.kda.nre. (2 objects, but the developmeat team has found CORBA to be overkill for many of KDE's funcuons. For lighter weight objects, it has created KParts and DCOP. KParts is used in Koffice for embedding application windows into each other, such as embedding a spreadsheet win-

•

DCOP (Desktop Communication Protocol, GeneNfbnm (Owilbumebome.cam) Is aTamnlo-based and pronounced dee-cop) will be used to IT manager,musicianandwriter wnaapsrates asmall manage object massaging communications. farm ofLinusservers. Backissuesof this seriesare It's the new cop directing massaging traffic avsnableonhis Website at

btlp: //www.NorthernJournoTeem .

behind the scenes.

'i' j(J Intel Celeson384CPU,Ceoln0 yan PS/PNI100Mht MnlnSoanl

d4MS PC100 SDRRM

•

8••

88 at Price

CONPOTERS $21W.Sythgw. ICem hieal Sythl Vanteuwr,D.C.V4PIRS yeh329429$ hs: 3294$96 8malhdlynm(80ysem ye.tom Wohsitenaww.0ynmymem

1.44NSPDD/ 402CDRDM 3DWavetahle SoundPro

SdKy/9/D890PO Modem 12SW Syeahms/tower Case

SustnessHears

10:NIM4MSPM W.STOh Aua. M toL 8 NoS doy

lo 12:NPMMMOPM

Visit es atWWWe

® COmp I I eCOm for details

I M

•

1$" SVSA Ioaltor 36hM60021200 dtfl Ssaaner CaaoaNC1000 Color Poiater tdamIN/499/4M/$8 Ntt/919/Mt/199/IN9 NRN/499/Njmt/IN/999/IN Stu/99lt/litt/1199/1249/l119

Sei'res,(eepeaeets,S ys tesaserreere„, F E T

•

107KWIN9880/20Mnusew/Pad

• No N lontfsfy Pee

• Unlimited LsJetime Internet Access G ~ E~ t. c. ~ CFv~ I Ataol rtant AC Ca mSS please calf ms or visit oar store for derails

An prices rennet a%cosh discount ond subject to chonna without notice. 88 APRILsppp THE Cottpurm Papev BC EDITCN www.csnadacompvtas.mm

•

c T ECH E N T E RPRIS E

M U LTI M E D I A

3 6 5 w . s R o A o w A v B7 2 - 0 4 0 0 HE SERT S O F T WARE S TO R E.

Eeamgh server ft gateway Continuedfrom page 76

RI I

0 CANCLLAE 4la OANC H2 0 C'ACIN4 DLE 1 0

of your Internet connection and internet servi ce provider. If y our connection to t h e

Internet ia via an fithernet card, you have two network interj'ace cards (NICS) to configure. Otherwise, you just have one. Fortunateiy, the

configuration is performed automatically if

We Are Authorized Dealer of:

'Wf3tlVB ' l l j inl'I'2<l

CONPAQ amapro

which iSperformed using a Web browser. There is no graphical user interface running on the server, which means that all of its processing power ia free for the tasks it performs. Asuming that the TCP (transmission con-

troi protocol) is correcdy configured and working on your workstations, all you have to do is type in the following URLin your Web browser: http: //t92.t68.1.1/e-smith.manager/. (Tbia assumes you' ve used the suggested IP address.) A Webpagewill pop up with the following list of links down the left-hand side: • grates password • euatty seghga • Date SISt time

«Tnpeless Bacfrrrp Detice

j tgC

duru loss, or efru HD bees for Jnurrerfi

II'etgrecoveryour lust frsin ftofnyusr luffd drive twsif it hes hckw Flgrl, Ffftmarrtrl. Ddtrcfr or crufaclf ia general.

Network Control Svtem: K6-1 (3D) 650 g 829 P II Celeron-433 $ 83 9 K6-3 4ijo fi nil P I I I-633 1 I I (6 P III-560 $1189 p I I I-600 g 1116 All Systems include: OJ MBRAM(I IMB rw a(-2 2 C Ivklal

ul <In clue HAN nllu I IJ I'nff «CX Cn.al)M I)ulf Anr ATTHlflkuuSMU VI I C .sa

• ONLANO C++ 410 1 •

401cc 34

H ACIC CA1ecf PLV • MANIC TNC Ok'INCWNC Mkclaa Cn k D ELI N HAW:kk RACINO 2

powc1 cNcsa

• NkaaW WANNION

S ANSIE DETECTIVE

TOP Ouu wiC AT WILL T4NC RAIRCa 2

OANOIC NI CINE CLUE

TOTAL ANNINILATI4N

an i l e CUeca spoaTC 30

I'wv«l «J». Rl«, Ivf I " EVIL2 II wl I I S IIP Ia-I • H l

System lipgradc IHM 1 .1«w I »2» 22 I I 'Nl

Am OJMu IIIUW» kvu)la THILI '1 Sk( I '

AI II fv

Hla I >Vo noh t I 2 1 .

JNIJ I I '

11" Ivl 1«»

Specialize in: - Retail Shop gofttv:Ire df Hardware for P.O.S. systetn.

SPECIAL DEAL ffkrrite mffrrrfrr g 1. 7fif The first time around. these links should be BASF CDR hlank disk g 17 lomega ZIP Disk accessed in the listed order. Subsequently, of course, one or more can be accessed and com- Diamond V770 32M AGP $ I 5I) manda performed in any order. These links Ensoniq PCI Sound Card $ 79 offer the following controls. jwijj Plj/Celeron LX Board g 59 • System password: Access to the manager is tontrofied by a usernamepassword combi- I will Socket-7 (Kfr-2 j ihoard gf 87 itvijl pll Iv/ UW SCSI hoard g lgfi nation, which you can change at any time. • Security settings: This controls telnet access lwill Dalai PIII BX Board g '2(>I) to the manager. The «hoices are no access 83-l3986 C2mbie Rd, Richmood V6V?KJ (moat secure), private (access via LAN), or Tcl: (604)23 I-9726 Fsk: (aua)23 I-Oefiti public (accessvia the Internet). The laner is Emsil: info(aioetwork-control.cuaf

designed to allow for remote problem diagWeb site; tfitp:dwww.oetwortwrontrol.csm nosis and resolution. It can be turned on aa required to allow a consultant to help you, HUDrsf Mok-I ri 9:3Ua n-o:0(1tfm for example. fiat lO:10km-t-ll)pm • Date 2nd time Does just what it says. CLOSED Sun ft Puhhc I Iolidays PRICKSAsc Alki E11' Tu I NANI I 'k I fuul I I U I 1'I. • Name and domain settings: Windows

TNOPNT skac 2

ek 10

ALI'NA CKN1ANNI

ea 144 IS 20

oakcau Nv sek saeva vs

CLaic C4NNAT • DELTA I Oaks 2

Dakcau Hkv aek paav4 lsa

DCCCCNT 3

Eaet CO CatATO1 V40LE131 CUOOOA MU L tRO 00 FINCWaisa VCNCION 3 170 Ml l• 170 taaalwao 170

TNOPNT RIVCae TNOPIN 4UCE

D AVIQMIN • Saa os

WANCNAFT 2 WANNAMNCi Cs K

Okwoeoa Waar SL A. •

I•

L AECLO • INLSNICS I M

I•

Loaf • F OVNN

DAVIOCUN AUTN W W l i

LOTUC • NANT EUITC MIL 20 M ACMILLAN 230,000 CLI'I0 I kk MARNNCEN Vs

I•

OATI NUN NKAOIN4VOCAS I 0 D kvalkoN 4FCLLINO 4L 1 0

DAVI 4NN WNI Tule SAWN I • DICNCT Wlv Clan I• OISNET WINNIC TNCPIWH Ia

Da • scca KIN4CECAET 10 fl asaa PNICCCONNNCT ls toESSI I Iau I 0 t kCSNI FISH DLE SUN 2 0 JNNPETMIT TCI O N N C I• JVNPaln f f w 0 1 H ATNN

JUleeafn T l w

0 1 REka I •

JUM PiIANT END ONAO E

I •

JUHFNTA11 RNO Oa MATNT • J u IFWANT 110 CRANE I • J useafAET 411 01AEC I • J UHPSIANT NTN C1Aac I • J uuewkaf EWI CRANE 2 A 24 J UNewkaf M s v J ENPwk1T KINECacisl n J UUesTA1T PNCN NOOL i 4 J NNPETAOT iIANIEH J UNPETA1T TOOOI.CN

JVNPETA11 fveala

w a eavksv t n k a

s ls elk STVC14 OLE Leak CNEOS

Lcco CacATaa I ECO FNICN40

LCOO ICLAN O LCCO RACCNE LRC4 NOCN N I OE1 •

0 24

I• 1• I• kk A4 •4 10

•k

LIVINC SN ANTNV1ai a ATT 4 LIVINC 01 ANTNUN'ECSNPT •

Llvlaa SN.AlrluuasaaAO I • L IVINC 41 CAT IN HAT

I•

LITINC SK Ds sucoa AOCTC LIV SN.DN • CNECN CCCCI • LIV 41 Hk a avAN4 NAUNTO

UV Siu t a f a 1ANONAwlaa LIV WI NKW Kla Llv SK SNEILA lfka

1 U v sc CTEI.MLUNA le LIV Sk'Taafule\ • HA1C 14 LIT sk ANTNVNO t EACN 0 l kwICAL J 24O I • INI • 0 MASELINE RAIN • DAT 2C M AOELINC vsl NUNC 24

Hkf w a aaauae

Nv l • SEACkN TTFSI410 I •

Ms Mwwn a

i lu t w LC 10

Ms Nkclc ssu • • uc\

M UFP4T T1EACU1C ISL 0 Ia oi E N N T i A I L 3 ONLT'E ONW A STONT 0 PAJWIA NAM DLE SUNN 2 0

A n

C SK 1 1 1 C ka n l 4 1

A NT lava CVINC 14 Osl • 3 0

MCAFCK VNIU0 ECAN

Accaknwaa 2 awekkv Is a MCAPRC Ol'I ICC • Cka SIOLE

•k

41U Fke Lucia

• eas Rws

4 EU LINUE04 NUC1CIAL 2 0 0 CALOKNA 2 EENVKN ' In Ckl.sack OPWIUNIW2 3 20 CIVILMATION FO1 LINIS 0 0

CONFLETR 101410 sulsc

20 •0 CCNEL LINVE C4iEL LINui DCLVAE 00 C01EL Wf SUITE ELINui 7k $0 OCNIWI OI%CIAL • NIER CaLITAME LINNE 30 FOEK 404 2. • 34

Fisc aso cautkavcasna F ICE SSD t O W E NIACN CNU ASCNIVCC

01 •4

Hcaawc a fsa Ukuc

HEROCN 2 Foa LINUE 4 0 L CARNINc D40IAN OHU 3 0 LMUEANvANCENREI 40 L NIUE CONPI.ETC REF As Lluuc • MANORANC 0 S 4 Lsalc SUANICEV AI'I' • 2 0 LINUE Coa • KENNEL Coaks

Uuuk Naval.an n

kl • taONTPASC 2000

la 10 10 4

Mi PNCNTNOC Eon Ue is Ms HALLHAak C1CCTINC 0

Maoeelcc 2000 sa suesss Ma OtplcaCK SN •uvupREO M a Otl'ICK 2000 010 Ul 2t s

Ns OFFICEwws Paa

400

Ms OFFICC I14 2000 UPSCO

Ms 4I'wcc pao slfn\N704 Hs PN414NNAW H • PUELIENER 2440

L INUE I al eut Nkovf I R P U NVE HCTVloak AONIN 3 0

LINIM Onl ca Acta

•

Lwuc os • Iwnaalouak 00 Lsaw Paac Waf RICCS kk LINN S CICNEE • TECNN 0 L INUE CTOTCN ANNI N • L INUE T4OL0 • U TN. • • LNIUi JkuiNAI.

UNIM OFFICE •ultc 00 00

00 H AN4akk\ 7 MAEINON LNIUE sckuaf140

Ha Ea atlas vaRas Hw Ai D 1C LLT LINIW SkiNLF Dl a W I U NEC OEV • ERL ni k A L C 1 1 IT EIN t COL Co N WNSNELT

Ms Wlkoows 00 Eas Eo 100

Hs wlNsawo HT wasksvlso

Hs WINNT SENVca 10UNECS

Ma woin 20 0 0 44 Hs wain su pw 2 000 I n

Rcs HAv Lwuk fai o u a 40 Naa NAT LINN Sanc f a 4 0 4ANNA 00

ONNINOC Paa ls

P AIHTC1 CLI N I C PAIN121 SD PAINTSHOP Pka • PANTltlak MASIC 4 • ON 1 •

lka

20 00

200 • C ANTWNEEEHRIalwa 0 0 WIECN 5 00 IWINT ANT lsf • PL ATINH 2k t oINT SN4P • DELIMK 2 0 PNIN'WNOP PNCIAIKi 10 PNINTaasl • ICNATUEE I • P NINTNANTCS PSCNIC1 72 0 PNOCONN PLUO 31

oulckcN Cosa ocklwa 00

nl cn » ec Hosaene 0 0 4 ulckcN 2000 salve RVICNTAECoos

S VICkit uks Pao 2n o

00 20 30

fn 20k •0 I•

SUER LINN ALPHA

Csuevo»'• cucv kaso

1•

TV1C4 LINUE

Nckoca Nkoalv Eua ee a R CAOEa RkosIT KINO • N CAOCN NAREIT HATN 1 E i cA4C1 Nklkfa Jl U 0 REA041 R1CA4 JOUNM 0 RCAOC1 RAOOIT sk 1 I 0 NCAOE1 1 SOrt i a k a 2 4 Rcko\1 SAONIT Rake 0 1 cAOAI Nn o f N c A00 2 0

uueca Tke 1 a

• NEANTA 00

svaaw ko k WCAVWI DL • T RLCTUEO \ 0

TNEksuaC COTE T NN EUOC MATN Efou a T NEAAUNE HauNTANI

TNEEN4uac

T1IPLE TNEM

0 0

wac1K Cksaau wait

WNCA4 CAiacu J1 W NEaa C I E N UE A

0 0

WNENE CANNCN Skl o a k l • W E l • T I N C CANN C I• WNC1E WA1LO CWI.MA112A

00 CkatLETE LAN O OCCICN Rk

Ns CLan Caaskf •

H a CONCAT FUCNT 411 3 0 M s FLIONT •IN 2000 00

MS f LlaNT SNIREECI Pea 40 MS MONE11A'TNVCE 2 MTWI 2

Nkn k a LCCCNNE NSA ROSS

30 •4

I•

sukac 1

NAINS4'If • COLO SCVOI.T RI • INC CVN INC'Nl SIVCN WITH ATNAT 40

Rouse Sl'EAN

00 10

IHILLCNCOACTCN tICEON 30

• EsA NLLT 2

•k 01 •0 •0 N L DIKR 4I w l a f uN C 00 STAN WA10 W IRCC Caa CALL • fANCNAtT 10 af k n n t f S A TILKANEET ai • NICN 7 WWD 4INS SLAVC SEND

• U.av I'lksaca

• WAT 2 EWTCI S N OCR 2 TCTWE COLO TNIAF COI.O T INENIAI 4 U N

Ta lo kkalCk •

•0

$0 •0 •

•

M 34 •0

TaTAL ANNILILAT RINCEN I • ULTNIA ACCNNION 04 ULTINA ONUNE ENP ACR kk U Ni CAL TOUNNANKNT 14

WkaCNAI't si T I L ECacsf 24 W Aacakff SATTLCNaf 2 4 WCW NITND WNKCILINC I •

SOLDIER of FORTUNE also

CONI 10N' • Rce C4 L • CoeNO VMTVAL NAIWCN 20 CNCANTA R400 • NCNT 200 0 Dl k ENCA11AEna 1E 1 Vf

wlcvckaeawk sas ak

•0 00 1 10

I A Lf visC Nkkaia C D E S ONCLIE1O ENCT 00 •

Haasa eaa HEALTN I

1 NE A 1 D E 0

• EU N C CT PNEN N CU L I • 1CWNC ST TOIWLN • DLE I •

20 •0 E NSNT • MACIC • (NEWI 4 1

HccNwnwoa 3

3 0 HONK DKCICN • Nlfc E P 10 • I • I.C LI0 1 N T CANAOI*N STV4CNT ENCT2A

NcAoca NA0011 ENQ oa 0

Skawuk seaklsoueo

• lkafoaa ooko

R I IIIH 00

Uuai L4 1000

kk Ni 30 04

Naavau Ufwlvlae eooo 20

CAN 4 lk l C N CT DL C CSN 0 WONLD CNCT • E

Sckeci NACOIT TOORLci4

Ewaw» wkas Rueav 0

04 10 34 I• •0 •4

•0

•P 40

N CA C

1 410 KONC TNNN4NC JANEE f/A I • J Et FA I I IW

•4

Ck N I C I •

•

Pl.lNcNAFE Toaacuf

414i s L INU1 2000 • LME LINUE • .5 4UEE LINNE OVO

ucwa • M~s w a • fe a s

•

Hn a aa OF HOM MILL CN04 Sk NON RWO IUI

HHL 2OSS

Pke I H AN EC ECICNCC 2k MITf PUTT DLE SNNOLE 20 NCAOCa RAaalv IST Ci 0

UAC1 ta l a ua 1

HALF L Ot n a I NC f a i CC 00 NEAVT CITAN 2 HEaaEO sl ANNAoC4aak 00

• NAAAON

N*114N nwvaa • CKtaois

4LACNWNC 7 SIACNWAN • 7

•0 0

HALI Un n n aevi

Hcas iecED HMHNAEC is

P 0 I N l a u EC CNCLI • Rk

Tuc PENCUIN 0'

QIAOLO + 411ATCCI Ca •0 10 ONIVCN Euaol'U N Aul Wka RO •1 cvci4UN T 10 • ETNCNC SINCE PIFA kns 04 00 laakk fkivksv • SACMEL NNIONT 1 n WINK CN CKC1 lk o k*NO 1Niet AUTO 2 40 N ALt U f E ASNENALINC 0 0

Na1T0N NI111Ncl Sc c

Maafaa CLEANncct2K 10

2A •0

• ao I Hl au sk MAT

N4114N kN TIVI1V • wwo n

IfiT ONCAN 14 • Evea Naavau'0 conk a s • IHI LT 3D osaka 3 ARENA . LINUC 00 • INFLT ACCkuNTINC V 7 l k k REP HAT • .I ST ANSANO 10 T kl IN 1 1 n 1 • 00 Ras HAT • . I D N 00 24 WINf kk • S A EIC l f k Wlaekc Pao • R Ca HAT • .I . P l w •0

Rca Nkf LINN • I • I.c Sk R NNNINO UNVE Sss 20 3 0

Ia D caccNT faccapkcc 2 4 0

Nncn 3

IWOS • A N O UNTIN C 12 4 IWOS • P U I • ACWIUNTN I 00

As R ulkkTAE 2400 DLE kk s slckaaokacsoo 30 4t

Sk 10

H CCN • INATCO INCWI

13 0

H sww saut cia co t c s

ss DolckcN n s o 010

Ukua wn voaka

Ms wINaows 22 pao Nests Ms wlkson RK paa A2p

N EQ 24 N0114N UNINCTAI.L

As LININ PNICWALLC LINN Fa a DV NNIEE LINIM I 41 a U N NICO OCK 22 L INVE CANCO 4 ENTC11 0 LINIM 4 1 k t s l CSENORMN 1

Cc ken 3

cel- KAU.va cowes

o kvloso» • kso A. •

o kvwko» • saa 0-Ia n osaacau waeueulca a I •

• LECH PLATCTATENVLTN 30

CNE TC A Ckn P LNC Vk I • tw t N I V S S TANOASO 12 0

• Luco CLucs • INTNOAT l a

0 0

20 24 14 kk NAUNIO \Cava COLLCTN sc

C HC00NAATAN Tn o

CasTCUCan faa Vi

k e s k C t LM I TA N 4ALSU1 • CATC

coacl. we Coos paa 70 CaacLWPOI 2KP14+ DOC los

Dwvc Inac

1002 AD INCWl

AUCN Cakow INE

Ol • I WEAVCN Va 170 ONCANWCAVCS VS+ F1WK201

0 0

D AME S L I S T E D A RE N E W W E A L S O S UY I S E LLEI TRA D E Acc al catwco Akc ae Kwas

• 74

CONEL DNAW 7 CONCL DNAN • CaAKI. DRAW • CNSCL Wl' 0111C • C 01EL WP OFFICC 1000

EpAcc INvksaae

• OP I SP

Csof asl Ca Co LANCLV 00

0 0 • 0 0

ENANENAI • ILENT TNUNDCN

150

okkakoka caakvsasokkl •

• 1TC \ •

Laleuac Uwaf n w u e •

2ks

AN E C N EN I • N

0 0 0 0

SARCIC C4TTA Ciosvc

•0

A aasE ILWN NATON •

A oksc PHaTOENOP 4JI k c s

kcNO t1TNEN •

ko ukvaA Rkalo eouva 30

kol 2000

k lHISC PASANAKC1 4 0+ $ 0 4

NIWLE SOLITAINC INTENETATE vi

Iks MANIC Ssu • kkINFOE I • M4 HA4IC 40U • EEIA N • I• Ms Oktkua

Il K I '21V»KVI;kklwl w lb.INt 2 112

Wulec Iv Ilwsa Mwlw

Continued ou page91

H4AVT CEAN HOTLE CA0114

okwaaaa sakawsaks-ale okwosok aako s wale 1 0

B«caup end rmrere lf D Ilare in Iniuuret; Prolecl yfmr rlera from syalcm crurfirec,

• LDAP dlrectety

Generalemail settings User accounts iafermaben bays create starterhomepage Generalsystemiatermatiea Support aad licensing information Backup or realere Retrnt er shutdown

0 0

D AW410N MATN aac AL N OAVION N N C AOINOSLA.4 Is

,„J I'u!(j, Ifv g tfft

• Name aad domain settings • • • • • • • •

gl kago InvontcIy gj match pacer S gloclt solocaon gl more In alack gi Esckaodou gl icut shipping

Faa

okwoaa» sans w.ALa I •

'Setup Mrrlfiple PC's fnr

LAN for the remaining configuradon work,

Ef WWS

okwokau lwn O L ot

you choose that option. i tried several sup- sfraring Rogers Wave sr ADSL! portedEthernetcards,and they were allrec- On-Site Jcrsy Jfrufff ognized correctly, A simple test confirms the Internet connec- - Ilvlud 1 kfru ellvrge fi <Im Rogers I r y tl l l l tion. It takes seconds, and if successful, you *Best Data Recovery Services can move over to another computer on your

cosun o e cokauaa

S easy to deal wllh

SD UL11A LIONKL 'faAI 30

tuiE I IAI-SAT 1 0 - 6 , s u tu 1 1 - 5 WW W S O F T W A R E S Q C E I I Ve

k een Aaaoaw v •

• cecnca 2

The Computer Company

•

% I I I S RtR

Asfcaa Ns

more configuration work related to the nature

I haven't been using e-smit h longenough to have an opinion on longterm stabibty,butthe setup processwas easier thanin Windows NT,and perf ormance seems to be better, too. As for price, there's no comparison at all

•

L • WOCE OL N l

skalw s n sl caa usa • CoaefaWE Nce coL •

0 C OIWTON • CNCT 00 0 CONCI WILS CANO CANC 0 D ESTINATISN CAETLE 4 NEONNAT 4 s klNHI Iw • EOTENTIAL PEENA 0

C aoksn a a e

wakes tales-cksv • s f euaa tales.tlaAvcsats PW NEN Pa Cc WILOWC4TS 1 H41LMO CNILNEEN • Cul 0

01 0 U E O CNCT 00

I NOIAN IN CVIWOANO JUNPETANT CFANIEN KINC • SVCET 7

•

0 N C L CA N O A A C I o

L ANEVACE L Pufk a

I•

LANOVAOE L FNEN C

I•

LANCVAca L oc N N

L ANCUAOC LCi CC K

Lnkukak I. Hcsaaw

Ll NCVACC L HUNCANIAN LANCNACE L NICONCSIAN L ANANACC L IT LIA N L MICVACC L JAtkNN E L ANOVAOC L NONCA N L ANOVACK L NANON I N

LANOVACC L Paws

I S MEN E H N TMNWH I

I• I • I• ls I• I•

LkNCVAAC L SUCEIAN

10 10

LAN4ukaC L EFAN SCEIN I •

LAN4UACC L CFANIOH INTI • L ANCUAS4 L TACALQO I• LANCVACC L VIETN N ECC10

4 NI4NTT HATN H ONETEN Tl UCN N O N E 0

Ln a u To Sek RNCLliu 2 4 Len a Tu st I f k a NC« Lcn u T o • I'K CENNAN 2 A

Ns WILF

40 M k c 4casueca kas 0 DCEANO ECLOW P 1 Nk k l k k S V IT C 5 NCAOE1 IU E SIT LET • 4 1 4 NEAOCE Iwas 1 RCAO

• ONAT

sctkaa sv *Nv wakoue 0 • ekca ne et •

• 101'wouk w4ATE1

CUCN D P D L I TA N V I R T UA I I k k c E D V E R O L N l e 4 9

LEANN 10 sea sewaa MAVI• Scn

N M a 'INC la 24

M anA H co e Su c v I 0 2A M usk Nn c a fw aaa E«cvckatcou Ia Is I C SWVCN oak HaN RACIO 10

RUICKVCNEC CNM C TIAN I •

TAI CNI TOTAL ED NONE DCLUEE RO

C TN TKCT CNALL\NCCN 0 'TWN 4 'F N I « S 4 T al C U N W II C T W I L L •

UNttvfRiggg

Lwlcuksa L toaTuacaE 10

'0 0

MAala'e Ckakv Tak10 0

A NSHV D IAADIC D o o k

4uaacT weal cAaocN • •

Waaavaaa D uf 1 fuse Toa A

LAND Dv s c e svo wwask WITH PCUAl. O S H I FT Ok o

•

I •

LAIAIS JDT STICK

LAIHN O A M EPAD

I•

kav J..I% I u a f EEVITI. Iktl ' URCNAIF-'

aksw~.

cs.corn THE COTIPUTEFIPAPER BC EDITION APRILreeo 89

c PLATFORIII NEWS n

Bxplorlnfi Windows 8000 On the home orsmall businessdesktop sys98. However, the bottom line is that with 29 Continuedfrom page 86 million lines of newcode, Microsoft hasdone tem, the decision to switch wifi be much MB of RAM. The minimum memory thresh- a sterling job of delivering a version of NT on tougher. This is the category in which the price old far this OS is 64 MB, but we found 96 MB the desktop that is generally kster. of the OSandpossible expenseof hardware and wasoptimum. This RAM incrmsewill be quite memory upgradeswill be kit the most. I ayee f PC World who eauuons astep up formany users,andmay forcea rela- Who ls going to like Windows 8000 Pray with Scott tively expensivecomputer upyade. Firstamong the likdy kns of this new OSare against hasty upyades.You really have to be In testing the running times we experienced security~nscious users who will appreciate sure tocheckthat all yourkeyprograms,devices with Windows 98 and Windows 2000 Pro on the improvements over Windows 98's security and data (espedally if they are more than two the sameDdl machine (loading Windows2000 katures. NTPS, for example, allowspowerful years old) don't go AWOL on Windows 2000 Pro afier completely wiping oif Windows 98), security access rights to beplaced on files, fold- hn. On th» positive side, it's easier than ever to for some reason we found Windows 2000 Pro ers, and even processes. In addition, it is fairly chtuk your existingsystem'scompatibility with startup timesfor applications to be quite vari- easy to transparently encrypt files. the new OS bychecking tech supp ort Websites able —asmuch as plus or minus 30 percent. Also, accessto your machine and sharing of before divingheadfirst into aninstallation.

Spanbauero

Our results seem to support Microsoft's own beachmarks. At 64 MB of mmnory or morc on a 200 MHz or better Pentium, Windows 2000 Pro outperforms Windows 98 by about 20 percent on average,' but by as much as60 percent.However, these times may be hard to duplicate because of the wide variation in performance, especially on startup. We noted that Windows 2000 Pro had a ten-

wait and sm how wdl WINE runs Windows ap ps—but at least the price ofLinux is right. In fact; price is the problem with this new OS. In Windows 2000 Pro, Micmsoft is delivering what it should have in Windows NT 4.0 four years ago, but the price is wrong. Most

hardwareand sokware priceshave declined by

ofl'er may bewonh the wait, specially far the reachedfor comment at jbsurvOlnforamp,neh

ed onthe hackers finding hugely unattended machines with no accessprotection.

Finally, support for PKI and other security for massaging, plus online file synchroniza-

tion in a backgmund process like in lava demo software aad processesoften emulating dues-fi er architccturcs.Windows 2000 Pro no We also found that several tests—like Visual Basic compile and runtimes, copying files longer playssecond fiddle to Windows 98 in

terms of support for devices, USBand DVD,

putationally intensive programs (for example, and much improved power management. That a Java pmgram that generatesthe first 99,999 the OS will not die in the bluescreea of death prime aumbers) —ran nearly identically the every 5.I days (or oncetoo ofien), will alsobe on Windows 2000 Pro as they did on Windows most welcome. Road warriors convert!

Runtilnes: Windows2000 Provs. Windows98 . twxdaws08 Test Nzdbws2000 ' Pro install fanewly(bimztfed herddisk .:; ~y..t ' 1 hr.„g mfh. rzu:,;- 4 8 mfn. ., ~='.tf', 1mfn.',40ssc. ',4 . 1izia„20 sec.' Beef-uptime, ,'~"<' „; 19 ssc' 12.ssc' Shutdown1!me '' 3 ssc.'/2 sec. ) Igbk) 5 sec./3 ssz Microsoftwordstar!up/ faad120!I du' 4 sec.'/2 sec. s@T . 4zsc. / ffA fdiazsahface! star!up/ !badIOOKBsfmst .

tscms ah/fccssssfansp/ lead2 hfgdatabase 2 ssc. /2sac.. xrffkhl 3 sdz. /2 ssc.' Adqbs/zzbbafafar!up/ !bad 1!80 dsc. . Ctrel wardpwfacfstar!up'/fbad120KB'dec. Cora!PfmtePafnf Star!up/ !maga prOCeSS. JASCPsfzfghep Pro/ Imageprocess. '

g ; 'lI -

• SDRAM 16SPIN PC133, IpC10o,Note Book RAM 144PIN • EDO, Fast Page, Tive Payfj/ • Intel-Pentium III,II, Celeran-Pentilfm • ANJDKT, K6 • Ufetinle Wangntj/On MemOfjr NOdule

ffia Bmm r /12mm,

Ssec./30 ssc.

Since Il l

Mphdsy-Fr iday11:00am -7: 00pm .Saturday 11:00 sm -0:00pm Sunda 8 Holidz pc!oped

PENTIUM SYSTEMS

Pill - 5$8.....

..... B1460

PIII-550 „„, Pill - BOO PNI - 650

B1460 $1620 B2730 ......... $17$0

' Vnith fatal CPf/ 8 faa ' ASUS Pavax matarbazntftssfuHZ) ' SSMS SpftAM (1SSPin) ' 10.200 HDD(tfDMA) ' 1.44MS fz 1/2 IFlopsv ' ATI Xpwmpw/8MS AGPVideo Cmd 15 Nll LlmSVGA 2adp Monitor ' cax CD ROM SoundSlastsr Lfvgf fValva) am VWSpaakis w/ Svbweofw Arx Case '1aaWindows Sz Kafeamd itsch 2 ballan Mouse 8 Pad

CELEIION SBBA--- ---- .....,. $910 CELERON 00$A.. .................SBSS CELEIlON BOOA.......,.....„„. $1 (IRf) PII-400 .................~ 2020 Pill - 550....,......,...,....................$127B ' wlm Intel Cpu S Fwr ' pevsum Momemaard

' earns sawAM (isa Plaf ' s.a Gs Haa (UaMA) ' iAsMs fs 1IR') moper ' Aap video ' is' Na Un svQA .aaepsrenzor 'aax GDRoM so sound ' 14aw Savazwv (Ama) ' Avx nese iaa windows $5 Keyaoaol ' Mouse & Pad

sex Fax Mermm(v so) wllh twilwa ie/iaa sass-T wvtcavr+ris

I I

htadsm 56K PaxlVoica !eternal (v.sp) v850

Hard Orive/htamoty Monitor 1 5 ta 1 T 028dp +8180 (pfaasa eall)

rusessvsfsrt is uwlzs wilhvupiss vasss Cars uvt arvr

AM Di,l

c s ev

Alfpredvcl names. trademaihsaad rap!stared tmdemaizs are pmpehles ef their raspscllva owners 00 APRILZbap THECOMPt/fsn PAPER SC 80fMN www.~ v

12 SSC.'/20 SSC.

0ssc.'/33 sec.

CR COMPLITEll OUTLET Tnl:($04)271-2583 Fax:(604)278-2661 118-4800,Na.3 Road. Richmond. Ip.G. Gnnsda VBX 3AB

Pill - 667.........

• SPBCifilidny in WhOleSale and diStributiOn

2 s ac. /5 sec, , „;2 sec./4 sse,: 1! sec.'/0 sec. ' '9th '"" 9 tzc /6 ssc.

OoU7lL •

lf1$'"6 Pentfum

* Whereraiiadbaswere morethan 20perceaf, thesereadhss arefhemeari.

N225 - 10'711 Camb|tg ROad Richmond, B.C. V6X 365 T(BLI(604) 821-1178 FaX: (604) 821-110? .:y... K-mailr mhi©intepglate.bc.ca

www.memciryhouseinc.corn

5ssc.'/1 sac. :;:,„.'- g 7 ssc,/3mm.

Mitresa hPublisher sfarlzp/ faad600KBdac.

NKNORY HOUSE INC.

ps~

ever expandingsetof Linuxapps.Wewill have to

attacks on e-commerce Web siteshave depend-

simple Open File dialogue become vcrrrry 2000 Pro are road warrio~rofessionafs slow thc tenth time it openml —almost as if who have to lug a laptop with dual operating Windows2000 Pro weredoing garbagecollec- systems and 10 to 20 GB in files, and prepare to

LD Q

new ease of use and 3D/multimedia katures. Cord Unux will give reliabiTity andsecurity largely on par with Windows 2000; plus it will run an

small becauserecent denial of service (DOS)

occurr«ness were not isolated to startup tests. not a step ahmd af, Mac, Linux, Unix and ln particular, Wiadows 2000 Pro can hiccup at other desktop OSes. strangetimes. For example, a previously zippy, A second group who will welcome Windows

in@,

Windowsbusinessand gaming apps, plussome

Also duc mmetime before July are Miciosofi 40 to 70 percent in that period. Windows Windows Millennium Etlition (the upyade to 2000's pricing definitely bucks that trend. (2 Windaws 98) and Core) Iinux with its WINE Windows emulator. Seeing what they have to JacquesSuiveyeris a consultant axdwife/ Hecanbe

itsresources are subjectto the same Kerberos securit y used in Windows 2000 Server.This is important to many organizations large and

dency toward pitching slowness fits. These tions puts Windows 2000 Pro on par with, if

(even on the new NTFS filesystem) and com-

home and small businessuser. Windows ME will satisfy users who want the broad range af

lezcom

TIIIIEE TMI UIOUA ANDONETHLII PAIITSWAIIINIIY FORSTSIENS We do

We care iv

c TECH E N TERPRISE 0 B-smithserver B gatewsy Continuedfrom page 89

Before I installed c-smith server & gateway

Version 4.0 is in beta, and may be released by

and conflguration experienccs arc pleasant,

on my aetwork, I was using a similar setup the tbne you read this column. It supports and no more dijrlcult than in Windows. The

workgroup and server name, for Windows

based on Windows NT that consisted of third- more Internet connection scenarios, and is party gateway/proxy and mail server pro- more flexible, too. For example, version 4.0 lets • LDAP directory: This is a hating of user grams. I haven't baca using e-smith long you determine how often the mail server accounts, which can be accesswl by any enough to have an opinion on long-term sta- checks for mail in a dialup situation, and it LDAP dient. Access can be conuollcd. bility, but the setup process was easier than in gives you better control over things such as • General email settingn Principally, this is to Windows NT, and performance seems to be incoming messages that are incorrectly contml access to your POP server. and to set better, too. As for price, there's no comparison addressed. the mail rctricval mode. The standard mode at alL In summary, this is an excellent Internet is appropriate for most dedicated connecI tested version 3. I of the e-smith product. solution for small businesses. The installation

rde sharing.

software is free, although there is a modest charge if you want a CD-ROM and printed manual. Support contracts are available at a reasonable cost, and are a good security blanket,cape«iafl y for Linux newcomers. For more information, visit htip://www.e-

smiihaet, where you can download the manual, determine the suitability of your hardware, and read some interesting success stories. 0

tions, but for dialup. you should choose BTRN if your ISP supports that protocoL Otherwise, you choose multi-drop mode. • User accounts: This is where you create a

user name and password for each of your

InternetBusiness?

users. • Information bays:Crmte information bays

and manage passwords on information bays. This isa rde sharing and collaboration tool, which may bc as useful as the Internet services in some offlces.

E-Commerce solutions for everyone

There arc other links, which are fairly straightforward. Once this stage is reached, you can start to test the server. As a gateway, it

yourname.ca or yourname.corn

can be run as aproxy or not. It is easier to run your Web browser without any configuration at alL It will simply connect to a Web site as though it had a direct connection to the Internet. I'm currently running in p mxy mode, which means I have to input the IP address of the e-smith server in my Web browser. All the basic protocols are supported, induding Real Audio and Video. The only one I care about that isn't currently supported is Microsoft NetMeeting.

Fully loaded web store 5 45fmo. - 50 MB disk space, - 2 GB trafficimonth - 10 mailboxes - Frontpage 9 8 server extensions

- web based control panel - web site statistics, etc. - FREE Miva Merchant™ shopping cart software (retail value $495 US) featuring:

Free team Web portals Continued frompage76 • •

• •

- unlimited products - secure server integration - automatic tax B shipping calculations - email notifications of orders - online credit card authorization option - ready to use templates - browser based interface for store management and easy development

eorwoi the group and site aenrices oflemd each member. Chats. Ciacuasiona, Team News: Ways for team members to communicate. Calendars, Goals, Projects, MyTaska, TeamTaska:Methods ofmanaging tasks snlong ths team nlenlbes. Issues. Resolved Issues Suweya: Mechanisms for msoiving problems. Documents, unks: Ways to bring local or emote PC g tea/inionnarion to the ttengon of the gmup.

- FREE Miva Mia d evelopment

software package (retail value $99 US) 30 day money back guarantee!

To date, the OuickTeam interface is Ime of obtmsive ada ghe Seat/them site haa some, and Anyday haa more).Instead,CuickTeam gate its return by randng and/or selling s mom

aophiskcuted vesion of its team software. In sddxlon, g youl hss tssnl sits glowa ialger gwn 25 MB, Thoughtwee charges e monthly Iae for tha extra atesge. Based an my d sousskxw with companies at Comdex and ge recent Tennto Intenwt Worki event. these sites we just the tip of the icebwg in free team and coi aboreoon services on the Net. Ail the major pta ~ , Miwosoit, sun kgwosywalns-uriil soon be ogeing dkect access to their Slice sufle appflcadona over the IntemeL This means users will no longer need aoitware on their PCS. In addition, s host of dotcxun staruea we waldag m the wings to offer a bmad range ofteam aenri cea via Wab ponala.AOIOay. with its nifty cakmdadng and event listings, is an Incgcstion OI whet lies online for your team'a oolleagvs auenti~ it's just a hint

of whal's to cene. — Jacques Surveyor

Get

Looking forjust a entry level web site? Available for just $50 - one time fee.

FIRST fl/IOfd TH

Domain Plus - yourname.corn, business card web site and email>

FREE!

Canada's ¹1 jf jfeb Site Hosting Company

100% Canadian operated

INItNItinn CIIIlaiatius III. wuwso

swan

wvana

S I I I I - l vl-n i l

IC +40 1.07+lsu

nl. I s 0%0IISI.III

Il.llss.el s

fat+W.I.II0 1005

Aa+Isesvnvsrrs

IS+wc le l .l u x faa; csol w l I ~

www.netnation.ca 1 -8 8 8 - 2 7 7 - 0 0 0 0 International +1 iggdi 6BB-S946 E mail: s a i e sen e t n a t i o n . ca

Ic +I x u s s ) I I 5 l fm t 30 1 5xxnsl

lc 03 1 xsslcllll fc t 3I I s s l1 IIII

I c +4$ 0 0000770u f w +I l al s s lll Ill

Ieh 6 1 000llaIII I~ BI

'assis domainnamecuwrson av 0 oeuvres sr Ivertsc selup aw Ills Gsr vol induces. nirw 00efeatures wuecl lo changewitsaul no5w. As varavrav are the wvpvtl of the vvscwv ownerL

wwwcuudscompul es.cern THErQMPUIBIPruret SCBXOON APAILZCOO g'I

SIIfIIIPmzR

Online k Connected I nte r ne t

T r e n d s • W i r e d a nd W i r e l e s s • O n l i n e S e r v ic e s • W o r

8 P l a y o n t he We b

Apple Canada launches online store

Toronto papers create

Canada's largest online job site By Jeff Evans wo Toronto-based newspapers, the Gbrbe and Mail and the Toronto Srar,

have teamedup to createwhat they call a C anadian employment mega-site, Workopolis (klipd/Wrmnorkqmib.corn). The site,offi ciagy unveiled ata launch bash at Toronto's This is London dance dub, laa. 25, has more than 15,000 active job listiny,

• s a

• d, *

' se

Tji ~k,. ~ o ~

@~ZAN

five million pageviewsper month, and over 160,000 resumes on file. Bigcd as Canada's largest job site,

Workopolis isintended to offer the maximum amount of resources to both prospective

run Canadian operation based in Montrml, and can be expected to put up a good fi ght against the new competition,

The G/ebe and Star alliance, however, wifi be able toexploit the resources(classified job listings) of the many editions of the two dailies and the other newspapers they publish, whosereach is conccntratcd in but not limited to Ontario. While the Workopolis site hashad a few initial teething troubles —its aa-important search feature was down for more than two hours as this artide was being rcsesrched—it

ollowingthe lead of its U.S. parent, Apple

Canada has oilicially launched an online Apple atom for its Canadian customers. Dennis Manning, cgrector of corporate cornmunications for Apple Canada Ine. in Markkam, Ont, said the online store will have the same krok and feel as its U.S. countwpwt. and cger

Canadians the sane range of hardware and soitwale products.

Apple

is otherwiseimpressive.

Peters says that in addition to the millions of dollars spent on the site's stair and technolfor the site), and to job huaters (who canusc ogy in&astructure, more than $7 million is thc sitefor &ce). many programs and options for employers slated for marketing and advertising to proThc site is dearly and simply laid out, looking to use the site in their search for qual- mote thc Workopolis site in its first year. allowing job hunters to do quick smrchesby ified employees. One possible additional motive for the two keyword, or morc advanced searches by date, Employers can choose from thrm levds of competing Toronto dailies to make nice and location, or in alphsbeti«al order. lt has a wide programs for ongoing accessto Workopolis work together on Workopolis is the rise of range of customisable options, links to related resowccs, according to Peters. Monthly rates Conrad Black's National Post. In just over a articles &om both daily newspapers. and start at $1,500 and risc to about $2,000, year, the Posthas established itself as a distincother online resources. depending on the services desired. Srnagcr tiveforce in Canada's key urban newspaper Worlmpolis presideat Kim Peters says the businesses can also use the site, with rates markets —espcciagy Toronto — aud some of site is a major step forward from the G/ebe's starting at $200 per month for access to the that yuwth has been at the expease of the sresume management service,or$500 for Glebe. previous job site (Web surfers typing in the site' To date, the Pesrs Web activities have been globecarecrs. corn URL are automatically a singlejob posting. employers (who provide the mvenue stream

linked to the newsite). Peters says aB the essentials to make

lgortstcr colllpagbort Workopolis Canada's leading job site are in Worhopolis represents major competition for place, induding lots and lots of job listiny, the Monster job sites(httpyhnm.mmsiercamor

powerfuland simple search features,and

ktlpy/nwwmmsiw.ca). Monster has s very well

Compatibility is a big issue, and it is rare that his series of artides has systematically Wcb masters can be certain they are writing looked at ag of the pro paries belong- Web pages exdusively for one of the two ing to the seceding Style Sheets 1.0 major browsers. This issue becomes more (C5$1) specification. Thmughout ag of the complicated when it comes to CSS, because code emunples and comments about bmwscr there are differences in CSScompatibility not compatibility, not much has been said about only betwmn the versions of each browser, when andwhereyou should actually useCSS but also between the versions of the same in your Wcb pages.There is no definitive browser when viewed under differentoperatanswer to this question. However, if an ing systems. This is where having a browseranmver hsd to be given. it would be "it compatibility listing handy (such as the one depends." printed in last month's issueof TCP) is crucial Each Wcb site is different, so diffcrcnt solu- when putting CSS code into pmctice. tions ought to be appged depending on the Realistically speaking, if you are planning panicu)ar needs and requirements of each to use CSS, you are targeung users viewing site. Having said that though, there arc a your page using the latest vmsions of the two number of fundamentals that offer some major browsers. lf you know that a signilicsnt mugh guidelines on the bmt approach to portionof yow audience uses older versions adoptingCss acrossa Website. of the major browsers, or an alternative

T he

Ca nadian

e- commeme si t e

(ktip://wnw.apple.cern/canadastore) will have a Fmnch component, and will be used to roll out

Us.-based end ~

rather static Web site(hnx//www.nalicmlpost.ca). With Workopolis, the Globe and the Star have raised the bsr very high for entering the online job site market. (2

"II there is a promoson in the U.S. (online) store, it will be minmed in Canada,* Manning added. "But Canada is a unique market, so consumes should not expect that at all fimes the Canadian stow will be identical to the U.S. stow. Decisions mu made for our market needs in Canada. and Canada is a digenmt market than the U.S. The Canadian launch is pmt of an ongoing roaout oi the Apple's online store arounri the worki. Ttwm have aimady been launctms in some ts other countries and Manning said a yaat deal ol tkne was spent to make theonline shopping experience for the customer a smooth one. Thmugh the site. customers can coniigwn systems they want delkrered, or take gm spscncations to their local Apple reseller to have the onler fiiled. Manning does not see gm online stow as competing with Apple's established 450 resellers across Canada. "It is designed really for dm convenience of customws who don'thave easy access to a mealier. he continued. And in the bmad gengraphicsl base of Canada, dtose are the customers who will benegt kum the stmu." Only some resellma believe the online store will harm their business. An Ontario-based Apple dealer who wished to remain anonymous said the online stow will

An in-depth look at Cascading Style Sheets Part 13: Real-world use of CSS Browsercornpagbility

iil ='J(i IS

modest;mainly involving asmallish, tidy, but

Weaving your own Web site: Part 55 By Knigt echenggl-nobarts

)tlat Qnkam'm'm

browser. you should pause beFore adding CSS to your pages. This issue is not as serious ss it wasa yearago,since thevastmajority ofusers now run bmwsers capable of displaying the effects of at least some CSScode. One point is dear however. use only those CSS codes that arc wholly compatible between the two browsers, or at th«very least don't use CSScode that will produce neytive

effe«ts onone bmwser. Try to use "saFe"CSS code whenever possible. but don't consider this sn absolute rulc IF

you do plan onusing CSScode that does not fufiy function between the two major browsers, cnsum that your content can still be

read by default. )n other words, make sure your Wcb page doesn't depend on CSS to be readable to the viewer.

Atthe time ofwriting,Microsoftinternet Continued enpage93

speciTe promotions.

takebusinessaway horn him. Ag it does is take away deafer sales, he added. "It doesnot add to the mix. It simplytakes

Continuedonpage 93

< ONLI N E 8 C ONNECTED >

W eavingyour own Weh site:Pma 55 Continuedfrompage 92

Strictly speaking, there are a couple ofways you can add CSS code to your Web pages, Explorer supports many more CSS properties either by defining the display properties of than does Netscape Navigator. It is quite possi- associated HTML tags by using the <STYLE>tag blefor a Web author to create aWeb page that in the header of a Web page, or by directly usesCSS code that doesnot work in Netscape adding the code by using the STYLEattribute. Navigator, but does in Internet Explorer. ThereisonlyonewaytosetyourWeb pagesto However, this can be done in such a way that it use CSS code derived from a page devoted to may look bauer in Internet Explorer, but can that purpose, by using the <LINK>tag in the

things further, this is only noticeable when the Web pages are viewed while running "live" on a Web server. The error does not occur when you run it locally on your own system. Any Web master who has run into this problem either ends up dropping this approach to CSS

to implement at least some of tl..ese properties fufiy. Despite only partial impiementation of

formatting, or becomesvery very careful when

posalsfor CSS3properties.

setting the URLs lor such Web pages in future.

Ultimately, CSS use depends as much on W eb authors who take advantage ofitsfeatures

still be read in NetscapeNavigator. (Th» opposite is alsopossible, but harder to achieve). So,

headerofaW eb page,asin thefollowing code

So what'n next

example:

as it doeson the suppor t ofbrowserm anufac-

for this reason you might want to try out such properti es the BORDER or BACKGROUND-REPEAT Families, which produce some eye-popping results only in Internet Explorer, but are stifi readable t o s omeone using N etscape Navigator. However, properties like FLOAT, CLEAR or RMPORTANT may not appear in Netscape Navigator at aB.

<HEAD> <TITLE>wsbPage Foimabsd From a Second CSS Page</TITLE> <UNKRE(='stfieshest' HREF='../../../index.css' TYPE= teal/css'> «/HEAD>

This series of artides has focused exclusively on the basic CSS elements. which are now known asCSSI. A CSS2 specifi cation already exists, which further defines how certain properties first described in the CSSI specification

CSS in themajor browsers,the standardsbody that sets the specification for CSS—the World Wide Web Consortium, or W3C — connnues to march on, and is curreatly looking at pro-

turers. The more that Web authors know about CSS and how it works, the greater will be its use. Hopefufiy, this series has helped more than a few Web authors add CSS effectively to their Web pages. Cl

should work, and introduces such things as downloadable fonts, greater control over visu- Next time:Apreviewof KHTML(a,k,a. HTML5.0), al formatting and even enabling Web authors KekbScbeagig-Raberia welcameSanyCemmenta, Sugto sperify how their Web pages should sound. gasgoasor HTML tips Toumayhave.Yoacan email In most cases this works just fine, but there So far, only the bare minimum of CSS2 prop- Keghatrcbeitsk@wave. kame.cern,Lookforhis Problems with <UNN>ing to n CSS page is a nasty quirk in Netscape that demands that erties (those relating to absolute positioning) upcemiagbook on CSS, CereCSS.ESBN:0-13There are two major ways to add CSS prop- you get your code right, otherwiseyour page are implemented in the major browsers, 083456-4), to bepublished byPreaiica Hall. erties to your Web pages: either by adding wifi not be visible to your viewers. though the next major versions of Internet Previousariicles ia Ikeseriascaabefound at: the code "inline" to HTML tags on each individualWeb page, or by creating a page of CSS codes that all of your Web pages link to. While the latter seems more convenient, it

If you get the URL wrong in the above line of code, the browser will not be able to find the index.css file containing the CSS formatting

Web authors simply opt for adding CSS code —even if it is the same CSS code used on each and every page —to each Web page individually.

intended CSS formatting. Unfortunately, Netscape Navigator doesn' t. Instead, viewers get a big "Not Found" ermr page because it cannot locate the CSS file. Compounding

Apple Canada lnunchea online store

John Cresaweg, pmsident of TRG Computer Solutions In Aurora, Ont., does not see Apple Canada'a online store affecting his business any time soon. "I think it wig be another aoume for people to get pricing on," he added. "I'm not suie people are going to buy from there. Moat of my customers want to have a face-to-face relationship

Explorer and Netscape Navigator are expected

DAZED AND CONFUSED ABOUT BUILDING A GREAT WEBSITEV

code. Internet Explorer dealswith this by simholds some haaards. For this reason, many ply displaying the page as is, without the

Continuedfrom page 92 away a sale fmm the dealer channel. It is a cash grab for Apple Canadaand increases their own mulitabigty and huis the deaktr in the process." He also complained that App!e'a contract with him matricta hia ability to seg outside of hia designated geographical sales region. but allows Apple to sell in hia region and to use a national mail outer company to ager Apple products and software at prices lower than he can offer. "Appfe can now sell in my temtory... How can I gmw my business when two companies mn taking sway from what is here'I" he asked.

[rather) than go to the Internet and plug in something and have it arrive at the door." Cressweg thinks the online store will be beneficial to customers he can't reach, those "in the boondocksor mmote places thatmay nothave a dealer nearby and want to buy a computer."

— yomVance'a

California firm smells success online : Sy Stefnn Duhowaki companyfern Oakland,Calif..nas found kathw invesknem capkal for ita to make your computer smell

fwmy, or sexy, or calming. Whatever your taste (or smell), Digigcenta InC. (hgpy/aWW .dkjimmh,Cem), the pieneer Of ektckoif c olfactory twigatkm, viig bring its Digital Scent Technology to North American computers in the coming months, with plans to

expand into Asian mmkete after. Cn Feh. 1, the company said it raised the U8510 mgiion it needs to bring Digital Scent Tecnoiogy to oompuiwa in the Asia-Pacifm , mmket, as weg. "With DigiScenta Digital Scmri T~ conmanem will be able to enjoy mmn lifelike and memorable expeieem with scented Web

of the onlirw entertainment experience and soundtraclm have become a necessity In movies, we begeve that over time, digital scent will also become ubiquitous in most fomm oI media. Ttw same way you can cack on and hear a sang over the Internet, now You can cack on an image and smell It wiN a computer

speaker.sized device." Eegenson said. So do PC gemara nelly want the appropriate stench to accompanytheir favourite firstpeiaon-shooter gamesY CigiScente seems to think so. Thecompa ny dalma soitwme d velopeia and advmtiseia are excited about Ita technology. Classtri ps may neverbe the same, aa

fietwoma to bring ita eledronio edours to the

edtmagon aa huge. 'Just ae sound has become an integral part

' COIIPETITIVEPnigfng Need a database drwen website? Hemegase Inirrnrt'r prices start at $25/month for a basic website or add a databaseto your existing site forthe same price.Plans stan at535/month. Call us for a plan that will meet your needs or

money at your own business.

Competitive web hosting rates starting I'rom just S25/month. Training, consuhing and web site building from $75/hour. Call the experts at Hemegair Internet now and get your database on the web. Customer Quotes "yrv wva'rfimf a arfrrr groupof prspfr whv wig stretch hard when mired ir moke yoursirework."DaleW. Larch, Sierra Stained GlassStudios, Iac. ".. rssr pricem well ai prvplr wka areFi/rMaarr awf aaamsh exprni. Homrasrr issk mr ar ihr head Ir/s e-mai/)anri heiyrd memorr rs mr bigger arena.

My pagesare rrrwd wry fast. I wm wornrd <aevi

des<aa/I thewayarran theturi fm du i ii Iwm'r msiurrd iathefeast."— Rari Holmes, Appgcd Communications, Tokyo, fapaa

k":I

pmaentagon of India whamthe sites, sounds and ameaaare agpart of the expmience.

, tens of the technology in advertimng and

panysaid ine pmmrekmse; jp According to ita chief executive oflicer, Joel

W E B SITE HOSTING

If the buzzwords of web technologies are star ting to seem overwhelming, talk to the experts at Hemrgaie Inrernei. We can assist you with your solutions or build you a web database from scratch, Our friendly, knowledgeable staff can help get you started, or build your entire web structure for you, letting you concentrate on what you do best...making

igigcenm iamarketing ita t echnologyto edu-

.Segenson,the.company feelsgm,eppgce-

ackvegames and online advmgsing,'the com-

WEB SITE DEVELOPMENT

carion specialists, too. Imagine a multimedia

Diglgomte pkam to Ixillg ita pammml scent ~ to st ore shelves Grat. Expect this comptaer pmipimral to be available by fall tor agghtly less than Uggggg. The corn pany already has e deal with Real

aitea, emag,movies, mua'e, i>commmce. inter-

htip:Ihsnw.web-weaving.aai.

TRAINING • COI4SULTING • SITE BUILDING

HomeBase INTERNET

Internet ~a

com putaa.ccml

chick us out at our website: MNOghhaaubg

' mAcn ToUR wansrrg Activity Keep track of your website with our web statisncstracking software.

• supanlonracHnlcat spaclrtcAftons

Hem<Base fn /erne r offers very fast bandwidth connecti ons atAreatprices.Located on a maior internet artery /he company ofiers state of the ari computers, software ant( greatservice.

' Faaruaas

' Paver/vl Snr sad PC irrwrr • 4 OC3 Intrraci Covnrgiosr Lrrw iv Wca Comaisrm

SSLSecureServer Avaiuale

upxBackup phvsicaar srrvw Sar fess crmaceFimval

><i hcd Network

. pair asckvp Co.locrian far your Srrwr Moner-sackOvsrmt«r aodlrr prvsram • RATES rha smaa swswsn sera snmsi \$

\II •

emr arden

C att reit Fr<a r-$8 8 - 948 - 0 6 6 8 Tat Soi-Ste-oaae. FAX aoa-aae-eaae shall: wiviellbsia.lal

Webi www.hbnae.net

PO aov moat. SSS W Hasiiaas Si.

vancouver ac. Ysn sns

swvwvaovoivmseli adswadsvww lc umvaAgtwerwewkdsw>r<rcawNcaw At@I

aria nrv i i Ma lo o se u r ui NIMS es so ur fr5I rim-o<INO ruh K a <alan orasue « o us i os $Nls ui a<sir - r olusrw too Ms • e a i so Im a<run -i oaebwe wv Ma i o a rar iii nrruv -s ousww s us s o s 54so u rr milan -s ortorw ssv Ma s oa Q sr r i s r ms cvlllpllllOII 4 50oiaslwi usa aolllier s aver co<sister ca l l fwm a49 Mlcwroarrmmal Server Call IIOIII @Is Osrxrlee smulllm ca l l IIOIIIrs s fnl thin

SssyalePAPER

Careers &Training I T C a r e e r Tr e n d s •

P r o d u c t i v i t y Ti p s a n d T r i c k s •

Bo o k Re v i e w s • T u t o r i a l s

Back to basics ~f

Password and splash tricks

you sometimes

)w orry

that you' ve

tl@ nfgsgyl

vzl

delved so deeply

vl v v c v 0 00&4 p i leyuvva

into the complexities

of your software that

0 00 I 0I V 0 0 0 » V V

V I~ I ~

you may have overlooked some of i ts b asic t o ol s an d options, don't despair This month we take a trip back to the basics in Microsoft Word and look at some simple but often overlooked skills that can save you time every day. Becoming familiar with these

IV 0 0 0 V IV V V •I V V V

I0 0 0 ~

0 0

000 V V V

0 0

• II I V I V V I 0

0 JVV V

0 • •

0' ' 0 0

I W V I I I • • • I \ 0

tools helps you work faster and morc eggV VVVIV ~

ciently and with a lot less stress. While this column uses Word 97/2000, most of thme skills can be applied to other word processors. If you'rc unsure how to do

V VV 4

IVI V + a

0 IVIV ~

something in your software, checkyour program'smanual or He)p Ble.

. Nfl

/OIBByldRPBP%

Views Word offers a number of ways to view a document, most of which arc available from the Viail menu. Normal view is a plain view of

Bw amiadumment viewedfourways(ciacuwiseflamtaufugy Pagelayuut, OngnaIayuul sunna,andffannat

(View, Normal) and select Tools, Options, View tab, set the Style Area Width to say 2.5

cm ( I in.), then dick OK.

tables, and databaseconnections. This may not sean important, but trust me, a Visual Basic (VB) pmgram with several database connections and long listboxescan take 10 to 25 seconds to load. Looking at asplash screen is abetter way to spend that time when the alternative is staring at the password dialogue. A trick to doing this is to do one third of the initializing on the Form load of the password

procedure. Then if the password isOK, do the

your document. It's fastand manypeople prefer working in it. In this view, you can have a Style area display down the left of the window showing the styles bang used in the document. To set this up, switch to Normal view

eour last tutorial, we learned tousecom-

ponents and textboxes as part of a database exercise. This month, we return to the use of textboxes, setting up a password and a splashscreenfor our a pplication.Inthis exercise we read an encrypted password from a setup.ini B)e. When the user enters the correct password, we start up a splash screen. The advantages of using a splash screen aua it allows you to advertise your pmgram and highlight its wares; and it gives you time to ini-

tialize a program's global variables, refaence ' 00 0 0 1 IV ~

0 I00

By Jacques Surveyer

Page Layout view (View, Page Layout) ment is important. In this view, you can conshowsyou the margins of each pageand aa trol location muchbauer than in Normal It' s header and footer tau. Using this view will also handy when you have columns or images give a dearer representation of what your in yourdocum ent. printed document will look like. Use Page Online Layout view (View, Online Layout) Layout view if you'recreating an ad, aoyer or shows the document in a format for easier a document where the location of each elcContinued onpage 95

nan third of the initializing on the Form Load of the splash screen. Do the anal initialization on start-up of your final main form But first, let's seehow to code a password screen.

Pnssino worzfs

You have mail By Gene Wgburn

even precedes the development of the internet itself. Not surprisingly, given that the Internet was developed primarily on Unix systems, there is a rich heritage of mail readers available to Linux and Unix users. The basic breakdown of Linux email packages is text versus graphical readers. Textbascd email readers have been around since the beginning. Linux mailers range from the

~ Bivsu have mail" and "you have new mail" are two of the most common messages that greet you when you log into a Linux system. E m ai l is, arguably. the most important s ervice barebones mail program (which is not as o ffered o n th e barebonesasitlooks once you peer under the Internet. Despite the hood) to graphical mail readers such asKmnif ravagesof spam, overaaive mailing lists, and and Nersrcpc Communicator. What type of genaul inbox glut, person-to-person com- reader you use is Iargdy a mauer of prefermunication with anyone in the world con- ence or religion. Let's begin by looking at the nected to the Net remains one of the most text-based readers.

•

Figure I:Passworddialogue

today,give mearing.

Add two textboxes to a new pmject form and caa it gassuy. The labels for the two textboxes arc asshown in Figure I (Enter tfsedfameand Enter Pusnuni). The Erst tenbca docs not require a special setting, but the password textbox does. Its ~ prop erty is set to the asterisk chmacter (* ). This causes the textbox to be fiaal with asterisks for each charaaer typal.

Cc: sumaneeiseesumcwhere

But thevalue of fussed.yezi seenbythe program is the passwordtyped in by the user.

Notice the "dot" (.) on the second-to-last line. On most systems a dot on a line by itself

sure thatwhenever thepassword tetuboxgains

from scripts. For instance, you can jot off a quick message to someone (if you'rc connected to the Internet) by typing:

0 mall sumeuneesumeuhera subject Huwabout lunch? 0 yuu navetimefor lunch

The second trick we have used is to make

in mail is an end-of-m«ssageindicator. The message is sent as soon as you hit Return at

the Cc'.prompt (you canleaveCcblank). You can also use thc command line to send

compelling reasons for getting an ISP account. Email ranks alongside the World The mail program Wide Web asone of the twin pillars of mod- When you install Linux (this series isbasedon

a file as amessage, such asa program Ble or

ern technological existence. Red Hat Linux 6), you gct a comnand-line Email is also one of the o)dest services. mailer as part of the base install. The program

0 mall .s 'This ishuwuur inetd.cunf looks' I > soneuneesumenhera« /atognetd.cant

There wasanail and B)e transfer (FTP) &om the carlicst days of the Internet and email

ma inly for sending email fiom the command line or

conBgtuation file

is called mail Thesedaysmail is used

04 APRIL2000 1HE COMPUlW fuPER fc EDmut vww.cuudsccnuvlaxcom

Continued on page 97

focus, the text in the box is automatically selected with the following code:

REM'1tusmdanighgghts/selects thetezl warn you aiulr

Screen,ncgveCu nuul.getgtutt = 0 ii =lenncreen.ActiveControi.Taut) Screen.scgv eCunlrct,gelLengtn= 0 Those who read Part 7 of these tutorials will Bnd portions of this code very familiar. Continued on page 99

a CAREERS 6

I ' RAI NING a

Beak to baaka available sdect View, then Toolbars. Thc most ing aleL You can abo change dw position of iaal state, rightWck a toolbar and chaose Continuedfrom pagepd useful toolbars are the Standard and any toolbar to aayside of the viewingwindow Customize Choose tbe toolbar to return to ns wadi on)isa YouTI Rnd the teat is larger aad Formatting too)bars as thcsc contain the but- o r leave it to Ruat aver the editing area. To move original state aad dick Resetaad answerYesat scmgs dgfcrently than it will in the Rnal document. Abo, thc document map will bc visible

so you can scewhse you are in your dncula eat. Oudinc view (View, Outliac) shows yau the structwc ofyour document. Here you caa reoqpuuze the tmt on the page by dragging

tom yau'9 nmd kr most common tasks. A a toolbar.grab thc double bws at its ldt or tnp-

P~ mark em Perhapsone of the most confusing aspects of

• as a » w a s» a » a w e »

@ as ,sip~a:g the/ ~ •w

a s tg z tats.stage ~7

Wonl, particularly if you are a WordPerfect user, is how text is formattaL Word stores details of the formsaing characteristics of a

a» ev • r • sa S a S S S S S Q. a Ih

headingsaround the page, and you can collapse and expand your document so only the headings are displayed, or so ag the text shows. Print Preview viav (File, Print Preview) is a good way to check your document before you print it to enema the IN/out is correct. In this view. Iou can see more than one page at a time by dicking the Multiple Pages button and

seleaing the number of pagesyou want to sce. Youcanalsoedit your tau in this view bydicking the Magniger button to toggle between

viewingyow documeat aad editing ix Master Document view (View, Master

Document) is useful if you're wasting a long document and you want to assembk it 6om a number of smaller documeats. In this view you can combine these documents together and add iadaaa and tables of contents that spew the contents of a number of scparlte dacummts. Wc looked at Master documeats in a past issue ofTtwCempsner Paper. It's online at

the pmmpt. Clidl Close to sensa to your work

paragraphinside the paragraph marker that appesz atthe end of thc paragrapk This is

additionally con('using becausethe paragraph

• smta assm lr Naa Saae al •

Nleeaaaweaal S ara» a l e »» a I e a e s

aaeae

eaehear

anal»ca»

aaweesmauee as aareslet Nils eaa w lasaer as sea a

To seethe paragraph markers in your doc-

a»»el

wew

I»I»ca

m naaaeww e sww I

raeaee awe a Ns I I*

• lmaae -

Se las

• eeeeeae

• wsemereeaaaaeeealceesla aaeaelase a»as» Tea W w aees leNaaa ew ivan Na\a ea aleeTeaswaae vwlas sane

Neaeeawmeeeasssao amaseesox

aweaw~ t u eaawsaeeaawsaaeaaweef

' a - h 4, maw- x Isocs1 d u .

•

ument select the Ctrl+Shift+' keys, or select the Show/Hideg button on the Staadard tool-

bar. You'U sm the paragraph markers (5) at tbc end of every pamgrapk Whenever you

• ass»ac ale»sea

a aesa e~ N A •alslawaeeaw- •; waeaeaea

marker is usually invisible —so you can do ag sorts of ddngs with it without realizing what you'rc doiag.

waafs

move or copy a paragraph and you want to take its formaaing with it, rlmcmbcr to take tbe paragraph marker too. On the other hand, if you highlight the text in a paragraph

and don't indude the paragraph marker, you' ll copy thc t«xt only and not aay of its paragraphformatting. lf you have a parayaph that has farmatting you wast to copy —its line spadng, or tab set-

tings ,forcxampk — you can copy theformatting alone (and no tan) by simply highlighting ~, 111 63pL00/eat too)bar isdisplayed if it hasa checkmark by its most poiat with your left-mouse button (or its and copying the paragraph marker. Whenyou name. If it isn't displayed pau can make it dis- titk bar, if it b Roadng) anddrag it into a new replacethe parayaph marker of another paraToo)barn pky by diddng thechcckbox byits name. position. Yoni( see an outBae of the shape it graph with the oncyou'vccopiaL the formatThe toolbarsat thetop of your saeen we fully Remove unwaatal buttons Rom a viable will beandwhereit will appearsoyou canposi- ting of the parayaph chanya automaticagy to custnmwabk andyou can choose to have than too)her by hohtuXI the Ahkcy asyou dragthe tion it accuratdy. If you' ve messal with your resemble the formatting of the paragraph appear or noz To sec the range of toolbars buann olf the toolbar and dmp it into the edit- taolbars aml want to return them to their orig- whasemarker you copiaL htt p:I/aaa.caaadacaspates.cas/cc/sectian/news

INTRODUCINGTHE EXAM CRAM PERSONAL TRAINER an advancedinteractive approach leading to MCSEand A+certiPcution Isdaks • lahpw ssrugrsdrea

zzzhsa .us@taps ~

Key word: Itezaozzak • Create your own study tools and study the way ynu want. Personalize your IT study with text, video. audio, special annotations, and mora Take countless practice exams, craft

your awn study sheets, and download new questions and content from the Web-PRERI

Combining the flexibility of

Web training with the power of

CD-ROM training, there'z

• Free Online Updates-questions and lessons • Select Audio Review to reinfarce lessons

nothing like it.

The Exam Cram Personal Ttaiaer includes:

Exam Cram Personal TMner syatetns list for SI04.99 each and came in the fallowing flavors: MCSE Networking Essentials Exam Cram Personal h)sez, 1-57610-644-6

MCSE NT Server 4 Exam Cram Pezzanal Raftmz. I-57610-645-4 MCSE NT.Server 4 is the Enterprise Etatm Cram Pwaonal Thzdner. 1-57610-646-2 MCSE NT Wozkatatlatt 4 Exam Cram Personal Trainer, 1-57610-647-0 A+ Exam Cram Personal 1Eainer, 1-57610-658-6

eA personal course created with Exam Cram material eA Personalized Testing System with:

Hundreds of questionshyper-Raked to lessons. Multiple test types:Adaptive, Random, Lesson SpeciRlc, Fbmd-length. aad mote. Seenano questtona for aR tests.

The eSmartest ma Wa ayIo Get Cer5fied

ttw mala sdtnsaamsspass cwmua

~ Cann a ib Azetxazza 195 Allstate Parkway, Markham, Ontario LSR 4T8 Telephone:905-477-0722 • Toll-free:600-967-9776 • Ibta 9(S-477-8819

'll

4 CAREERS S TR A I N I N G s

Lowest j;.' Prices in Canada!

NCSE NCDBA ORACLE lnsaocl )

Java 2, Classes Tick ets to career advancement in

the computer industry today. Extranc Technologies Inc. www.extranc.com

Iniine images Ifyou haveWord 2000 you'reluckybecauseit has better image handling than Word 97. With the lauer, it's afl too easy to md up with an image in a document that simply won't move around Scaly no mauer how hard you tug at it with your mouse. If this happens to you, it is because the image has been insened as an inline image. An easyway to identify an inline image is to check its border. When you sdect it, you' ll sm it has a thin black border. If you drag the border with the mouse th» unag«may dmp

into the middle of a paragraph but the surrounding tctn won't wrap amund it attractive-

ly. In fact. youcan't alter the tca wrapping for an inline image—the wrapping options are grayedout on all menusand toolbars.

Email: infooextranc.corn I •

I • •

e Fast Workstations and Servers with 17"

dmtmos 4$1

Cslsmn 4$$

-1$.'I HPA Susen

-Sat TPT Smesn

Aaeka Hsnl Drive A.san. Hsnl Drive dxea er Rsm Mammy 4$MS at Rsm Memory

monitors • Certified and Experienced Instructors e Flexibleweek day/evening, weekend schedules e Proven success rate

e»X CD»lorn l ann Anne

eea Codtsm • Nut Ames whhSpa»kern nnh Speakers Cat Vae Fasmsdsm ANC Vm St»darn -1 Yssr Wsrrssly .1 Yssr Vtmmmy

To change an inline image to a free-floating one, select it, rightW»k and choose Format Picture (or Format Objcu). Sdect the Picture tab, enable the Host Over Text cheJkox and dick OIL When the image is I»Ected. its sizing

handleswill appear, and youcan then moveit anywhere in the douunent. You can also choose the way textwraps amund thc imag» by setting its wrapping

• lvlake-Up Classes If You Don't PassCerttmtcatlon Guaranteedl

options by choosing Format Picture (or

• 3ob referrals after cettl/Ication

Format Object) and select the Wrapping tab.

ACBW Bgo

IPPLV1$W

FU IISU I

We' ll beat any competltos se advertised teltlon feel

dzssemn 01 4$0 Aen Hsnl Drive Aden Rsm -1$.1' TFT Semen

8 80 7'I 30 geCSINIC nna>

ees Co»tom Aax FsslMsdsm

821-0876 ynacalawu > Inwluuuutl Campus: Ifull 1$h3851 Jacomlm rtl. Inslimmul, SC

-1 Thin.4lhs. -1 Yssr Wnvsnly • SHOOHIC

•

AA Ols. Hsnl Dram

Aden R

-1$.$ TFT Semen eSX Cndtsm -1$OS Asins nnh SF»sham

Ance»dern 1 Yssr Wsnsse

Speging, Srammar and heeaurus Word has some handy pmoflng tools to help you check your work. You can set it to check the spelling of words as you type or only on command. To change the current setting,

choose Tools, Options, then Spefling at Grammar to enable or disable thc Check

Spdling As You Type checkbm. If it is disablnL you can speB chnJt your document

anytime by dicking the Spcning and

TOuHISA

E SERIO UTURE S; I

•

ABO S~

' I

TOSHIBA •I' I

•

dmtsmn 400 AA On. Hard thtm ddeh ef Rsm Memory -Sat TFT 0»rssn, xan VDO Rsm Cdx CIWlom

datt Fsslesdsm dasdmm 00 -1 Yssr Wsnsnly

•

dmtsnm 400 AAOID Hsnl Dram Adah at Rsm Nsnmry -14.1 TFT Semen 4IVO RON

-14nlt Ames nuh Speakers Aet Vaepss Modem A Yssr Wsnsnly Atsmm Ssnnsis

Grammar button on the Standard toolbar, or

by pressingthe Fy key. Word's thesaurus helps you Snd synonyms and antonyms for words. To use it, select a

word in your document and load the thesaurus by choosing Tools, Language, then

Thesaurus, or bypressing Sbift+Fy keys.Once the thesaurus is loaded, you can select from diflerent meaeings of a word. then select a

synonym. Click Replace to place it in your document, or dick Look Up to Snd synonyms

Nl n

of the synonym itself. If you sdeu thc dropdown list in thc Lootwl Up area, you can I

slw

'sny

IScBBIoon

CORACLE

i l i

dmtsnm 4$$ AASD Hant shiva

Aden Rsm

-14. • TFI emssn AWO Rom .

'Ssn

4MI» lusdsm 4 Yssr warranty

•

due $00 1$els. Hsnl Drtvs A»ah Rsm -la.O Vpr esrssn 44s Cndtsm eat Modem -1 Yssr Wsnssty

academic lsiziazivv 'I

)QCisco I

PROMETIUC ~C

om pTQL

' I '

' n'

Short Courses: WindowsNT/Bg/IS, uS Word, Excel, Visual basic, Cee S Java

Tel: (604) 5614502 Fax: (604) 561-5572

Readability Statistics checkboxes. Now, whenever you check the spdling in a docmnent,

TOSHISA CNM4EE ACSR40

FUJITSU QII nawierv

~Lang.

Chmy&le Rifm List

wwwfluulgggwfgm INSTITUTE OF TECHNOLOGY

Grammar cbedong can hdp identify problems in your um of words and your sentence structure. In addition, the readability scores displayed at the end of th» grammar check hdp you track how easy it is to read your text. To see the statistics when Peur t»N is checked, select Tools. Options, Spelling al Grammar, and Som th» Grammar area select Check

I C ease SeClneGrammar With Spdling, and the Show

' I

Instructor Lod and 1 to 1 Classes

mntm to aay word you've looked up previously in thecurrent session. Tolook up a word of your choice, type it in the Replace with Synonymboxand dick Look Up.

you' ll also check the grammar and you'll see the ReadabiTity statistics when you' re done. For more information about these, select

Help, Contents and Index, select Readability Statistics then Rmdabflity scores.

Sxpanlgno text It's not unusual to Snd yomself typing the same thing ~

asy ou work, it might be

your company name, an exdusion dause. or' evenyour Wcb address. You can save time by creatingAutoCo Hect eatries for the oit-repeatGmtinhrd on page 99

< CAREERS 8 T R A I N I N G 0 You have mail

You can switch from message to message,

features of Pine is to type s for setup, and c

able. If you are running a lightweight win-

Continuedfrom page 94 In Linux you could either type the above as one long line that wraps around on the screen, or break the line into readable s«g-

send replies, move messages to another for configuration from the Pine main menu. dows manager such as FVWM or IceWM,

"/varispoal/mail/gwilbura': 131messages 3 new

useful, but a bit annoying to deal with oa a

At each configuration option, type I for you may find TkMail or TkRar a good additional information. If you like text- match. Both are fast and have pleasant interwards, set how many lines of display you based mail readers, Pine may suit your needs faces. TkMaii, a simple mailer. has afi the ments using the backslash fi) "carryover" want, etc. AB this information is in the man perfectly. Pine is installed by default on Red basics: send, reply, include message (quotsymbol, as in the preceding example. Note pages. Type man mail to lind out afi the Hat systems. ed), carbon copy (Cc), blind carbon copy that the -s flag can be used to put a subject options. If you' re a tinkerer and want almost total (Bcc), and MIME attachments. It allows you line on the message. I'm including mail in this column because control over how your text-based mail read- to adjust the views in several ways, from sort The mail program in Linuxcanalso beused it's on every system, it always works, it's very er looks and acts, Pine might be just a bit too order to fixed-font display. TkMaii is utilias a mail reader—somewhat primitive, but useful in system scripts, and getting to know tame for your tastes. You should consider tarian, lightweight, and a good demonstrasurprisingly useable. Just typing mail will it gives you another administration tool that Mutt. It is highly configurable and Mutt afi- tion of how useful the Tk widget set is for bring up a screen of your Linux Inbox listings: is a portable skill to other Unix systems. cionados have made afi kinds of interesting simple GUI development. TkRat is a Scandinavian product. The Rat Mutt configuration files available on the <CODE> Upsoale text readers Internet. Mari, too, is installed by default on in TkRar standsfor Ratatosk (swift tusked), Linux mail is an example of the oldest kind Red Hat systems. Check "man mutt" for the squirrel in Norse mythology that runs Mail rerstat Kt 6/6/93. Type? torhelp. of command-line-oriented reader—useable, additional information. up and down the cosmic tree, Yggdrasil, cart2tMOOREPW@gos.as.ca FriFeb 413:42

123arhtao@server.uwlnds FaFeb 418:39 39/t425 "Ra:SC2000Sessioa'

t24 supp ort@lpttmusca Fn Feb 4 2314 171/7893 'ImportantNotice - Sa' 125 da(titaac@sym patico.ca Sat Feb 5 08:52

70/2631 '(mpipo stj Re:Festive' 126MAILER-DAEMONttcytxxu SatFeb 5 08:51 95/3616 'Ratamadsuit Local ' 127 saat4567@mailcttyctm Sat Fab 510:19 412/14963 'NEWSALERT - SPECIAL' t28 dcmtarts@onliatcnet Sat Fab 5 11:09 69)2416 'Pbklagyaai brain' >N129 asttea@ittagstm.nat Sat Feb 5 t2:36 64/2651 Jmplpostj Fivestausa' ttt30 gvilbata@hama.cam Sat Feb 5 12:43 14/488 'Haw aboutlaachT

N13t (twllbamfihom e.tern Sat Fab 512:48 I03/38t 9 'Thisishawour(acts'

mailbox, invoke your favourite text editor, run a spefi check, scroll backwards and for-

rying abusive language from the dragon

daily basis. It didn't take long for Unix hack- GUI mailers Nidhog at the bottom of the tree to the eagle ers to come up with something nicer. Along I'm personally so fond of character-based at the top of the tree, and vi«e versa. with the advent of fufi-s«reen editors, such mailers that I use them ev«n while I'm in X, Definitely not your ordinary mailer. Among its advanced features, TkRai as vi,came full-screen mail readers,such as but I can understand how users who started Elm. Eiin, which stands for "electronic mail t heir i nternet l ives o n W i ndows or allows you to create a database of mail mesfor Unix," provided the ability to scroll up Macintosh systems might find them a bit sages, assigning keywords to them for quick and down the message screen, read a mes- quaint. Linux, as they say, is about choice, lookup. It also has adelightful feature called sage by tapping the Enter key, replying by and your choice of a mail reader is your own Take Mail From Netscape that "looks for typing r or forwarding by typing f, delete business. messages which Netscape has taken from If you' re new to Linux, or frequently move your inbox and steals them back jto your with d and undelete with u. Elm is fast, stable and still used by manypeople. It is nor- between Linux and Windows, you can use inboxj." TkRat is usually installed by default mafiy installed by default on a Red Hat sys- one of the most popular mail readers in a Red Hat setup. tem. Typing man elm will provide details on around: N erscape Com m unicator. If you' re using KDE, then you' ll likely using Elm, including how to send com- Communicator offers awell-designed graph- want to explore Kmail, the K Desktop mailmand-line messages with it. ical user interface (GUI) that includes size- er. Kmail is a modern mailer with plenty of Pine may be the best known and most able,movable panels and drag-and-drop of options. You can use it to check the mail of widdy used of the text-based full-screen messages into folders. It ofiers POP and multiple POP accounts. It has bwlt-m mailers. Pinewasdesigned to be a bener Elm IMAP connections to your Internet service "rules" or filters that can bc applied to than Elm and the name Pine itself is an provider and. naturally, displays HTML incoming messages. acronym for "Pine is not Elm — one of those messages wefi (although you should be As with most KDE applications. Kmaii is self-rccursive acronymssuch as GNU (Gnu aware that HTML email is frowned upon in accompaaied by an HTML manual that prois not Unix), of which Unix programmers the Unix world). Bs Address Book features vides extra documentation. Kmail is a slick

are so fond. Lately the Pinemaintainers have can be ported between Linux and Windows application with a niceappearance. The only revised history to say that Pine stands for or Linux and Mac environments. URLs thing it lacks, for my taste, is a long line The ampersand (g) is the mail pmmpt. If "program for Internet newsand email," but inside mail messagesare just a click away. wrap option that will take those onc-parayou enter a message number, it displays the this new corporate button-down name is Communicator is a decent mail reader graph-per-line messagesand wrap them on lrlessage on scleelx not nearly ascreativeorasm uch fun. overafi, but it lacks the panache of programs screen. NetscapeCommunicator has this feaPine is a feature-rich program that has usually associated with Unix. Therefore it' s ture. With Kmail, you have to scroll and g 130 been kept up to date very nicely. It can now no surprisethat many Linux users seek out scroll to the right, losing the context of the Massage130: read HTMI based messagesand can be consomething a bit more native to the environ- earlier part of the paragrapk Once this fea>Fromgwfibam Sat Feb 512:43:52 20(tt) figured to start up a Web browser, such as ment. ture is addetL Kmail will be a serious chalData Sat, 5 Fab2000 t2:4R52 4500 Lynx for http links. With its visible help To behonest,afew ofthenative graphical lenger. 9 From:gwlbam@txma.cam menus, it is easy to useand likeable. One of mail readers look like exercisesin X Window To:gailbamghama.corn its best features is its built-in editor, Pico. programming. A case in point is a reader Next fimei RadiosthingsoaaLianaa)stern Subject:Houabout luacht whichmakes composing messages easy for cafied XMaiIToof.Clearly desigaed around X new users. Pico, aswe sawin a previous col- Window widgets, it is fast but has little aes- GeneNlbum (gatlbum@ttoma.corn) isa Toronto. based it Isa havekmafor lunchtoday, give taa a iiag. umn, also makes a very good standalone thetic appeal. IT mana ger, musicianandmiter uhootteratesa small general editor for Linux itself. Two mail readers based on the Tk X farmotUnusservers. Backissuesot thissar(asare The best way to get to know the advanced Window widget set are more generally use- availableonhissitaat htttx/lmrw.mrlhantioarmy.coat.

Get Smart Canada

•

with its

...FoR GUMMIE5' Books.

•

• •

aas~no avTt vr uii

a asurNÃe

alii' or list

• •

• QS

•

www,canadacom puau.corn THE COMPUTERtuPER SC EDitlON APRIL2000 By

4,:

' I: ,"( e M

Oil ~ ~~j~ . , e A

IntrelncinoSvdex e-trminers

The complete and fully interactive computer based training tools from the leader in certification. ~A~ e-trainer

Netwos is+ '-trainer

A+8-trainer Covers computer hardware, software and customer service, assumesno

Covers the fundamentals of

Network+

planning, implementing and

e-trainer

maintaining a computer network. Provides a thorough introduction

previous knowledge on the part of the user and

is the complete preparation

to networking concepts plussolid preparation for the Network+

for the A+ exam.

Certification exam.

isbn 0-7821-5000% $74.95 1 CD-ROM

isbn 0-7821-5001-2 $74.95 1 CD-ROM

Virtual lab e-trainer CCNAVirtual Lab g CCNA Provides you with necessary hands-on experience in a simulated network environment, e-trainer' She( Ud

Teu lame@

wuuI roNsr

which includes three routers and a switch. Choose a practice method that suits your

needs. Follow step-by-step labs that have been designed for optimal learning or experiment with hundreds of supported lOS commands.

~ â&#x20AC;˘~

â&#x20AC;˘ ry I C S I C

~ e~

VS W SS &

isbn 0-7821-2728-2 $149.95 1 CD-ROM

opa ~

e perfectcompanio to Sybex'sbest-selling CCNA Study Guide.,

Sybex books are the firstchoice of trainers

C CIA

NETW ORKS

CISCO 'CERIIREO NHWOAKASSOCIATE

StudyGuide

Study Guide

' I

isbn 0-7821-2490-9

isbn 0-7821-2547-6

isbn 0-7821-2381-3

1,'l04 pages, $77.00

736 pages, $77.00

768 pages, $69.95

1 CD-ROM

Distnbuted in Canada by

Q S FIREFLY BOOKS LTD. Tel: (41 6)499-8412

F ax: (416)499-8313 sybex@fireflybooks.corn

For more information

on these and other Sybex certification and training products visit www.sybex.corn

Sybex Computer Books are available where computer books are sold.

w CAREERS g

TRAI NING w

Sask to basics ContinuedPom page96

(without quotes), dick Add, then OK. Now,

ed words or selections of text. This way you assign this text to a series of a few unique letters so thatwhenever these leuers sze typed, Word automatically expands them to the full text.

another punctuation symbol, you' ll seethe text change to the expanded Web address.

the With box type the full text you want to

appear in your document—in this case it

which is easy to type but which allows easydifferentiation between an AutoCorrea emry

would be "http: //www.canadacomputes.corn"

and a common abbreviation. In this case, if example—are likely to cause problems if you can contactherat heienlheienbradley.corn.

anytime you type "cc"followed by a space or A couple ofwordsof warn ing,takecarewith

you madetheAutoCorrect entry "AC-" (with-

need to edit the document later. out quotes), you won't mix it with theabbreviThe correct approach is to replacethespace ation AC. or hyphen where the text has split with a nonIf you find an AutoCorrect entry expands breaking (or hard) space or hyphen. These when you don't want it to, you can undo it if spaces and hyphens are special characters that

you immediately select Edit. Undo (or press appearas aspaceorhyphen in your textbut Control + Z). are unusual in that Word will not split a line whereeitherofthem appears Createa nonat http: //www.canadacomputes.corn, you replace tera AC for Area Coordinators, you'll Sticky hyphens and spaoss breaking hy phen by pre ssing could add it as an AutoCorrect entry by select- have problems later if you need to type 200 Occasionally you'll find that, when you type a Ctrl+Shiit+Hyphen keys,and a non-breaking ing Tools, AutoCorrect, then selecting the volts AC —the text AC will be replaced with person's name or a phone number (like 999- spaceby pressing Ctrl+Shift+Spacekeys. Ci AutoCorrect tab. Ensure the Replace Text As Area Coordinator—which is not your desired 9999), the nameor number appearsso closeto You T)rpe checkbox is selected, and in the result. You can avoid this happening by using a the end of a line that it's split in two across the HelenBradleyspecializesin writing hands-ontutorials. Replace Box type "cc" (without quotes) and in character after the abbreviation, like a dash, hne break This can look unprofessional and Hercoiumnsappear regularly in anumber of publicathe Replace text that you choose for an entry For example, if you were to regularly type and ensure it isn't text you would use in anoththe address ofthe Canada Computes Web site er context. For example if you were to usethe

password snd splash tricks Continuedfrompage94

If KeyAscii = 13 Then ' this isthecall on theroutine drat does the passwwd Scnwn.ActireControirefers to the control that cw- checking rently has focus or is active. This, of course, is Call passwd Validate(False) the textbox passwd.By setting the active con- EndIf trol's SelStart property to 0 and its SelLength End Sub property equal to the length of the text in the

trying to fix it with solutions —adding spaces before the text to "push" it to the next line, for

password. If it doesn' t, we issue awarning messageasking the user to re-enter the password. We could keep a count of the attempts. and then exit the password procedure altogether.

However, if thepassword isvalid, we call the

splas h screen routineasfollows:

tions in meU.S., the U.K. andAustralia as well as In yho

ComputerPaper.Helenwelcomes readerfeedback.You

Summary In this tutorial we have shown some tricks associated with using textboxes, getting passwords, and the use of splash screens. We

have again put VB's predefined objects to good use. Finally, we take advantage of some of the many procedures and events associated with textboxes like Keypress or Validate. Eg

This subroutine iscalled every time a letter ' Weare in call the spfashscreen box, the text is selected or highlighted in the password immediately on entry. This means is typed in the password textbox. It looks for passpfash.Show theuserdoesnothaveto besureto erase the one KeyAsciicode, 13, which isthe value of the Enter key. When that is pressed, control is contents before entering the password. The name of the splash screen form is JacquesSurveyorIs aconsultant andwriter. Hecanbe The next trick we have is to recognize if the immediately passedto the password validation passpiash.It's here where the last two tricks are reachedat htip://www.inforamp.net/-jbsurv. user types the Enter key after entering the procedure. Of course, we alsocall the password performed in our program. First, we need to password. VB does not recognize entry of the validation after the OK button is clicked or hide the password form from the user. Because Resources whenthepassword textbox isexited. it is the calling window, we cannot just Beg/nningV86,publishedbyWroz,coversVBteztbozes Enter key —you have to check for it with the The password validation procedure is fairly destroy/kill it. We have to hide it with the code on pages73-94. following code: simple. On Form Load we have already line PassForm.hide. The second'trick is to do VBBB/eck Book,published by Corioiis, toucheson obtained the decrypted password from the any leftover initialization required. And with 'Iextboxes oapagest97-22t. private Subpasswd KeyPressiKeyAscii As Integer) ' detemwhenuser presses "Enter key andif sovalisetups file. So now all we need to do is check if these tricks we have asolid set of program start More links toVBresources can befeund at theauthor's the entered password matches the decrypted up code. datepassword Web site.

Im passe KI~lFl%l

•

HOME/OFFICE POWERUSER INTE LCELERON 45S I500/533....,...........$898I938/988 466I500/533......,....$1158I1178I1238 INTELPENTIUM3 INTE LPENTIUM3 550EI600EI650E...$111N1188I1358 550E I600El650E...$1358I1438/1608 Pg/PgATX UBB AQP ATAgg PCI ggM/S INTELCELERON

SOll PC100SDRAggDIMM 10.2GBATASB NARD DRIVE Kd4IB PANASONICFLOPPY 4IX VIDECBROMDRIVE gBIBSDAGPVIDEO ONBDSHARED SSKINTVggVOICE FAXMODEM ONBD 16BITSD WAVETABLE SOUND ON BD 10/100BT NC ONBD(ADBUCABLBIIEADY) Iy"ATX CSA MID TOWER CASE gg" 28 Ni LROSDFLAT IIONITI)R 104KEYSWINBBAGERKEYBOARD 2BLOGITECH MOUSEW/PAD 100WBPEAKERgsIICROPNONE FIIEE INTENIETACCOUNTI MONTH ALL SETUPANDREADYTORUN SOFTWAREOPTIONS (SIN): MS WINDOWS95/N CD FULLVERSION COREL OFFICE 2000CD FULL VERSION

ATX AGPUSB ATAggPCI33 gg/8 BQIB PCIN SDRAgg DIMM 13GBATAggNARODRIVE 1A4MBPANASONIC FLOPPY 48X VIDE CDROM DRIVE ATI INB AGPNsgRT'gg SDBVD SSKINT VggVOICE FAXMINEM IBBITSD WAVETABLE SOUND 1y"ATX CSA MID TOWER CASE ey" NyNILROSD FLATIIONITOR 104KEVSFUJITSUgy25PSI2 KEYBOARD SB LINITECH WHEEL MOUSE W /PAD 320WBPEARERgeMICROPNONE FREE INTERNET ACCOUNT IMONTH ALL SETIIP ANDREADYTORUN SOFlggAREOPTIONS(gtgg}: MS VV INDOWS95/98 CDFULLVERSION CORELOFFICE 2000CD FULLVERSION

OPEiV NOiV - SAT, 1 0 6&m - 6 cpm & ' C E P T H OCIDA YS AAL PRICFS ARE GASIFY DISCOVNP PRICES PRICES SZ/EJFC 7 PO CiYAA/GE $ 1 M / 7 A ' O TICE

•

sall% lm

caamwrv MICR

i in

PROFESSIONAL UPGR ADESPECIALS

INTELPENTIUM3 133MHZ BUS 533EB /600EBI877E8...$1678/172N1908 733EB /800E8........................$2038/2348 AMD K7AlMLON 200MHZ BUS 800/65MO OIT50..$16N17191798/1928 . ASUS PSVIX ATX ATABBPC133 (PS) . ASUS KTMATX ATABB200MHK(Ky) . sggggSPC133 SDNAM DIMM . 13GS ATABB 7200llpgg HDI)

. 1A4MS PANASONIC FDD

. SgggB RIVA TNTR AGP TVWUT . 1y .20 Nl LR FLAT OSI3 MONITOR . PUJITSU By25 ENH. WINBS N/S . 38LOGITBCH WHEEL MOUSBSPAD .17" MID ATX CASE 2 SIOR OPEN .52X INT BIOS CDAOM DRIVE . SOUND SLASTSR LIVE VALUE . 320W STEREO SPEAKERS .ACSR INT ggK V.BO VOICE FAX . MICROPHONE INCLUDEO . FREE INTERNET SETUP/ACCESS . ALL SETUP AND READY TO RUN

SOFTWAIIEOPTIONS(gtgg): MS WINDOWS 95/ggCD FULLVERSION CORELOFFICE 2000CDFULLVERSION

UPGRADEYOUR 3/4/586 To PENTIUMLEVEL ASIDK04 500MHzCPU 32MBBDRAMDIMM PC100 BMB SDVIDEO ON BD SHARED 1BBIT3) WAVETABLE SOUND ON BD INSTALL/SETUPFREE

OHLygggg

TO PENTIUMII LEVEL INTELCELERON&3 BOX CPU 32MBBDRAMDIMM PC100 3D VIDEO 8 WAVETABLE SOUND ON BD BBKVgg VOICE FAX MODEggON BD

10/IBBBTETHERNET NIC ON80 INSTALUSETUPFREE ONLY$308

PARTS OPTIOMS UPGRADETO64MBSDRAfd.............gdg ADD 10.2GBHARDORIVE..............S168 ADD4BXCDROM DRIVE...................$58 ADDBSKVN INTFAXMODEM.........$38 ADD10/100BTRjdgNIC.......„,....,.....,$20 UPGRADETOIT ATX CASE.............$48

Monthly Promotion SDFXVOQDOOglggggAGPVIDEO.. .,..$1$9 LOSITECNQUICKCANUSS..---...-...........ggg ZGS JAR/100M82IP 01SIL.......,...,.....S12g/18 ySS DTITOMAXEXT.TAPEBACKUP....,..........gggg RECOINABLE/REWRITASLECL.gg.yg/2.70 EPS()NPNOTO PC yggDIGITAL CAMERA Wgg

•

www.anadacomovtes.corn THEGOMPtrtER naPEFI ac EDITI0N APRL 2000 BS

< CAREERS (5 TR A I N I N G w

LearningRed Hat Linux lacks depth but gets new users up and running By Kelth Schengfff-Roberts

LearningRedHat Unux Publisher:O'Roily &Assodstss Tsb800-998-9938, btlp://www.orally.corn

The book also comes with a CD-ROM that contains ag that is necessary to install Unux, along with a number of the pmgrams mentioned in the book. Together, the book and

ISBN: 1-56592-627-7

disc have everything you need to get Linux up

Soffcovsr 378 pages 1999 Comeswilb a CD-ROM

and running. After a basic Introduction that toute the features of Linux in general, ths book takes the reader through the steps necessary to prepare a PC to run Linux. Once the user has the necessary information about the devices used by the PC snd has prepared the hard drive, the book steps through the involved instsRation process. To really get the most of Linux, however. you also have to install X-Windows, which runs a graphical user Intmface that most Windows users are familiar and comfortable with. The insbuctions for installing Linux take up

Author: Bill MoCsrly wss atime, notso long ago, when

installing Unux on s personal computer could be a real test of one'e patience. But over dme. systemsbc impmvements have made this process much easier, and thanks to ils speed, power, reputation for reliability snd its cost (free!), Linux has carved out sn ever-gmw-

Pries: 951.95

Ratingr Inlormstloncontent ""

ing number of converts born users of other operafing systems. With ag of the buzz about Unux, gmre is also s growing number of people who me curious about ths OS and its capabigties, snd who am wiging to by it out. However, while installing linux ls easier than it used to be, for those people who have never installed an OS onto a PC, some sort of help is advisable. This is whee LearningRedHsl Linus comes in, pmviding a useful guide that will enable a novice to set up and run Linux on a PC.

•

Readability: "'1/2

Intendedfor: Beginner Overall Rsgng: "'1/2

OTIE&LY

•

The book is mitten by Bill McCarly, who has introduced Linux to hundred of students at Azusa PaciTic University in California, wham he is a professor. The book is aimed squarely at users of Microsoft Windows who want to set up their PCs to run Linux instead.

Continued on page i dc

Third edition of guide serves Linux neophytes and power users

By Keith Schengili-Roberts

WEB HOSTING 6, 68.95' v 5 M)B of cBsk space v 2 POPS c-maill accounts v 1 alias v 1 e-maB ausiorceponder v unBsniscd data transfer v setup fce $25.-

v 20 MB of disk space v 10 POPS c-mali accounts v 10wBae v 2 c-mafI susorcspondcrs v unBmited data transfer v setup fec $50:

v 50 MB of disk space

v 100 MB of disk space

v 20 POPS e-mail accoaanss v 20 alias

v SO POPS c-mrafi accounts

v S «-mail aucorcspondcrs v auaBmiscd chasm transfer v setup fcc $40.-

v 50 aifae

v 5 c-mail autorcsponders

v setup fce $50.-

• avelvve

EtsodswUbsblm • Piss domainnano Sairslkm vawv.vauxbxnm.corn • Fnmtpaes2000 wosnalww • SS bournFTPscaeas • bslbrtapsbaskrm • RWtimebaasrsbsmam

• gst Ecgvzdw S.OSOHOfor faas SoavrmwWawar rcwcb WasaaeSaaaoaaam ww aaawawcalli afvarwaswiCello Cuir ralF saaawaaia liw oaarrrw awwawlll

• Cnmns cmdacsnlanwesalne le seconds bveuab ewsssws estswav • ms Accussnd SOL v/Aa database auexort

avsussQpgc

fV6riSign Entaiprlse Systemsaolutlens bvx i voasa casviia assi Twvaio. Ox, miiz \Wr

• CQI execotkm cslwbllsy • All NTWadwesa Ixduds ASP • pwl, 0, C++. fsvs, fsvascrlras, Vlmrlpt, Acdvsx», Sgl • 88Levsosbm wbhESS'shared dlezslID

WWW.BSBWebsert/IC00.00UR

Info®BBBWeh$0rVICBS.Com

100 APRIL 2000 1HE coMPUTER PAPER 60 60illON wwwoanadacomouias.oom

ore and more people are turning to Unux for running both professional and psmonal applications. What used to be a minor operating system has become a real force for other OS manufacturers to contend with. Developed entirely by volunteers who continue to improve it, Linux is distributed for free and has gained a deserved reputationfor reliability and effective use of system resources. Sut installing and running Unux can still be tricky. Once you are up and running, you still need an effective guide to take advantage of the most popular applications for Linux. Subtitlsd the One-slop Shopping Guide ro Linux. this is the third edition of a deservedly popular book. It is as comprehensivea guide on the subject as you can expect to find. Running Unux, 3rd EdiTion Author: Malt Welsh,Matlbiss Dslbsimsr, sod Lsr Ksulmso Publisher: O'R oily&Assooislss Tsb 800-998.9938. btlp://www.orssly.corn ISBN: 1-56592-469-X Soltcorsr 730 pages 1999 Priss: 351.95 Rating: Iolormslion contest "" Readability: "'1/2

Intendedlor: Bsglnosr / Intermediate OverallRsgng:"" RunningL/nux explans everything you need to u daistsrM, install, and stat using Linux. It has a comprehensive instagadon tutorial complete with plenty of good troubleshooding tips. It also has lots of information on how to maintain yourLlnux system, and how to use the most popular tools for woxl processing and programming. This book also prcwidss good guidelines on smdng up and running a network, Web sits administrsgon, snd much more. In tenno of specmca, it looks at such popular Llnux ap pgcaUons as the Apache Wbb serww, X Windows, TCP/IP nstworldng, tools including Emacs snd TeX. plus soltwms development envlnmments

O'RgllLY'

llrlr aevi

xrmw iuwowmrmauaaarao

including C, C++, Java, Perl, and Tcl/Tk. This edigon covers a number of nsw topics, including the KDE desktop intmfsm the Samba ffle

server, PPP(which is popularly used to log into remote systems), and revised insbucdons on installing and conliguring the Red Hat, SuSE and Dsbian distnbutions of Unux. You don't typicsffy see a third edition of a computer book unless it has proven to be a real success. Obviously the first and second editions of this title were packed with enough useful information that they attracted a large number of readers. Even so, each edition should be judged on its own merits, and the third edition of Running Linus lives up to its predecessor's reputations. This book diNers from another new O'Reiby Unux guide, Learning Rsd Het Linux, in that it

attempts to be much more comprehensive and of interest to both novice and experienced Linux users. If you sre looking for a comprehensive guide to setting up, running and maintaining a Unuxbassd system, it is hard to go wrong with this book. It wgl get the beginning user on the road to becoming a power Unux user, and includes informsgon that will prove useful long after

system setup end congguration. C)

Windows of opportunity. a.

Nctnaofy

Ttgldowxcx

lt li

i tl!

Wndews Charles

Petzold • a awv

amauaogr

CSE

„Training Kit "Nnamer2Xe Server

i '.

Microsoft Windows2000 Server Resource Kit AS the lools youneedto successfully deploy, manege, and maintain yourenterprise server systems. '46099 • Chapter t Gun Price'41489

MCSETraining Kit, Microsoft Windows 2000 Server TeachesIT professionals howto install. configure, and admln. ister the Windows2000 Serveroperating system. '92.99 . Chapter1" CfubNce '83.69

MicrosoftAge of Empires II - Age of

Online lnVeSting yon nhtatkman

Kiings: Inside Moves Math nwalker

437.99 Chapter1" GubPr ice 43428

'2999 Chapter1" GunPric'2690

ProgrammingWindows,5th Ed

Microsoft Flight Simulator 2000:

CharlesPettold '86.99 Chapter1 Oub Prim 47829

InSide MOVeS aartPatkas '29.99 Chapter1" OubPrice426,99

RunningMicrosoft FrontPage2000 aaolmm a fam

m~N ~fnb4 ~

JimBuyens '67.99 Chapter 1" ClubPn'ce46329

COde CharlesPeuofd '42.99 Chap ter 1 GubPribetgaN

Take advaaleue ot a enealal offer from mlerevOlle lkal eaald • me vwf oelf stan 444

wladoav aooo otlel. Soe tokfdodkeekfwam tof infanta

MCSETraining Kit Networking EssentialsPlus, 3rd Ed

wtdowma

4 ~ ~" av4em

'92.99 . Chapter 1 ClubPr ice 4N.69

MCSE Training Kit, Microsoft Windows 2000Professional =-

. , ' fili'I

i'C'. I l

'92.99 Chapter 1 Club Price 'N.69

Win32Developer'sReference Librarytgith Behate Sticker Davidlseminger, Series Editor '209. 99 Chapte rI GubPr ice 41N .99

lllicrosoft Windows2000 Professional Resource Kit Exhaustive reference, indepth detail, and timely Insights for maximizing producllvlly. CO.ROMIncluded. '107,99 Chapter1' Club Pme497i9

Come in. Go anywhere.

a ONLI N E S C ONNECTED w

More DSL offerings for Canadians TORONTO—San Francisco, Calif.-based NorthPoint CommunicaEons GrouP Inc. (htlpi/www.scrlhpoinLnsyj is teaming up with Canadian telecommunications company CallNst Enterprises Inc. (htlp:/Rnnv.csllnst.cs/) to provide wholesale digital subscriber line (DSL)

services across Canada. •

•

Cat-Nst is one of Canada's lwgest compeSbve local exchange carriers (CLECs) and already has equipment instated in 90 telephone company central olSces gocal switching centres) in t8 major markets. The two companies said they would be able to take advantage of CaE-Nel's existing

•

relationships with Canadian businesses and its 16,000-mile backbone network across ths country to move quickly in providing the DSL capability, which permits high-speed data access over existing copper telephone lines without interfering with voice conversa'bons.

• •

•

egg~

Tricera~

Intuos

4x 5 6x8 gx12 12 x12

Cpm uter Monday - Friday SAM -5PM

203 1830 West 5th Ave - Vancouver - 733-5702

. vvtjvw.tricera.corn EPSON Expression 800

Speed to market created the OSL leaders in the U.S. and it will also be the com petitive diffemnSator in Canada," said Michael Malaga, NorthPoint's chairman and chief executive officer. "By parlnering with Cag-Net, NorthPoint is strategically aligned with a leader in the Canadian telecommunications market with the network assets and customers that will enable us to establish the nation's largest broadband footprint by the end of the year." Cag-Net's Sprint Canada subsidiary boasts that it already reaches some 25 pement of small- to medium-sized businesses in Canada with its long-distance telephone services. Sprint Canada also has some 186,000 Internet customers, most of whom use its dial-up senrices. In January, the Sprint unit announced a reorganization to position itself as a provider of Internet protocol (IP) networking services with a business-to-business focus. "DSL is an important component of CallNet'snew data and IP-based focus," said Kevin Bsnnis, Cag-Net's pmsident and chief executive ofgcer. "This joint venture with NorthPoint will also provide Cat-Nst with the high-speedbackbone we need to supportthe e-business applicaliona we' ll be offering to customers, through... Sprint Canada."

Also joining the DSL fray

USB Ready

EPSON Stylus Photo 1200

Dynamic Range 3.3 Crisp accurate images Top rated SiiverFast Driver

EPSON SUPPLIES

rye, Photo paper

EPSON Stylus 1520

Glossy paper ink cartridges

I)O o+

Matteheavyweight Photo transparencies Adhesive photo sheets Banner paper - 17" x 45' Ironwn transfers sheets Back-lit plastic - large size

EPSON SUPPLIES •

•

17" x 44" Paper sizes

NorlhPoint is one of several U.S. companies hoping to deliver DSL services across Canadian networks. On the same day in midFebruary that NorlhPoint and Cat-Net released details of their DSL plans, the Canadian arm of U.S. parent PSINet Inc., PSINet Ltd. (hSpy/www.psLca/), announced the roll out of OSL services for businesses in Tomnto, Montreal, and Ottawa, and plans to expand to other major Canadian cities by the end of 2000. The PSINst DSL service wgl allow for maximum download speeds of 2.2 Mbps and maxim um uploadspeeds of 640Kbps. PSINet said it is relying on technology from Alcatel. The service will run over Bell Canada's local loops using DSL facilities provided by Sell, linking to PSINet's own backbone facilities, said Bryan Boyd, vice-president of PSINet In Canada. Bell Canada, the incumbent telephone carriersewing Ontario and Ouebec, ouers DSL service to businesses and consumers in major centres in those provinces, snd most incumbent carriers in other parts of Canada also pmvide DSL service. Late in 1999, the Canadian Radio-television and Telecommunications Commission (CRTC) told the incumbent caniars they must make their facilities available to Internet service pmviders 0SPs) at reasonable rates so ths ISPs can oNer their own DSL services. The ruling foEowed a months-long battle between a group of ISPs snd Beg Canada over the terms on which ISPs could use Ssg's facilities for DSL sewice. Boyd said PSINet's service will cost 8499 monthly, plus a one-time 6999 installation fee. which includes a routes

Other competitors rscenSy entering the DSL market in Canada include UUNet Canada (a

.' EPSON Perfection 1200 scanner now in stock

subsidiary of giant MCI Woridcom Inc.). and Rhythms NetConnectlons Inc. of Englewood, Colo., which is partnering with Canadian OCI

Com munications Inc. (a subsidiary of Optel). •

•

1(NI APRIL2000 THE VQMPI/TERPAPER SDEDITION wwwcsrauacampvtss.corn

•

~e wsbytes

c HAN DS O N w

Low grades for Real Science Useful content hampered by interface, multimedia limitations By Jean Agen-Ikeson

discsbefore Ifound avid«o «gp.Thereareseveral on the Physical Sden«e disc, but they are olds, as the publisher suggests, it is more untitled and you must read the text carefully to find out what they are about. Most of the clips appro priate for 10 to 13 year olds. Some sections are quite useful, though. A arevery short and seem to have been thmwn section on reading technical weather maps, for in because the developer had sequence on a example, discusses premure change, dew point, particular topic. The gashcards feature is interesting. By and the special symbols used on these maps, clicking on the Ilashcard icon within each topic, a series of words appear one at at time. The «ards flip over to reveal the degnition of each word. This feature might have been developed further to help middle school students The depth of some of the material is skimpy and rather than being suitable for 10 to 18 year

eal Science covers life science, earth science, physical science, and astronomy in the form of a virtual planetarium). However, while the box for this four CD-ROM package is enticing — saying its easy to use hands-on format will help users build s«ience comprehension and improve homework skills and report writing — it doesn't deliver on all of its promises.

,.'„Real Science

Compton'sLearning:RealScience From:TheIeamiag Co.

studying similar topics atschool.

hnp:llwww.lheiaam ingee.corn

According to the box, you can add facts, graphs and degnitions from the glossary to the Notebook However, attempts to do this by

For: Windows95/98

Price:$39

leh- and right-clicking the mouse, blocking, But first the good news. The text on the subjects covered on these discs is integrated with numerous illustrations and quizzes. The best feature is the experiment icon, which links to experiments that «an be run

independently of the computer with simple, commonly available materials. For home s«hoolers or teachers, this should be a nice aid. Directions are clear and questions kids should be asking while they complete the experim ents are included.

and dragging the object to the Notebook all failed to achieve this result. Nor was it possible to arrange the interface so you could see the text window while retyping its content into the Notebook. Te«hnical support did not have a

copy of the pmgram. The program has aglossary, but clicking on

such as an S on its side with an internal dot, whichstands for freezing rain. Though thebox daims "1,000s of images and videos," I had to go through most of three

terms that are printed in color in the main text (a convention for indicating hyperlinks) does not take you to a degnition. You must click on the glossary icon and search for the term. This

ompu e ' Mon.-SR1..10:00-18:00' Snn.12100-17:00.

warrant and I-monthFREE internet

is no advantage over a textbook other than saving trees. Multimedia CD-ROMs have the

potential to —and should —offer more than the printed page can.

Compton's Learning and The LearningCo.

brands have long been synonymous with quality educational products and innovation. What happened bere? 0

Snow scrapes NB-If you' ve ever hurt yourself doing a Mactwlst lor even its Burger Rip variation), wiped out uying to get some Canadian Bacon Airorhonked on some unseen object and lived to tell about it, you'm the kind of snowboarder the Johns Hopkins School of Public Health wants to.get to get in touch with. In collaboration with lnteliHsalth.corn, the medical experts have launched a Webbased study to collect injury data directly . from thousands of skiers and anowboarders worldwide who have been injured on the slopes, or who have bad gnarly accidents and emerged unscathed, INote to the pins-

\sr-and-Knickers crowd: the researchers say they don't need wsr storlea fiom telemark or

ooas-country skiers3 hlfp:/lwww.injury-study erg

Burnaby

Richmond Tel:278-7886

205-58$6 Fax 205-9088

TECAt278.1159/Fax278-1137

¹3-5901 Broadway

¹207-12020BridgeportRD

Closed on Sun & Mon.

(N0.5 & Bridgeport)

he lowest Price, Highest Quality aud the bestservices!!! ops owevtlax k7-550 Onlv $1429

wiib k7-500/6001650/700NIhz

$1419/1469/1579/1799.00

•

pgkabrd

5 00Mhzznfy $1189P11I-500 Mhg only$1r369 P3-550 ONLY $ 1 4 99./ID

pill-533/550/6819750 $1199/1239/1289/1519.00 Cel400/466/500 $949/979/1019.00

PBI 533/550/600/667 $1379/1409/1459/1689,00 Celeron - 400/466/500 $1109/1139/1179.00

Gigabyte/FIC Athlen K7 200 VI /k Chipset 133Mhz Udma-66 Motherboard UDMA-66 Mainboard Asus p3b-f 440BX Mainboard 64mbpc/00 SD/IAM, l.44 FDD 13gb Or/mu-dd HDD, 50xCD-rom 64mb SDRAM pet 00,1.44MB Flpy 44mb SDRAM p«100, 1 Aemb fiopp 8.7gb Ultra-66 Hard Drive VooDoo330rkryy raurAGP /dmb. 13.4gbHardDrive,56k v.90 Fax/Mode ATI Xpert 98 AGP-2x smb S3 SVGA AGP 32mb SeusdBlaster128,480w subwoofe 50x CD-rom, 56k v.90 fax/modem 56k v.90 FAX/MODEM SeundBlaster 128,120w Spks Win'98 Keyboard, Mouse 8« pad Win98 /ieyboaid, Mouse Jr pcd 3D 16Bit Sound Card, 120W Speaker Win'98 Keyboard, Mouse & pad ATX 19"Case, 17" SVGA Monlto 50x CD-ROM,10" ATX Case, 17" ATX Case 250w, 17"Monitor 17"SVGA Monitor. 0 ti on: AsusK7Mmb + 25.00 mira syrirmr purr/rxrx only: N T 4.e Server5 user SZZO Ms Mausrzbririrrln $23

tvfadows 98 vrrz $/zadd Ny 4.eubrauarinx gm Ms/rammr Keyboard $37 MS o ee zem rrxx/f hxrixerr / rn arrinxal SZae/see Mcwi xdxwr 2OSO tr/X9

Packages

Motherboards

pill-533/600/700/750 51459/I 539/1889/1969.00 p11-350/400 $1229/1259 Intel cc820/Abit BK611 ATA416 M/B 64mb SDRAMpc 100, 1.44 lloppy 13gb I/DMA-66 7200RPM HDD 56k V90 FAx/Modem, 50xCDROM TNT2 M64 32mb AGP SB Live! Value,480w Subwoofer Win98 keybord . mouse 8« pad

D k6-II 333 $549.00

100Mhz Mainboard 32MB SDRAM pcl00.1.44 fdd &4gb Hard Drive. 44xCD-rom On Boanl AGP gmb, 56k V.90 Modem On Baud3D Soundcard,120w speakers Win98 Keyboard, Mouse & pad 15 Tower Case (Monitor Extra)

CA@Wc K>iS ~~~

Authorized nmirr

~ onz r

K6-11450/500 $569/599.011 K6-III 400 $ 599 .00 Intel Cel-A 400/466 $589/609.00 P-11- 350/400 $669/699.00

17" SVGA Monitor.

Avthwimd Oesirr

~ ~ ='~ T'~"

Video / MODEM /Sound

Asus p3b-f/p3c-2000/K7M-- - - $ l74/235/233 SVGA15 "/17"/19"- - - - - - - - -$ 179/249/44 ATi A i l -in wonder i 28 AGPi6/32mb-$21 9/309 Asus PSAb/P2b-s U2Wscsi — ——---$129/459 Viewsoai«17"Sizzs/ps775/azzi - $ 539/559/3i ATI Xpert 98 Sm/ZeeeIdmb AGP--$65/txe TO 100Mhz Mainbosrd,AGP gmb, Viewsoaie is" v95/e790/ps190--$577/539/6Z3ATI rage fury Tvoar/magnum32mb-st79/tze ABIT Bhd/Be611/Bpb/ZM6--$149/197/195/I 3D Sound, 32mb SDRAM Sony.25 i 5" ii nzsliz" 2 i ogs- - -- - $287/46 Creative TNT ldm/32m/I/ttra -- - $ 99/159/zm With AMD X6-//333/450 $269/ 329 Gigabyte Bx2000/6csc I/bvxe+---$155/189/119 NEC.25 Es oo/M500/E750 — — — $325/329/573 Diamoad Steat/Zzeeetntra 3xmb--$ 129/Zse 17" 72evzryeeTIIS".25-.$313I385/24Matrox G400 32mblDeai/MAX- $165/223/339 IntelCeleron 400/466 $299/339 Intel cc820/810--- - - - - - - - - - - - $ 198/159MAG Sunsamg lz" 750s.27/750b .26— --$289/36 3dfx Voodoo3 2000/3000/3500-$129/1$9/339 Intel P-ll 350/400 329/359 Hard Drive USR Win/Hardware/wits andes-$59/76/ee CD/CD-Wrngers/DVD Please Call for currentCPI//Nlemory Price 8/13/20/27/34gb $153/183/219/369 Sekvee--- - - - s ge ACER 50z /Creative 52x lssz CD-ROM-$59/63/5 Motorola/PCtel PleaseCall for setup your Network. 13/20/27gb 17200rpm)--- - — --$199/249/365 Souadalaster 16/12$/LlveValue-$33/45/72 Pbitl ips4x4x24x/LG 4x4x32x CD-RW--4249/26 Prada/58ffrg mstock Pkuge Glttffffw U2W Scsi 9/18/36/50gb-$450/689/1289/1379 Toshiba dx l Pioneer inx lax DVD — -sisen69/l3

IFn ®~B R RAW'8 O 7

www . ~

nat es.corn THE caMrPUIBl PAPER sc EnllloN APRIL 2000 108

< CAREERS & T R A I N I N G e

J&L

a Match Price

COMPUTER

• Spscfa) Grders ' Quich Shippini

Good Services

oples Vltimedi& &LfC

e Great is)actions

600 Kfngsway, Vancouver, S.C. Viy ug Teb (006) 263 23yy Teb (606) T00.2130 Fax: (601) 266+663 www.jlcomp.eom

•

T060 Sranvige Stmet

((ggta Monday - Saturday 10:00 am - 6130 pm Sunday - Closed

Vanceuvar, S.C. VSPap2 Teh (006) 203-2261 Faxl (00S) 26y-2263 www.peoplamm.corn

~eggg~i

I a Uaaa wradense

1452 Ay.

12.95

ayecdEwaes

21.55 14.95

lge ol Emasl 1

EMMDIInlnloo

ChC -lhelor ler

4EN

cnyamow 7558

leamosla MNI

I 7.95 21.95

CrarAAN2 calNIOA

27.95

Ckc -Semen

Chaoaa Cd loPosh

yrdacno

ONa Face2

SHS

hl frana f WO AWN aaw wgls

Oyl kar WH Osssae MaA asnlsr 2 MSCherarh el • N hach N

WD Sseen Iyfm E.e Mk Snarls N My Oft 2.E

lrrnla 49.95 19.55

ctc csarcyerae»

fk canywnlyearner) escN aaa Uxl UdsRarer

Clrtnss

IWay Ol hah

nsreaes crd caoasa sy Gone tkhla 8

Cenaey Ws

Feepaysstets. Da

WW Cenlrsl

Dasher ly IIW

Cy Saa Cearkre

hcl hnea Asneeafl Peeler

sfenyk padahl

alders Gala SaNe ta» 2

alernndr aay

ysyr

lys Ol Nrcka

Oasesvs

Anean fal 2 Sor leaf Snasn Seel 2CO

A Uhary ashry

Wisest«2

Nol Ua Oeelfe any a

Ia shay N Peaer drool

EWN 1

asnw Ielnnre Ianaeee yAHd Hehry

Makingthe most of PowerPoint: personalizing the background

•

Rs4fhn II

Awylsdah fran» Pell INC!a

PISI Sr I Ihr M Hsday

Foaml.c Feast

fhalfenkay'N

Cal

42.AI

I 'litt

45.af • 7.95 I RN

• 5.N

Norh enhdahleaads Gang Satl lalo 2

Col 28,95

Ganeaak 9Eghao Nam

45,N 14,'N

Sln Araonyo

IW uh aa IN A\anlaa IW lte CwoAWface Heary Geo 2

N.yt

hhne S • Inogalddk

87.95

HordsOIy

4y.rrt

NosesMSM• eaaskyn

Ia Mchxay yta Haar le Nasl Narrate E2

I'P.II4

21.95

laaodf

21.95

lagdy CX HN

wale IDly 7 placf

SI.95 I • .'N 19.95

lsmmhyl Ws IS SNI

Ikct

Nnylh Chgsn Hsnor Oned

Meeeusn ECaaa Mlaoehd 2SU

MlCorneal Flgnl 5hslakr

IUMes srsosy al

IP agni lhnlalr Nyy Ml Nghl 5haalo 2SU Ao IP NI tha 2SP

Mlma wde cae mp Nyy SMagicVy

tkm I laeco lsgacl Seas sochy I yw Haco hahy 8

Haseforroehl . HyhSakes 1st ms

sp.rrt 11.95

SP.N

211.95

Pleasance

aeeowasw Nelly

a Arum C aaossaeky Cselrlm Orl eessss C aelUer Wray

eledfrraae yaa Alasedc' 2 ka O W y . a e

teal

1RN Ah yla Ina laos Award

IN.N APlsalatka

Ika

l ke 5deeense

II .N 2EM 4EN

I EN WDEOaa

lyN

R WU D A N W r

4EN

lyN R W aswtrn r MI N 4ka CsslUarmes N N Hwaasleyryamrssd f nd N a sesussll FEN Sdf Usa EI M.N caelaplaat N -Ure f4IN Ihr awly lhasa sass t ees haoat l Eww ss p Ikey Usr lear Asans ltakhawlrlhcUar MN Rs e h r 5sltrl a d HV NIN eaeysetyhdal fk4 4 teat fkal IWHWahl f Wa 7PN kalaroyaksl Sha oseaa y kN W e m e r y NN A U4dlll / l l N N / E E N ahensasala IEN Cst aw ant NN a w s s f ' Assmilt

4a. asIhe IWs Ply

Fun Learnln

4p.yt 74.55

N.yt N.N Cal 12.55 14.55 45.55 tkyt A1.55 15'PE

Hockea

I'P.N

Wraafshh

EI.OE

Arch Conmorm Preach Aoacaee lamenl Plree Ol IaHo lo

Chas 2 CUda 5

Eaeoom Roose

21.UI

42UI

• 7.N Xt.lrt 2 I.lld

Aaanoll Iwnyfre

24.N

shan

21.95

kealera Cae hn Ctf tah

ym yama Ark Sfa

yea Eeo

SOW a tokyo SpecCyl • yaal 8

So Cna

Sa OIN Soechal

Eke ass oedoe caEmote feedlot hkh Goa

IONI . Meal/Or tger Rhah irlr

agosheds2SS

lomh llae 4 torsi Arnw!Non andorra

No Iaay lt aafr Na Ey

Nlele srf a Af

• Ryt

• l.95

• 2.95 • RN • 1.95

cr osnrs Haoss fly sar cylhaa ~ sa Osphe drya csee

emerkynr Ua

Caadeaoe l l of

csselaHse asluINtl

82.N SI.N

So llea adder Esl

sooth. fac4 ~ Oo rara Aaoa

lh esetl ' Set r Snye nasl

wew w t ya

IW E

Srya llaar lhdst Coala R soon

lyssa 1O rara ta ad law 4rheeaeseOa

cAeEesae

fete 84N

lt N 24N tlM 24th

Eayaaty ts ehuetale a nhasea EeslAssa

a a h n mllelel IEN NDSsae Whryma UIN lcM fkle Issleest

fkN ft a • hl EN fka l aeykaaadc¹ysa f EN

2RN NIEesaa

f Roy le feet Ua faa As f/kodesNa M N etlhCWOsaa ak45 fesylmaarl fAN UrLWe 14lasr I844 Oaa ~ dr eeyra fka Use Aer EN IAes EEaayly fky5 l helmsa a l 0 tRN Nesihasldlar fw e Nfkaeeata rfye lrdarts ra l fkN Dhy hsaas Ssyla4t IEN Nreshanansratr 24el ICHarPrsea Na 14N on elenekesr4f t4N 5 4 aal 2SN HaeteahaaN M N aeer hrr Ua Nel fka era Its U

f4N Occam ta

24N MsaeaCssmal

I F85 N I W D U

Col 28.95 • 7.95

IRNPS

INes ot Anllee

2LPE

ahaelO any

IOECUfCSS.

f44l

a.al Ikey leN

rays fyN IRel tAN fkN

faN

Do-it-yourseg template To give all of your presentations the same corporate look, you can create your own PowerPoint design template using your company's colours and logos. To do this, either open an existing presentation to use as ths basis cf the design or create a new one. Choose View, Master, Slide Master, add your company logo, adjust the fonts and colours and add a background image if required. Oelete sny slides you don'I want included in the template. Create any slides you want every presentation to have —a welcome slide, fcr example. Save your template using File. Save As. then type a name. In the Save As Type list box, select Presentation Template ('.pot). select the Presentation Designs folder. and select Save. To use the template select File, New, select the Presentation Cesigns folder, select your template,and cfi ck OK. You can also apply your design to any open presentation by selecting Apply Designfrom the Common Tasks toolbar, then choose your template and cfick Apply

Croppingcgp art To crop an image, select the image, then choose the Crop tool from the Picture toolbsr. Click on the image handles and move them to

crop the image as desired-moving a handle Learning Ned Hat Continued from page I00

Vlrea lamonaa

acr cna2ceca

Creating an agenda slide To create an agenda slide containing the titles cf afi the slides in your presentation, select View, then Slide Sorter. Choose Edit, then Select Ag to choose all the slides, then click the Summary Slide button on the Slide Sorter toolbar. The summary slide will appear at the beginning of the presentation. Ycu can edit it like any other slide to fine tune your agenda.

Copying PowerPoint slides Save time when you' re creating a PowsrPoint presentation by using slides from previous presentations. Select Insert, Slides From Files, then select the Find Presentation tab and open the source presentation. Select the slide or slides to copy and click InserL These will be automatically added to your new presentation and formatted to match the other

slides. Table tools PowerPoint 2000 has a new set of table tools that allow you to draw tables much as you would using Microsoft Word. Use the Craw Table tool like a pen to draw the table boundaries and to divide it into cells —you can even draw diagonal lines across table cells.

Graphlcaf bullets PowerPoint 2000's new graphical bullets option allows you to use pictures as bullets in your slides. To createa fist with graphical bullets, select the text, choosy Format, Bullets and Numberin, select the Bulleted tab, then click the Picture button. A dialogue similar to the ClipArt dialogue will open, and you can select a bullet style from a list of options.

Anfmated tmages PowerPoint 2000 now supports animated GIF flies, allowing you to create sophisticated animations using third-party software. To add an animated GIF to a PowerPoint slide, select Insert, Picture, then select either the Clip Art or From File option depending on where the

animation is located. Some animated images are available in the clip art collection in the Motion Clips tab. Select an image, right click on it and select Play Clip to view ths clip or Insert Clip to edd it to the slide. You will see the first frame of the animation on the screen in Slide Sorter or Normal View. To view the animation in place, select ths Slide Show view bunon. ~e l an Bradley

Language

4LN I 7.95 27.95 14.95

INnh Chas Vkho Hghl» 2

PowerPoint Central gives you access to additional useful information about PowerPoint as well as links to additional resources, such as clip art, sound clips, and templates. To launch il, select Tools, then PowerPoint Central. If you' re connected to the Internet, you' ll be prompted to check it to see if an update is available. If it is. you can download the most recent vsrsicn. To make ths best use of PowerPoint Central, you' ll need your original Ogice CO-ROM for access to files in the ValuPakfolder. Your Internet connection will also allow you to locate additional Web-based

I h t W l a a l f h D W , 8RN

tea I WWUcrlfesUe 4E45 t kN IhfauisactPrs I IR N

OI.N ladarr aeathr

41.st 2kyt

ona» Goner cldlctd

in removes part of the image; dragging a handle out reveals more of the image.

PowerPoint Central

I 'P!IO

Faaaace 2 Ganw Haghl5

Appll ation

Uoah 2

Uehad ldogy 2 Coomy Utah - caa ol ADW Eselhal

ou can customize a slide format by adding a photo or other image to ks background. To do this, select Format, Background, choose Fill Effects fmm the dropdown list, then select the Picture tab. Choose the Select Picture button and locale the picture you want to use as a background image. When you select Apply, the efiect is added to the current slide. When you select Apply To All, the slfect is added to all the slides in the presentation.

f 'MacVwsi onAvall sbl fi So&w arngsfgaing@pieary

hlh aaa lo N AImcsde IMngsCy Oeany Ihl corn arla laal

106 APRILm c ME GQMPUIER PAPERgc EcllloN aaa.ctnadaccmgyfskcom

almost a third of the book. The mst is devoted to showing how you can make this new OS work for you.Subsequent Chapters are devoted to such topics as setting up s local network, getting connected to the Interret, setting up ftp and Wsb servers, using ward processing applications, and even finding and playing Linuxbased games.

As with ag introductory books, one wishes this book offered mora detail on celtain top-

ics. In several places, Learning Red Hst Unux consists largely of step-by-step instructions and not enough background m ateri al.Once you are up and running, you will definitely want to learn more about this OS, and for that ycu will need to buy another book. However, this book does exactly what it sets out to do: get the Linux novice user up and running useful applications quickly. If you are looking for a gentle introduction to

Unux, Learning RedHat Lfnux is well worth checking out. 9

•

Windows9$ Developer's Handbook

NCSE Test Simulation oftware Package 'T~ s>t' I'gf7M®kE.

„gg$5

' 'ion~+-'

Reg442.9S

Ilsing Office91 3rd Edition

Reg414L90 4CD-ROMS

os:

Reg:$8L99

HTNL4 II cashed

Network IIPgrade 4 Naintenance ~ Ouide

~ Reg410.9S

egp$101.99 Massive 500 Paye Authonty

10,000 Nultimedia Software Pac I

' +~®

'P • • '

The Internet No ExperienceRecluired

Programming Nacromedia eb Publishing Pe COI WebPages Ilnleashed ~W50C Web p

le ~

• P •

Reg479.99 1CD-ROMS Clip Art Reg449.9S SoundFX

Reg410.9S

•

001 5

•

I I

' I i

•

I •

•

SET A WKBSITR FOR ONlV $14.95y e

I i

Domain Hosting / Registrat 10 Email Accounts 10 Auto-responders 100MB Web Space Easy Web Control Panel PERL / CGI / Java Support FTP / FP-98 & FP-2000 Support pnce oaaedon I year NJa pmd. GSTnol Included Infermlcfee nolmclnded call for delwla Lnwfedome offer

per Inoh 604-63%-5000 Now you can advertise your property on North Alnerica's ., best residential rental web site!

AyuwCempuheul. ACPMmhmg AddnCwymf Co ADRClaps'm AEEhdmde heTsdmalmfwlm, hhm Commetfmheogy hem Plo AyadTadmohye inn MICCoepri m IIOPCmupm SaalcpCmqmlma C.C.TINI

Cwela A.Ihnl CeehmLatch Eu CETPehcgw IN. Compo abg Cfphl Cm npm hl CSPGepue ClangEdgeGepdw CpmmeSphea Com

Oieea Sawe Cka

NewapwenNI

wwwJupe

ww~ WWW ~

www Juhncw wwIaamhmsNI ~

ASII

weomuwpooNI ww.sspofure wwwA Itccn wwwslfylmm eehwlsuece

wwwlmahcm wwwaaeladaw NW.~

ltgyshw IN NSEE Y JSLGepuhfud. KIK~ Lye Melekng Mac Stsgw T ~ Mamm yHams IN.

ghgshsbrbybh ahb'g lgborhi More than one million users see Rent Net aparunent and relocations information every month!

C w p.

ggowIry year turbg

IWW

thoro C oncept

Through the Rent Net and partner sites mcludmg Yahoo (the most popular search engine), NBC

MchlTech Inlmnaycnal gin) menageTadwlsyw NatswkCmad NawTjdmCompulms Hedge nwl Nweea Ikwwc

interactive, USA

NIW

Today and Class!!leds 2000, as weg assearch engines Excite, Lycos and Infoseek property managers will have

NNW .pcmmDNI

wwaueyurgncw

ww uydslcemscw ww ~ hcca weyhyslamsimra wwwcyhm cfweml

ewhwhedearn

I W N~ WN~

CNll

Owmbshhlmsdie www e ~ cw Eesmno Ee Cwpm Sydew wwwmwarneJxwl PLY Gepae wwa~ rfaw uhsfySnhw ww.kwrcfwcw RmdfsfCeqmhr www.hma tcom GDSyahm c Iwwghydawhclm GmeicGeprimc ww ~ lmca wwwgekuw wfen Gehgcom fue NNNempmfcmdwcw Ha PriceCmmm l aBede Homa gawISNWPuthhhg LIL INwnaceie HyuwCeehmEnlmpnieLTD www.P hNliowl h?nN haeea ~ hm. wwwallahhaw hheew Gshey Swem NIN.WNJguwl hhuowTochndegyLhl ~ fe IfefwseCam peuhc eeJwenplwAwll legfymlBaees ha I NN~ d NI Nwwkdw gshtme Inhrwi Gam my lemmhCVLOhktubw www ~ awf hwalgmoSnhes ul.

Ihhhcck4ly Ih AgeCfunpm Pkm PmdcGrusSsmlwm PCPiwel PlwaeI Splann Cmpmasw PlillkdhwEphquew Peridmbom Pafecm Comu plw Pcnfum m Compulmu PmwaComyuke Prifwsduhmm Iewpeuw WWW PmyaciMekary GumheDge Pehds RadwlCwmwwakw IkwkConydw Smmlaclmlalriss LM Sfmylyomtudm bylawhhmal SOHO Skyway SaawisychmsCmeh Sweoahtwhmhyw tb TINCache Ccmpar aw TksonoOSCDSl mple. www TfcmaCampier Casu Yamm Compuhe www mmlemhqumi MsyshmLu badarihcomyuiw wwhuwgsle wwwmkphl mtoNW

gghrh lylty โ ข lays yhdhbclas Get your properties on the most comprehensive web site of residential properties in North America. Call yout Home Renters Guide sales representauve now for informauon. Get on the Web:

maintain market presence and reduce your vacancies, fast! A service provided by Rent ยนt i n parmership with Home Rentery

access to detailed

information. graphics, e-mail, fax and their very own web site!

YOMwle be seehg For more Rent ยนt

Visit us at ufufus rent.net i n formation just calLVancouver 604-608-0316

Our promotional campai5ns will draw surfers to Rent i!let and increase visiยน to your site)

ggV

We' regoing to use the power of our Guide and Trader publications across the province to support, on a continuous basis, the Rent Net web site. With a combined readership of over 225,185 amonth. you can be assured that anyone with access mthe Internet will

soonknow aboutRent Net!

e ace

fs21 f4 Powerful Windows NT Web Hosting

o Di i t a

Our hostiug plans offer eveiychmg yauneed. including lull support forpopular apphcati onssuch as Access.M S SOL ASP. Cold Fusion aod PERL With Pacilic Oolid~ you' ll gel tha fastevi, most reliable Web

servers.a high speed redundani backbone snd estaffol qua hfied indnuluals We can gel you up and runnmg m as little as 3O mmutes. Visit us on the Web or call today. Stan

Redundant OC3 Backbone 399' uptime

Full e-mail serwce

Unhmited FfPaccess Your own CGI dnectory Uve Web slatrslics Microtoh FronlPege Vnusl lnlerDav Active Server Pages Cold Fusion

SEARCH ANY TRADER PUBLICATION IN WESTERN CANADA

CyberCash Passwordprotection

CHOOSE FROM OVER 6000 VEHICLES • CARS • TRUCKS VANS

Darly taps backup s

M I N I -VANS 4X 4 s • RVE M O T ORCYCLES • BOATS

Zo-hour on-site momlonng Same-day activation

HEAVY EQUIPMENT • FARM EQUIPMENT • AND MORE!

No setup fees 30 day money back guarantee

RADER I

call 1-S77-503-9S70

ww wpacific.

ca email: in taCPpacific.ca

canadatrader.corn

Looking for a Creative Way to attract Consumers to your Web SiteV

UNLI MITEDONLINEBUSINESSPOTENTIAL Release Your Full business potential Online, with Gotoecom.rom, Our Team Of Professional Graphics Designers S marketntg Proteasionals Will Enhance Your nosiness Online S Otf linn. Call For Infownation Abnut Our Providnded Servir.as.

HOSTING

OESSGfd

• Domatn Registration • Domain Hostmg • Secum Socket Layer Server(SSLS)

•

' l l

•

I I I

. .

•

CO ecorn A

• Business/Personat Wabpage • Web Graphics Design • Database (Access/SQL/Cold Fusion)

please visit our yrebpagc Foi A L st of our current chants

4 " K

'" OIIjutIer'

c TECH E N TERPRISE n

When teams 90 awry are a number OI populw business books that extol the virtues BAdpsyoifs of teams. With the fkwd of ~ and teamwork softwwe naw available, it woukl appear that Team Mifisnniwn is upon us. But maNng teams work fsqiifes exacgy that... wmk. In their book Why Teams Don't Wcrir gyfwglas and Mclntyre, 1007. ISBN: 075251 3501), authors Harvey Robbins and

Michael Finley describe quite a number oi condrixms UAdsf wtri ch fBSUIS nlsy go avxy. The major causes can be gwupsd into there of ' creasing severity and potential harsh consequences for the team. First, there we d ~ team membws. Consciously or inadvwtently, members of a team can lack group stalls, which afiows them to sabotage the needs ol the team. In other cases, selecbon of

•

team membws can lead to severe skill overlaps, wlich can crests potenbsl mbiguity or cwss-funcfiond congct when hying to accomplish tasks. Cteariy team leaders shoukl nwrimize-if not trade out fx eliminate —dysfunctional team msmbws. The second problem, ill ~ tea ms, is much more serious. Again, it can be inadvertent or l iberate. A team without dear goals

•

• •

•

and objecfi ves can be created much more readily today with ccndificns and markets changing so rapidy. Even when ON major goal is qwte dear —become the numbw one com-

pany in Internet software, for example—the lackofdefi nikon and priori fi es can lead to confficfing eltorts. A precise defini5on of the measwes ofsuccess~ the number one company

in Internet Softwwe within the next two years. starting with corporate Wsb development softwwe, followed by a 50 percent or greater marketshoe in afiW eb biowsw usage. forexample-can make all the difference in ON world. Butsome5mes top execubves do nothave a good measwe of the market or realistic concfitionsnecesswy forsuccess.They can define Ixecise goals, but then leave tewns wilhout sutficient resmsces, refief mechanisms, nnum. nt measures, or the ability to go to

external markets to meet Idl resowce needs when they come due. Other times a team is deliberately given a Mission I tpossfirie with gosh and consaaints so high, or esources so low, that the piobabiTity of suCCSSSN lifwtBd wifilOUI th8 tesnl delwering e ~ e ffo rts. Smcafied Death Mwch systems prcjeds are notori ous examples. with no amount of ~ soft ware cspabte of wducing ON extra worlioad. An engifww I ~ for a story about expmt systems spoke ~ cn m ganitational ~ . As a member of a team creafingan automakM expertsystem, he was the focal point of the team efforts. The team had the latest in groupware and was progreswng well towwds reaching its goal. But this engineefb expertise was cwcial to the team's sucHe enjoyed working for ON rporatkm and himself well paid. But he had seen layoffs and downsiring M other companies. Hs haddacdedly mixed feelings about afi cwing the team to tap into lis unique Imowledge and automate ik I am damned if I do and damned if I don' t. 5 I do give up too many of my bade secrels. thwe is a good likelihood thatIand some my fri ends and cfieagufw wifi be laid off when times get tough. If I don'I jiveenough, ON team mllnot succeed, and I as a member will get a damaging mark on my ISCOIO.'

• •

•

Fmafiy ,even given goad info,8 team can sfi fi Mow 8 bscmwe ISSOWIXN we vmy fighk Wifirin two increhs ot the imeniew. the SAgineiu I spoke wfih tmd joined another finn. After he Iafk ON IWABIAiAgAwmbefs of tasln did not have enough mowledge to pnweed and ON pmjectwas disbanded. Ttws the problems sumwnding cofiaboraion and teamwork have become more insfi f tufimlsl. It key IssUes, SUch as coAlpBnsaboll and fair division of labour. have not been worked out wefi ~ for a project. the team may be fatally flawed by sfikrikxtd design (or lack thweofj. And with big name companies like Boeing, Coca Cola, Mobil, and Xerox eummtly laying oif massive numbms of nhpIotxnw, ON ullplicit OIOIBCt BAd tfUSt

•

betweenthe emayee/tern member andthe employer is wearingvery thin. In sum,team and ~ e sof twam cwl ewtainly wduce the fricbon and tedious labour aspecw of teamwmk; but by no means is it sufficient 10 guafalltae OIB SUCCSSSOf Ole Ie~

ciafiy in a context wham stufional trust and

fair nessmay bein quesfi on. ~

Sunet o r

c PLATFORM N EWS w

Windows 2000 Pro a smooth install Next. I i nserted my Windows2000 adapter, a CD-ROM driveand aMicrasoft kcy- yau would with a name brand PC, and maybe • vensmesouls mons)x Professional CD-ROM. h mcssagc came up baad and mouse n Pek 27. the dayMkzamk Corp. OIRBuying a snipped~ mm putcr isa't for I grot instagedWindowsyg SP,and congrmed saying that it contained e version of Windows cially launchedtheWindows 2000 hm- ever)one, but you might want to ~ thi s that verythbN was woddog wdL I in»egal dmt vms newer dum da one I wa2 presently ily af apemtirN symms, I dndded tn appmachforathastonespshahYouwgllearns Ofgce20uh andmnggurcd Internet Explorer to using. Did I want to upgmule to Wmdoum 2000I install Wmdmm2000 Pm essional on my new Iet, have gunne contml aver Tma systemthan acmssthe Wcbtbmugh myptuxy server. campuhw.During thc pmcas, I kept a lag aml timdine of myactions.Comunenary an market gjferhgreupSl firedssgeeLaserPrhfffus shue pmjeaions and issueslike the mportcd 63,000 bufp will havetu wait. High gpeed ghutffe Mefnff Line Pdfnfers I bought theaoaoputera weekmuberwhh this Colour Laser gf Wide Pomuft fakJet Prfntduu hnd of cmrchc in miaL When it amass to autput ffganagement EI Eleceenics Porms inshdbng ancw OS.)Smbarn more and adfer thmugb hssstum il you use a oomputm du» . S Addthorfaed Onglte $)Depot $enrlce Programs you don't dependon to doyour daily work Since I didn't seal a fogy stockedcomputer aml intended tousesomecomponents I alaudy baL I bought a barebonessysum: just a case, m tbciboaM CPU,and RAIIL One advantageaf going thebwebonesmute isthat you can opaxEhmuprfm Ntggg Peaepsim NRES EPEREE e a toptha IQEEE fy piecisdywhat )muwanL Tbae are dcalas in SyeekN pxguummm Syesk«I gvokoms u gyemk 21ppm Spook 20 ppm {20252 everymwket whowill acmmmodate you. gesehrifmggxsgdpi asham6NI 8$dpi 20ppmgug SoiehgecTlmtmxtmd a Tbe pmccssor I decided onwasa 600 Mgh EmdegemAriohoyaogwfph EsuiegsmAdoboPsmgmbrS gmhhmc Adohu pumgmhi 3 oi oheioc Tlm 1& x tmra KL5o,Kl6 AMD hddon. Ies~ )em a P dum m et tbesame dock spccd, butcosts 8200 buc I Psmemr. IhwwK133M v K l 5 e, Kl 6 bougi» a pmmium hsusmotherboard aml aa Peyergeeahm.lug»,hrw, pms i soc puwapz~ psg s. ~ u h0 , upgradedcoomI never warn to sldmp on these Nsasluec pips, omslopu. mmmoiai blonuggipubrc3ueol pmug gguaomehe lgaluh keymmponeats. I alsobought I28 Mgof RAM Am1u uwupuowm, hbohoml~ Medhwolghetgmtuh oshxvuk ina single DIMM, which leavesmelots af mom I»abuseThitmz. 03$IEEE uun lmluk to upgmdc hmhum tgtubT, 1$$IEEE RerkghmgoShgegnm huriaec tumig,66$ BE luabsocuftmT.SESBE pe~IM Parallel The Immponenls Ialreadyhadwere a 26,5 Gg For more than 60 years Pcsgvl Parallel Pries:8 2560 Mextor bard dish, an Intel PastEthernet coaL a Pncel SESSE Piicw SdAN Price: SS,ffulmasl Sound Eh»sr sound auIL a Matmx gmphics Xerox has been aworld

"Your Digital Output Specialist"

N EW

K a r ma

R OC '

P r a cl u e k

Landau pa

A w a r d - w in n i n g c h o i c e s f o r e l l y o u r d o c u m e n t n e e d s

leader in document

solutions for the oflice. Now. with the addition of the award-winning family of yekgouam colour printers, Xerox

'- pay as you go ' EIOUNTA{16 VALLEY, Cau.— .personable',

' {hgpshuuxpom mublecom) has anmouaced phlos fo ager Windows 2000 as. Iwitwawr lo help anaS- aul medium-slee hushvuum {SMEs) decide when awdhow to migrate to the new {)S. g perse)able.com m ea aptri'megan savice imvlda {ASP) «ue offemh fully Wmdaws 2000 deal»Op aluf alber pepuhu softwam kx rent over «m Internet,

can provide the widest range of network printing solutions for

ofhce workgroups of every shapeand size.

Chgeklu Easer Pubotm Epoee16ppmblock, 5ppm colourwith upgmde Sssoluhc12Ndpi block,6N dpi wbhopLcohur lui

Emriuhm AdobePmgcripi 3, Kl 5c Pmeosser.PowslPC133Mhi

lhfis vuri guc 16lb. hood un

: la conlplluy Ivptwmwhri)ve,Peggy Ksgy.

.byhh)hatwere, SMESpay only lor «w ' . modwweurcee they use when .

, they»sert to use.it, she.says. The erimfmny lays phriferm upgrafoswtrich always include inclosed Iawhvsm ' 'aul eeftwsm costs slid oogiwlg w/steals ' maiwlewa'ace-releain an enOrmOuSChal-.

Phaser ~Celeur

PhasesSmrridem kneesPvingm

Phases ~ Cegeo a geRegek ptfuam

PheemI® Cegem

gpos05ppmiol our,t6ppm black

gyomkupu lippmcolour,10

Pmeisser.Povmipz SSNS

Syoak 4ppmcolour, 16 pym bloxk Smwhdmcupto 1$0 dpi colour Eswhgsm AdobePosairile 3, PCLgo Pioeamc PowelPC133Mlu

ggsaswmglric 16lb.bowla

ggoasshoe loser,legal,

110lb. index gfoeotppecplool coulslouk, Ioboli,irouoporoocioi, envelope

tabloid, iobloid eea, tabloid phe, A3,SI«ZLAO,Si, 05, euilml mlos

Saul»huegn dpicohul {12N dpi Iohul opli fea46aa AdobePoslSuript3, PCLgo hscesior.PowoIPC133MI» ggeeewehtm 10lb. bondts 50 lb. inde

lb. index Modh luecplain piper, ghiiv popor,coxlsmik, ususpslosuioi, labels,I-ihi» essxiols. elwelspos IshriococigbT Eeomsl Pologolsuudold

coldslook, t.shiceoxsfer, esxipoloxcies Ihulocopliouol lawheeclgbTBhemel Pologolihxduld

List Pncel S Eddy

list Pwca S S~

Ihastfpc phiu,ghsiv, lobels,

ppmblssk Ssiolsgm up to12N dpi colour hahgma AdohsPo»gcript3,

PClge

Suyloc opgoo ol

ggsdio waglac 16lb.bondu

hlaheoc 1$6$bTBhsmol 0306 Parallel

Ilglb.index Noao Ague plain,coirimuh lubols, tlsviporuxuiss,exvulops

lÃEEala gff fygf UstPrfcm Si~

Aliihhh Nhgeiplffh Sieol Pririog

,.lenges for SMEri, which often hove neither «w'hu»get 'Iuu dedicated wmources ta

YaMehl Easer Iiokem

hswhsscubTShemm, Parallel sloxdsxl

Iisr Pricat SSSS

.ah «vm W»Mhereatwae savice, users work via a,

shm4udbye«browserfrom eewxvakriexxxil'e servere. This means

«ow't havet xi upg radeIvmfwem {for.corapal- .,

.Ibglfy, SLrmor epee«) areeltwam {gw laiesr af:the{38 is always avagshle), er'; weiry shout eystewis wurinteaanem{wfrich10-, ~., hswdi fxfhpPesaaablexxxo). The reotwsre soluhoo also means inenaatayrisehove cecum access .aad eau work Im slee or eampsny pm)eats;, floe{aoyImemet connec«en anywhere inthe '

thinking laser printers • c h o ose printer solutions Printer solutions specializes in manodlrome and cofaur pouter soiut'lone for workgroup, ptoductiorl graphicrlprepress end wide ion»at output icguirements. we ojjbr complete instoteliorl ouining eurhorized service ond support for og major printer menufocnwnls. we also

opr computer systems )fern Apple and Intergraph and professional services such as colour caiibuuion, output management solutions and cushlmized service plans

@ PRINTER S O L U T I O N S

worid.

10 9 -3993 Henning Drive • Burnaby, BC • V5C 6P7 t ell { 6 0 4 ) 2 9 1 . 9 3 7 0 o faX: {6 0 4 ) 2 9 1 . 9 1 9 0 info@printer-sole«ons.cem • www.printer-solutioas.corn

apple u epson • fjenicom u hewlett packard u ibm u intergraph • lexmark u qffks uEeklronlx v xante u xerox www.omwouxmputes.corn TICCOMPNEnfupgn SCEDITIQN APRLzcee 100

c PLATFORM N EWS o

When I answcrcd Ycs, I was given two After ayecing to the licensing terms, I was advion Imuto congnn that your soltware ismmoptions: Upgrade To Windows2000 or Install invited to connect to Microsoft's Windows Fanldewith Windows2000, or that smvicepacks A New Copy Of Vtfindows 2000. The 6et was compatibility Web site, primarily to check on me available,bcfomcommitting to an upgrade. With only Micmsoft soliware on my system, I

tbe recommended option, since it would

my BIOS. Microsoft points out the dangers of

rephcc Windows98but keep all of the settings and the installed programs. The second, or "dean install," option would retain nothing and force me to reinstall all of the other sobware. I did choose the Rrst option, but in prindple the second is better. It involves mom work, but provides a sounder foundation for future work

using an incompatible BIOS. If I had been hsd nodoubts.Your situation mayrequire morc using an older computer, I would have been invesdgationand testing.. to put it mildly.

At this point, I started my stopwatch. The

instaga 'on procedure predicted that it would take 30 to 45 minutes, plus additional time to convcn to NTFS.The procedure restarts the computer four times, but everything is automated. You don't have to wait around to answer

Next, I was given the opportunity to questions. upgrade my Rle system Bom FAT32 to NTFS. Just after the 6ve-minute mark, the converAt thispoint, I encounmted awarning about Windows 2000, unlike Windows NT 4.0, sup- sion fromFAD2 to NTFSbegan.At 13 minutes, somepmyamsneeding upyade packsto work ports FAT32, but NTFS is superior. If I had the pmcedurc started to detect and install more concernmL I continued with the installa-

tion, ascongdent asbefore.

with Windows 2000 that I bad never seen in any wanted to have a dual boot with Windows 98, of the beta vesions of the 05. Ttw warning I would have rctaincd FAT32.

lation of nenvorking componentsand beganto install Windows2000 components. By the 25-minut«mark, it was installing Start Menu items, performing upgrades to

,;, Sai

devices. At 19 minutes, it commenced the instal-

proyam and system settings, and removing

temp orary Bias.

C' 'hd ' cQn I ' ' So lie e for

At the 37-minute mark, I wes at a Password

Creatingscreen;andjust aRcr 38minutes, I was up and running with Windows 2000 PmfcmionaL My Rrst step was to try my applicagons. induding Internet Explorer,worked as befom All of myseningswee conect. The compatibility report at the bey'nning of the installation Saggml the Matren yaphics adapter. It is not cuncntly supportml in Windows 2000, which I knew, but I wanted to

see what would happen with an unsupportml component. Windows2000 useda genericVGA driver, whichworlmSne within the limits of the nnolution andcolour depth it offeL After spending some time in my new Windows2000 Pmfcssional installation, I tried a dilferent installation technique. Most modern computes have a BIOS that suppons boodng

• •

•

Rom aCD-ROM. Afier tweak' my BIOSsetpolo

ourca

fea r Canada' o

0 VS S E I want to receive (continuo to receive) Canadian Computer Wholesaler.

0 Bench, store. Oistiict, egieaeimsecgee

Q Cimamk retsiL valuadded e resegers cadmanagers 0 Pwchesicgesa meeiiesdisicgmemgcrs

Nema

advantage of that, and hssthan an hour later, I Iml a bread newWiadows 2000 installation on a Rashlypartitioned and formaued disk You can Rnd more inl'ormanon on the new OS at htlpi/www.mkxtnoR.corn/wlwggws?IKI —mmidscomputes.ear n

0 PiogcctdeveIegmectmessgers

0 Computersense?san

Compsay

Pam to support Adobe POF

0 Technicelmsnsgcmsct 0 Oedga, system ecdspggcetiec ca?lasers 0 Merkegcg, seIesmanagers

Address

Pmv.

f eei

0 Omar/gieesosaeeiir Tbo systems my orgonhagon Integratesormange

Postal Code

eo Immd on tho fogowliig: iekeckcgIhst swag 0 Uaki 0 DOS/Windows 0 Ucxx Q 0?/?/Cmagsgkles 0 Macintosh 0 WmaowsM 0 I tetwmkicg 0 Oth er/pleasesgecgv

Email Sigxetaia (evil w oeixiu w usa

Data ~

~ ii

Aro you bnmlvel In?hoaoghh rosaglng. aml/or dhtrhuthn of computer/ notorklng ayatoma, aohwaro oroanihoa? QNo Q yes Wbhh best chmigmayour Rnn'a prlmmy buahasa at your hcaihn?lekwk eeemgyl Q Veias.edgedgeeier/wmeger

Q Mess merc?em/we 0 Consumer eiecmmics/egico mechixe waster 0 Oistiibmehrlmbmlegmiaeee meseiecucer/OBW

what h thonumberol omphvaaaat ghhlacwgony (exec?onemirl 0 ND -C?g Q 10/?Dermore 0 8/gg-g,?M 0 ?/Ng-CSM 0 I / ?0-18?g 0 M g-OM

0 IN . ? tg 0 ?O.gg 0 tmmtkex?0

0 Ogmr/ pleasesgecgy What h your ibm'a approximate Omaaannual aahoy icksckeeesnM 0 Oveigt m?SO O.Mmigios 0 OvcrgMmigsa 0 Overg?Smggea-SMmillion 0

0 Soiaxaredsveleger 0 S?suxxs iciegrexea/seitwarececsvlgsg Q 0 0 0

to the start of the insodhtion mutine. I took

whhb boat daaeibaa your job goo oioupylckerkcaeesivi 0 PesidemAIP/owner/genemlmseeger

0 No

0 New Subscripri oa 0 Renewal 0 Changeofaddress

Tell

I'ng Channal,

tiny, that's what I trkxL It wmkcdSawhsdy. As a bonus, I was given the opportunityto deleteaml to createpanhionson my dLdt prior

U adergimillion

0 Overgigmggoo-SMmgfwa 0 Ogmr/pleesesgecifv 0 Overhmgfiex-Sigmggex

Oovercmeatpxrehensg sgeom Cmsgmermsimeessec/sambo cemgesy Hardware/segware rate?sr Other/please spcciiy

Xg ewiriici mcc kvcsmvmt /ccwwirwcash vWIscr ar pmcsrmk ?xiPagikrr iviinvi rkr ii?ium dmmku qstrpcwem

You twr? yfax your subscription to CCW:

l410) ~ Or, Nyyty 8?68Iltt

514

P:llmWeV.CCWma9mCONI

110 APRIL?mm tlwCOMPtmgkruPBt OOODIIION www.cscemcompuuoccm

HONG Kt?N ~ Sys tems and Patio ,Compuiiog,aSCom'company.have ~

thei r intsrakm to Integnuo tho

Adobe portable DmxmwmFommt gx?pj tmgr. i into uw pakn compuxng piel/omi. • Ttw ompeiioo aay Om ~ h „designed Io support Omgmueng coimumar marketfor oiocxonh ubggehlng, tmd to bxog a sww hvtgof conan'oce and pmtabgty to ;Adobe cuakxnea. It wiNpwwida Ps?muses yvigt neW COntent, Oum OdrnekstO bueinace

Publistmrts authoia and roadea of oiecworldxgsh'moAdoboPOP. ' pmpilotaiy technology onebkm.aiaotmn'm Istuxx to iotain tbo.visual kitoorlty oi a , document, p'iuemvo ehvant rkunmggn I such aa gmptikm exi texi'wiggn a ahglo ':document, and maintah cromqtlatiem , capabilities, Tens o/mggxe of PDF gkmeo , already avmiabio weldvw vde, Owkxfmg elec. Dtxde books. manimhnod workgow mxieri„4th ami forms. wabytas

< HANDS D N m

Microsoft' s home software suite

includes the Works By Rod Lamlrand

it very useful fordeveloping personal fiscal work you and your family need to do on the responsibility. II you haven't yet tried person- computer .Teak Launchermmalns open when al finsncial sottwsre, this is a good way to you laurmh a particular program so you csn give it a shot for almost no cost. easil yfi nd yourwayback.

ake sn award-winning word processor. an exce3ent encyclopedia, a newly competi-

• Horne Publishing 2000: A rich and broad desktop publishing-style program for throwing together print and Wsb projects, such as grsefing cards, newsletters, personal Web pages and even animated email greetings. • Expedia Stnets 0 Tiips 2000: A mapping program for planning your next vacation. True the Canadian content is a wee bit spotty, but it's very useful if you happen to be

five personal financia softwme prognun, add an amazing home desktop publishing pro-

gram and you are part of the way there. Now throw in an image-editing pmgram and a roadTmm

map application, stmn p Microsoft all over it and sell for 0150. That's Works Suite 2000, and it is soirie product.

Microsoft Works Suite 2000 From:Microsoft CanadaIxc, hiMylwww.mlcrototl.corn Ezfmstsdrelsil Frke; 3159

• Pichxe 0! Expsss 2000: This is not 8 high-

end photomdking pmgram, but for a quick scan or download fmm your digital camera, it has a6 ths basics, snd a few cute triclm

The sevenCD-ROM suite of programs is an amazingvalue. Just look et what's included:

beskles. For most people it will peform a6the (ki iuie msnipuiatlon tmks they' ll ever need,

• Encsrte Encyclopedia Standard: It's not Ihm deluxe version, but le8 very good enoyolo. pedls none the loss, It contains more than Task Launcher 38,000 articles anda goodnumber of aniThe folks at Mlcrosofi have tied the whole suite mation and video cfipe, not to mention pic. together withsnelegant HTML Interlace they tures. Charis and graphs. csfi theTaskLauncher.W khoutk you would • Money 2000: k doesn'1 contain ell the bells simply have• number of Microsoft programs end whistles of the deluxe version either, but $5 over the place. With it, you have8 one-stop, the new interlace and various features make get-thix0$4one shop for 90 percent ol the

• Works 2000: This com application, snd the

product's namesake, inc!Ud03 Spr06dsheet, database,calendarand sddmss book mod. utes. Pmvlously, Works includeda word pro. ceasing module, but the fofiowlny Item shows why it won't be missed. • Word 2000: Microsoft'8 best-sefilny word processor (which alone le pramlcafiy8 must In today's PC worldi.

•

book, calender. worksheets for home inventory, and a mcips wizard fmm Home Pubfishing. It

makes sense.

Swap, swap

going to the U.S.

Microsoft'

The interface is organized by task-which is brokendown into 10 categories,such as Newsletters 0 Flye~ gm r than by pogram. This means 8 category like Household Management will have links to your address

lhee is one little downside to this large bun. die, but it is an inconvenience, rather than 8 speci Tic poblern. Because there am seven CD-

ROMs, with gigabytes of combined data, you do haectc do 0 bE Dfdi6k 6Wippjng, to put It m5dly. The program wfil ask for one disc, then another, and another, etc. You oould spenda fsw thousand dollars on8 multi.CD. ROM carousel, or walt 8 few months for the expected single OVDversion of the suite, but otherwlee disc swapping I• a small price to psy for s huge amount ofsoftware. So, if youhaves new computer with nothing on it, consider Micnlsoft Works Suite 2000. 0

•

• •

•

• •

AMD KT NOMkx

AMD KT SOOMkx

AMD K7 $5OMOS AMD KT 7OOMkx Ixiei Pemiiem Ioiei Peiloiioi Ixiei Peoiiom toiel Peoiixm lxiei Peoiiom

m sso Iti Soo OI $30 ID 7$0 OI $33m

Ixmi Pexrixm UI scow Ixiel Pesiiiiio

OI 733B

• wim PC 133 SDIMM RAM

Pi(Seeso 'sct io eI

SystemConggurslmn:

IMClsm Systems:

Celeron 4N System: 810N

I - Ieiel Cekee GMMHzPiecsxse -ASUSMESWMN70 M'eoAlX M$6erixxN Amo Rei xmfsse -(XHkera AGPWrieoexri (6MB) mltl RNIexl SSN -84MBSDRAM - Amm psemM MkieATX eemeeeek - Fxyixu1$GBUDINAN Hsnl Dike So&I pci ex soemi -144MBFlspfy Orlvs I see ummmMoo . Ceixmpoo - TIX TP SVGAMsxzsr, 254FI -oesememe AepIlieee eexi - wx6$kxissem -IP SVSAMemm. Zeee - IeemeeImmi Meem PSIX - LSSiieehWheel MemeP$2 . Mew mlrlmml - IP ATXTowerCsee - 1$'ATXTeememe -Creslhe62xIDE CDROM - oeemeexelos coxoM oem Sleeei PCIAeee - Semri MsxmrEsxmiq PCIseeri eeri ImemmSeeekem - sxkvsx keexmiI@I ImeepexMeeem - IN WMMSfsskem -5N VN PCI Urim fax Modem •

•

Woleee Syeiemei

•

• • •e

I•I

I HI I I

•

$17$8 SISXS 3 I 9 I8

szzzs 31$4$ SZIIS 33319 33$58 SI93$e $3168e $3768e

P sngifiti B(.G4(8$0 Sy$(sm:

32 N L

0<lsmi -ASUS X7M ATX Moihkmuri -wr cmsmie PCIAudio

- Intel Pedum III 533MIGProcesw, 133NK FSS

P<lsss:

- IA(MB FDD

- ASUSP3C25N B20MofiwrixxN - 128MBSDRAMPC133

-ASUS P30 20N IAIOM2$Msiokoxm, 133MIM FSS . wr cnexmiePCI Audio - NMS PCIOORAM - Penes«xc T.SSMS7DD . Msxior 13 GSUDMAN HDD. 2MS 73eefm - ASUSV38$susrs nVISIORive Tkr(3 Uiire 32MS - 11 Moxxcr, 2$eoi, 13Nx1024 - 1$' AlX Cme wzh33OW.PS

- $& IDE CDROMDeco - Sexed msstxr PCI 12Semnri cani - TOO Wxtix Sfeskem -Ssk Vso Iniemsi Vcuefax Mceem - Ma ~ DEM out notice. Pleasecall for the merest 'ces. il jj . il (I u •

- Mmlor20GBUDMANHenl (kim, 25B 72Nrcm -AMIS V66NDelum32MBGeFome258VMN ceri -Samsun016'Mentor,.266ol,1800xf280 - 15'ATX easewith 250W.PS

- lagiischInlmmt Kefbcsid

- Leg'techWheel Mwxs. P$2

- Cne6ve52xCDROMDriw - Plezor8432AIntensl EIDECD.VMter -OoomrriPCIAxdb - GHTSoxnri system - USRSpelxlsr 56k Winmorism

- MSWeriowsN (OEM)

batteries

•Can ada's¹1 SourceFor RechargsablsBatteryPacks. •NoteIIohs Campers CellPhnaes Cn rlessFuseTools. 2120-13700 MOyfield PlaCe, RiChmOnd, BC V6V 2E4 TOII Free: 1-888-882-9977 Or 604-207-0567 em w ~

cutm .cern THECDMPUTERPAFER SCEDITIDN APRILZCCC 111

Big Computer Swap Meet Saturday April 1st, 2000

I Ie bttytkreeyclr Monitors

Croatian Cultural Centre

15'..............70.N ;A... TSS.N .

Personal finance software a no brainer

(4; GA.........$49.00 4 @

14" ............$04.00

11:00 am- 4:00 pm

4 HA ND S D N >

VGA ......00.00

17" SVGA ......100.00

.,190.N

(ccmsrof Cammsmid a E. 16thAve.) Othrtnih uhhh

2718 West 4th Avenue Vsneoinwr. S.C. V8R 1R1 Tnii laoel 73340iot Fnxi (8041 7388322 Tall free: tmeamit8.8484

Itbh hbb

3- 12381 Bridgeport Richmond, S.C. V8V 1 Tek (804I 270-2877 Fnxi (804) 27(n2830 ' Toll free: 0-888-808-8484

No Fln Is)co~erg(( •

Fio Q+ ubjxvnby'810Jto ' stthiwenhfnnns$luhbory

tobe given away at2:00pmjjj !sits o f gun!i ty dealers!

Getnff your nmb4 usedmo ni tors, pri nrers hunfwsn., scfnvsre,parts,games.books,

tmi

aud loads more! All at gtvet prices!

ABMISSIONI

50-8L

Adu((8$3.00

1)bbl00

KM0tlngor (3 Fno Fondly gotti SKN

(I mombowl

**WDon'I MissOutl OneDsy Only l*** Telephone: (504)32I.S304 E-moik funpmnwgbhcnm.tmm

SMISK SOQAAhdumDSI hfolmtb SRQSOMSDNlho phofumuo IkmSNNeb VIRSXKutefiettt 8•

,' •

, jj

N NFEEENCE SPEANEIIPNQNE...,.„.-.„.QTN

Srdgn 51NCV D Totiee 4300XDVO TotmeilONDVD Totubo4INXOVD Totem Mlmlm lbrlmo35MXO10 Totme35NCDT Totbl e3IOCCDS TotldeXMOCDS

l orr TM55 0T

D!55K FISMQTieo!

FIIIINUDVM IKK

FKI INMNDI NK N OOISDVOA XM N S340DVD!NK

NOXVUQIWMK AMOIGMIOIWMK MNQNUICIWMK N IMAVTIWSIK Fin INUI34XISIKmbtl

WeSpecialize in PCUpgrades8 Repairs, Installation of Software,CD-Roms, 4ttModems... Intels Celeron™ Processor-Based System

Intels Pentium® II/III

Processor-Based System

USS PCICard (2 gott)............... $34 USSManual Switch (4 poA).......,...838 USS toModem Adapter...................$41 USS to P$2 Adapter (2 port)..........$38 USS to MAC(Mac+ P$2 port).......$30 USS to Geo!serlaf(MDsfspln)porL$127

Panlsonic1.44Floppy

USStoEthernet 10asseTAdspm.r...$57

USS to RS232 Converter (2 In 1).....$41 USS Expender (2 porlL.............. $41

PC toTVConwttar(tg'24x788) . $195 VideoSpauet(2!45!Spot().......84SWNS KVMSwitch(V45lt sport).....$13( 4(310 Video8wlteh (2 to1).. . — $50 Video asunder(tfism) .. . $185 CPUSwitch(1 to2!440!(s).....fmm$118 CPUSharing Device(SIDconsols to 1) ... $141!8254

ConsoleExtender(Ssm) ... . . .A107 Consoh Converhr(MacS Sun).....$110 SI-TnmlesAuloSRNches.......from833 PNOSelAulo SwjtcheL.........from$10 ]ed~I A(do wfch 2I4 to1)~..$2 3$

PCEthernet Tmnscejver................$47 MaaEthernet Tmnstmlver...........ssg PCModemSkater(4 port)............$70 Termlnafdfost ModemSharer Cablesa PC4(ubTesters.......from$30 I• I I

•

' •

I I b • .

•

' •

retirement, maybea boat. It msy even tum your

USSHub(48iypott) .......... $54$84$70 USSSay(3USSogpartotssr. Potm)..$133 USBtoIEEE-1284PrfnterCable, .845

'5'

would have to be just a wee bit on the masochisuc side to track your money on paper. What me the bensfas of financial softwme'? If nothing else, it will slat ycuNnking about your cunent situstkm, your net worlh." k wKI also stat you thinking about Sfs evenls. You knovr. weddings, university, e csr, s house. chiklmn.

thoughts to uw cost of cmdit. You know that cmdit costs. but you may not realize how much. ' ' I I I I I , I A fmv hours spent using personal finsncialsoft64 MW12GD T FT 141' XGA $$300 $1$$G Mzolmo ware willshow you how those small credit card NM WINS I F(14.1' i(QA TM SMN $1$flm NMOM.NO IFf 141' XOA N 013gioo and ovmdreft charges reasy sdd up. NMPO',IQS TFT ti,t' XQl 0117!mo However ,themein masontopumhase aproNMSIO,NS IFf 13.1" VOA N 01Mloo gram Ske Gulcken or Money ls to get• picture NMOQNS TFT14,1' XOA St Iamb ol your expenditures. I haw noticed th«a am NMWSAOO TFT13.'I' VOA N $01!oe 33MW ANS DS12,1' VQA 15N MOAN two Vmost everyone ls confident of: that 33MW I.GOO DS 13.1' VOA 13N S!mo theythings sm a good judge of character, and that NMWI.NS TIT 13.1' VOI L GIMINOGS TFT13.1' VGA 3NO 0113!Mo they know where their moneygoes, PT, Samum pmved the fi mtassumption was fi swed years ago; and the look ot pure bewSdennent exhibited by many people when uwy look at their monthly bank statement diomovss the second.

Intel' Gelsron™CPUw/128K Int L2 Cache tjI Intel Pantjum j/jjj CPUwi512(0256((Cache

L lg

ICT his is a no-brain-

er. It you haves computer sndsre not rich, you

him boo.hhnen onhnomum. Im ibibl &lnll onimulnb IhnihiIbnebo tbbohnn.bthbhmrbhviuhnbnb snshn nm pggygVOTtt 2$$0

AhriTIN IGT

CAE ADAAQSSTIsSeSmekdawefodalbSsuj b

inbni

ls a simple dscis~

IbetnIOtntnbhnoibln.nmohn ohhehb,ihhhh hbhhhbhhbhnmhi

LotsoffreeFurk!ng! Turnyoursparecomputerberneintocash!

40.00

S sorts of people 1st their money take cme of itself. TheATMIsle umm Imow when umy me out of cash; utgem phone csfis 1st them Imow when they me getung s little behind. For those petxxe, I ssy, move on, Ns artlde won't inteiem you. For the mot of us. personal finandsl software

3250Commcrciaj Drive, Vancouver

•

Acsr MX3LIntel440U(AGPSot M.S. 32M PC-100SDRAMMamory 6AGSATA& Hard Drive

ASVSP2-99 Intel 44(E(AGP Sot MS

64M(PC-100) SDRAMMemory . 6.4GSATAA)6 Hard Drivs

4 PanaGo nic 1.44Floppy

SM AGPVideo Card 8~ ATI j(part 98 EMAGPVldso Card 17" ATXTower Casewl 250WPower Supply Sm 1T'ATXTowerCasew/250WPower Supply 104 Keytkfin '98 Keyboard 104 KeyVwn'08 Keyboard Logitech 2Button jiilousa &Pad Logi tsch2 SuttonMousea Pad

ill

AopanSEKPCIjnt.Voi ceModem Aopsn40XCDRom ESSPGISoundCord OnBoard 120WSpeaker

Cslsfsa 438/46(ij5()O $699IFI9/739 AID/CNIX S)js(SS) PISSSS Call, Syskxul Yoarpmtbg02YoototubcurWstmnty

wc CarryNew crQsmma2 ~p mt s a ~ Wc doTRADE.IN$ too

ls Fntmomcdfoottodettp viSloutxxxn blkoaimi soMSimndssfntmk of IntelCmyondan.

For personal finance software users, that first

step is entering account trsnsscaons into tie ptogrsin snd categorizing them. This io an essential step. It is where financia software

Aopan 56K PCI jnt VoiceModem Aopan40XCDRom CreativeEnsonjqPCISoundCard

begins to offer teal analysis; and it is where finsncial software hso traditionally failed the averageconsumer.Whyv Because dataentryis

120WSpeaker

tedious. Fbtunateb. we finafi y have the abiTay to download stmount transacfions into progrmns

pl)4NINI ibIII450NNE $1N9I)230 •

•

like Oueken and Money. torah this develop-

•

PanasonicETQ I 17 Monitor ..... . . . .$320 Acer 56KInt liliodem w!voice (VQQ)....$48 18' ATXtower Casew!230Wpower supply .. $4S SoundSlastsr EnsoniQPCI SoundCard ...$3$ ADPEN40xCD-Rom ....... . . . . . . . . ..$50 HardDrive,Memory ...... . . . . . . . . . ..CO!I

BECKMANCOMPUTER

)N I S IIIDQSFOIIT mw

170-10400 Bridgeport Rd, Rjchmgud, BC, V6X 3R2 (Eutrauce 2$ Icckmau Place) fbomi ISTuu Tub 30310$3Opar Mmyri I 1-1 Shi 116(0004 Sunk Holidbrb)

112 AFRhzccc nu xsnltixn FAFSnDcOortxxv

Follow the money The moment you begin to watch your expenditures, you begin to change. The minute that you seeyour various bank chmges fmm your verious banks totaled and subtracted from your aller-tax income, reality kicks in snd the spending brakes get s tentative press. In criminal police work, govsmmenlal audits, and personal Snsnces you only have to follow themoney to fi nd the answers.

E A!fg in M

ffg flg

ment, um final piece of the puzde is in place. You can now go online snd within e minute have

your monNy account statement imported into your Onanciel software program. That is. once you' ve done the iniTial setup, which might be

simple. difficult, or Imposm'bmwithout changing financial insgkaions. At the time of wrmng, mmeumn21 financia I sukNians allowed users to downkmd account dale fm their personal tinsnce softwme. Only about halfa dozen support Money, wtile most support Quicken. However, this mlstively new

festwe of pwsonal Snancial management is taking olf and Is being offemd by more and mom insbtutions sfi the time. Without it, your financial software is very useful. With it. your

software is a godsend. -Rod Lamimnd

•

ll0.

•

Psodueh 3.s" Floppy Disbeise, cDR, zip, Jess Das Tape ds more 3.S" Diabsue Case. CD Jewel Case, Eavelopc, CD Paofile, Rase Tower cD & Diabeue Label (Laser/inbjer/ofibeo CDR * 3N " Dlstretm Dupueadlou Quauty Brand: SONY, TDK, VERBATIM. KODAK, MEMOREX, FUJI, DYSAN, RITEK mc. loess data scan R verificslicn Soo copies of CDR pcr dsy CD/SBwINshcue Servtcm custom tsbel dcsiga, mulu-color screen prinung, turbey psdrsgiog CD Rom Repucauon Services Iow cast, low minimum rcaubumcas •

•

IlllllllllllllllllllllllllllllllllllllllllIIIIIIUI ILIRCODE SONT,OCE, Vela DLL far Owns,VIL Aasass,oysnl Rtgmr, oc++. Mpbh 4 'cbatsnm Onria Repel edsew. Fwo1hal Doenloadfiam Wcb ID CatmsdhriassaCcdtmcaeae/Iysda, IacAurcsnANasAN.Isucc12a. SAN12a,ua Sotmcc fnl telnun

dataloss.Ie tmilely.

Tes asia is impstant to us. —' So ore pm. 1.800.551.3917

0) 905.479.9938 (0 905.479.1515 105 590 Aidan Road

Msrnham,Grdsrio

L3R BN2

Canada

I '

•

'me dIl:rash.

•

' •

~ VlfllS."'

'' • 1

•

Cai Dnla aacwsty Tachnolagiaa,inc

•

The tasl-and-laand.iot Is and as

("%R & DISK Duplication • drdndasgr ash. • fspf sla Iun Teanfm

•

• lb diyanbs snneanba plass

ah rum lr. Dncums •, Mstscaca oncne.

• foiSassaf.Ne EN Cbada

RARCODE SCANNERS lnrcnncaSaba ~ bu I N OScrics Massaadcs~ HD

' PAPER

• la/amish

SyndwlLTSNI/LSIgag/ls2ISSLgune Scrics UmrcchMS2NIMSSNMSdge Smica

LASEL PRSITEREPos sggfashsoPTwARE SsobnganoN ORNIJSTED POS HARDWARE

4irllisV 4; ~

Caaam'I Canratat Ia/a rattan raartt

tobesacmmomu pssisN'8V > snm

Cw Ser( nntufapsassnmdfssapshmr bwllssmaspdsanm

ROORBSgkagat)splkugo

RATES FOR AN AD THIS SIZE AREI

3 iSSueS.....'155" (per mone lor 3 monam)

BiSSueS....8144 (permonthbN6mones) 12 iSSueS.....'1 28 m(per mone tor 12 montts)

Cali 688 2120 for (ietatls

amasmmucea

gg I(lgig fderfrdtN a:~m~ ant md warn

Proser %~salle>w

R build o

Sygwe000N

• Corporate Training Programs • Network Design)Planning • Uni)dggndowsSupport •WebDesignandE4 enfnarceSolugons •SogwaleDesign,gnd processconsulfing •InternetTechnologyConsulbng

• o'

•

'a o

u r B t ter P cks

• Rebuild battery packs for notebook computer and other rechargeable battery systems. • Upgrade battery pack with

higher current (mA) capacity cells.

• Battery supp)ter for UPS Systems.

I I

Cana d a 's Clea r a n ce source of:

. Used&RefurbishedLaotops for rl cln o nd avullabli l

u,,xsns

• I I

eas e cuff er vrsil wefsslse Itm , „ . •

•

gpeciafdfingin computer

MONITOR I

e All models

Repairs from 14n-21n

e Free estimates e Free pick-up and delivery •

4p Three month warranty

•

e Monitor loan available ' VHC Cassette indmririal Ltd. rsh lass)221 Ino sectdIs) ssldus1 „.t 15Sshnsbwy sacwaascataotaugh, Onswso, Mlu sas ' fttun ~

dom h u p u ~

naolt l l ~

IBM MACINTOSHNECADI SONY HP DELL MITSUBISHI ACER EDSVIEWSON)C MAG SAMSUNG DARIUS...

NICd, MiMH. Sealed Lead Acid Battery

(UFS). Charger and Battery Systems.

D W Technologies Ltd. S I32-2323 Boundary Rd.. Vancouver. BC VSM 4vg Tel:(604) 205.6928 Fax: (604) 2050918 B-Mail: dwllebc.sympssico.ca

All Models — All Sizes 14" .........................$45.00 15" .........................$55.00 17" .........................$85.00 19" - 21" ...,.............$195.00

freepickop)smlM eery Vbtoemonlhworrotrtp 100ys 0 week dig9 8620 Heather Ss Vancouver. British Columbia

Profe ssionalQaali(I 1stRefils .HEPTMw~sws alascant phatspapua8 lahsbt swan m nnausnpsu O)4 N cn anvmam

SL0)(Slick'29."

RAM! Whsawt

aaalsassImllsasnsanr mmlnaINmedlnhlmed,

200 CQ RomLabels '

AERO Monitors t 16-2323 Boundary Rd. Vancouver

298-4455

I I

nosy

reads are Edmonton or England, out pricmg, muilablliry and dslhery will aacamlyaw needs;ea Sbnw wary sinn. Visa wscwkmmco.com lm coasbiandy updarmlaAM pri dng and mtsilabnay

c-mail: aero@imsg.nci

WWW.CANAOIANLASELS.NET MECCMPI/TERPAPER ECOOmCN wnw . ~

hmco m APRIL2000113

D on't m i s s

• hj Mac Consultant

a nothe r i s s u e n

Mac'055 Multimedia/DatabaseDeveloper

PAPER

P h i l K l l 0 9lllll F

By NickMajor'sDATA RECOVERY LABS

Ceesdrr Cehpatsr larerhauae Samrs

Whydoso manycorporations, servicetechnicians,wh smallbusiness&computer professional insist onusngNick Majorsandhis teamol expertsior all of their emergencyrecovery needs tSIMPLE-WeareiustBETTERatwhatwedothananyone

604/618.PHIL (618.7445) ihfacihome.cor n

htt p://kushnir.dhs.org/

Call now to atart your autsnoription today!

IL else in Iheworld!

Nick Majorss)ATARECOVERY LABS

(TORONTO,CANADA/BUFFALO,NEW YORK)

(6041 0434461 15 Mb Web site

NetworkServers,.AdvancedOperating Systemproblems, Multi-driveRAID/ARRAYconfigurations,: OpticalJukoboxasandTape/DATrecovedies

Point arClick templstes snd graphics Step by Step on4ine training FREE business opportunity Try our web design demo

Only 3110 USIYenr lao-Esttrno

•

- e

• •

I I

0 010

Crash.

lr 4 ord II loarl cuhrhusncrunm

CunenrmanhmonEC 4 ISA Shhl ~

I CIm n l r l awrwle idaho arpmrl Srrm Superi

13-12840 Bathgate Way, Richmond, B.C. Ph 604.218.5356 Fax 604.278.3486 out of town call 888.454.1544

SPECIALISTS:PROPRIETARYMODULES FOR PRINTERS 0NOTEBOOKS FROM A TO Z.

EVERSOIRCKTE(HHOLOGYINC. 4 rneeef ur e/du Taildie Steep-/rxeddin If' Tehmn

•

ISDN, Analog,ADSL salessssohoskyway.net www.soboskyway.net

order your ADSL noto

(QI N~

•

' •

•

I I

095

ascl>R inaertcards SPECIAL 8

www.wesrernrape.corn 0I

sr. srsmassh

suhs 100ull wm amis shel vlnremsr, ScvaEIpo Earmv avoeuelshwml.loh

•

AemCAD Otremtor CertiTicate. AumCAD 2D. 3D AutoCAD I.T, AutoLISP. 3D Studio, Mictostadon

Avovscaavuhh welaomlnohsnsh5MO

• '

•

«msawhmeahsrm «mr-Iamoehrvhhwassadhmcec wales m a p

•

AutoCAD

www.ChlsIIsleme cem

snpulhhasmhhhh Icmuwntl

Smart Chcticel Savlngsil

lw hdelhrhl Ihlhhlhl

Mutuel luna4 areuposp 5lhhls

Fsn:(aea) traduce chin sechle lem.cern

e-mmtl cadd®so'Lab.ca bupdlwww.saitab.calcadd

FullService Internet Service Providersince l996

• •

ACBr Department. SAlT t30t - te Avenue Nw

E-moihsource@eversource.com www.eversoum e.corn

•

Power-up your LAN

QoII

felt (604) $02-7688 fax: (d04) S02-1686 Toll free: I-888-303-WWW (9988)

Piett-op/Drop Off (604)786-6611 •

482.1222

We are ln Surrey, wholesaline Computer parts. Dealers Onlyl Weleomel

We Roeyeto Computers, Eteetronio Office Eapaipment ....More 6 Great Service

SOHO Skyway

IOUKE

VOU GET CA<Ha

,INTEL,AIIID, CYRIX,

RAMBUSRIIIIINI MODULES'

I • CD-R Media CD-R OM Replication', ' ,•CD-R Duplication • DVD Replication I • Mastering • Pac kaging I • Printing • Diskette Duplication I

6 Years of Excellence Best Wholsssleprices for memory a CPU's MEMORY:, 30 PIN, 72 PINSIMMS,DIIIIIMS, SDRAMS,

WMI Shier haa Mhhl Ie hlhmmm Sn We 4where hmsehw

of 100 Njitsui CD-R's

Fsx: (004)273.1040 Email: basimm gbcsyapafco.ca

CPU;

'I whar ~ 4 alm hhmh ' un sleueu Cwhhl SalaamsSmmream • Mlucamnhm Snead SeeeAelhhesn

I CD-RPenwith purchase

l l l l l 8 lTeh (0 04)2734nf

(0"

MITSUI '

c.nu

s l l as

Specializing inHIGH-END/ TOPPRIORITYJOBS- inrJudfng

htt :l l w w w .s N nar . cpm/its ex

Themosttechnically successful faulffy =. available - anywh ere- atanyprice!

It I

%fob~

Become your own MWebmnster

~ Clll SIlstemOiseibinlenlnl.

114 APAILaooo 75IE csuwurun rvvuan ec aomov vramcsnacsccmcrashccm

15012830Clarke Place, Richmond,BC, VSV2H5

medhas cshnlah mhfaaeesahmam Imhhs • Scl Sawer slndeel MI V elar Seel 4 haul fnsPre

AM I I I

Subscribe to

ComutevPAPER and receive

Wearabte PCsto power up with water FAIRFAx. virg.~ new inmative from Fairfax-based xybemaut corp. (http:ltnww.aybernnuccum)and DCH Techrelogy Inc.may seethewearablecomputersproduced by Xybemsut being parkafiy powered in the futum by water. Xybernaut and Valencia, Calif.-based DCH said they would jointly develop a wearable PC that would run on hydrogen-fuel cells. Recharging those cells would simply require filling them with water, according to Xybemaut director of owporate communications, Rabin Bore. Cunently, a single lithium-ian battery csn power Xybemaut's wearable computer for

three to six bourn, depending on the spplicatians used, Bono said. A second battmy can be swapped i~

hau t shaking down-for a total of about eight hours of power,

she said. However, the new tuel cells may run from t2 to 24 hours, Bono said, and recharging them will be as easy as opening a water spigot. Bono said the announcement signifies just the first step in ue development pmcess. Xybemaut's Mobile Assistant IMA) IV contains a fully functianal Intel Pentium MMX pmcenaor, and either a fufi-colour natrisanel display or a Xyberi/iew head-mounted display that can be equipped with an opuonal video camera. Other necessaries and software are also available. The MA IV can run Windows 98, NT 4.0 and Red Hat/Unux. Pricing for the MA IV with a flat-panel display starts at US84,995, while head-mounted display systems start at US85,489. The systems are available direct from Xybernaut. -Newsybtes

THEINTERNET DIRECT STARTERKIT 8 TIICOWSTOP 100 INTERNETPROGRAMS

Monica eaerlliiae uaiavala nsativaio t«o l««»l

So EasyIt's Child's play! Internet Direct makesit easy lor you to get on the InternedWith over I IS,000members, Internet Direct is one of Canada's fmtest growingInternet communities. just put this disc into your CDHOH dmre and get 30 days of unlimited Internet accessswith S emails addremes and a free personal webpage. Ho commitments and no credit card requirements!Yisit our website at www.idirec(corn i

oetkPdkd;C7

TheWorld's Humber I Internet Software

SiteGet l00 ol dsebest Internet software fromTIICDWS- oae ol the ThsfiTm leymet Direct Internet's most popular web Sf ftjlttCI' KIII sites! from browses to chat a~ c ell »»l lo»««» progrann, email dienB to gdfiglfiydigfig HTHL tools, this CDHDH has what you need to f make the most of the Internet. for more of the «»»o nov» bestInternetsoftware,go «A V . s o .' ' ' . gg to www.tucows.corn Toga 000 astoaooesoon»oooo

Microsoft protects children's privacy Mimasoft has launched Micrasoft Kids Passport, a new smvtce designed to help panmts protect their children's online privacy. By using Kids Passpan, parents will be able to decide on a site-by-site basis whether they want to allow their child to use participating Wsb sites' services that collect and/or disdose personal information hom childen. Passpoits are unique to the individual childnm, allowing parents to make consent decisions apponpriate for each child. Participating sites either secure psnmtal consent or testrim Kids Passport members fram using senrices such as newsletters, chat rooms, and pen pal programs in which childen might provkle personal data. The senrice is aulomaticafiy available to Web sites uet sign up to use the Micmsoft

$ I

Pawpart single sign-in service. Other sites interested in the Passport service can get morsinformanon athfi o:ltwww.oasnpmt.cum/business.

'ihis siofk Cn toll toataiashath aa I0 dart of treeaaloaitad laeiaat areas ael aa rlKOW!Iop 100 lou»oat elean piofiaes, aad is oalr asriiahta Oroath this Com potes Paper whscriptioo oNer.

So far this ssnrice is cunently only available in the U.S.. but Microsoft Canada says it will be monitoring the success of this initiative and will evaluate it for use In Canada. -Keith Sckeng//l Robens

collso»as»toto) ae we

'ZJi,~~"i' IParody 8 hit.. make that millions of hits The developers st Vancouver-based ClickHouse.corn Online have s hit on their

hands wtusMo-Monopoly Otua:I/toom.ms-mnnnn aly.curn/monuanly.ohna), s satire Wub sits created in the wake of the recent ruling by U.S. courts that Micneok is s monopoly. The site looks tike a Monopoly game board, and visitors can get with details of evidence brought against Microsoft by clicking on the squares that rim the board. In case viewers don't shee their sense of humour, ue designers have cmated an anline form complete with pull-down menus so regislanng an intent to

Pleasesendmen subscripfien te The (ompucet PaperendTheInternet fired Starer fiit 0 Tucen Top IOO

t IC«.

-wl

Ol t

(Oil%up

t 8

Pfioufi(E

POITI( (OOE

)EEE MOfiE

sus tsquies just a few mouse minks. clickHouse.corn Otilp:ttwww.cfidthnuen.curn)says that in ue week fofiowing ue site's launch in November, it hsd mme uen 6,962,255 hits-28.802 of wheh came fern Microsoft IP addresses. On ue busiest day-when the URL was posted at SashDahatg-k regislwed a,f 55.898 hits.

ClickHouse.corn operates an online ad network uet focuses cmptamaung small-

Q Ply fEiOT ENROHO IOIEQOE Ofifi gfi ET OIOEO PlVdfi (E TO THE (OIIPOTEO PdPEO) Q THI Q llanos(ard EEP .O d)E

(dllg ¹ Eeaik sahscriprions@tcp.ca

to medium-sized Web and sewing adverrisers who want to deliver their message to a mote targeted audience. Not surprising in light of its sabre site, ClickHouse.corn says it is also active in the open source software and Linux communily.

Iehscriptient are transferable,hut non-refundable. 0 d

rat /tuscan

»I ' I

I i

» »

»»

I I

III

wsowcanariatxsausutes.curn TstficoHPUIMptasaek BGEDlrttxe Asskk2000 195

~ id ee! 05 Choice!! Sa vials!!! ~

Exalts unveils Cansdkm porlal TORONTO-Canada's amlsrival communicagon compames now each have a U.S. heavyweight in thek comer to boost Owir Web-portal egmts. Recently, Rages Media Inc., a division of Rogem Cornmu ications Inc., helped unveil Excite Canada (kyp:iiivrm.salts.cs), a joint venture with Redwood City, Calif.-based Excite©Home. A monS eaSer, Bell Canada had anrmunced Omt it wss teaming wi51Lycee Inc. to cm-

+ON I I I I

als 8 separate company that woukl manage its porlsl bumnmm. Bell Canada, owned

largely by BCE Inc. Of Morrksal, owns s majorily stake in Omtvenhss, which is called Sympayco-LycosInrecognIEOOofthe Lycos brand and fkyrsISP business,Sympa5co. Rogem Com m~ , wh ose own cable TV-based Lqp business gct the jump on high-speed Internet access in parts of Canada while Sympatico wss 859offering only dkd-up senrice, now pipes the ExiteeHome cable Internet offering through its lines under a RogwsBHome label. LikeExcite.cornintheU.S.,Evoke.cafeahusschanneh suchssautomogve.mueers, computws,heakh andnml estate,which help organbe ItsporudcontenL gxcke.cacontent partnem inckrde Rogws ~ (afa desnk, Chstehine and Cenacfan Business), EnancesiteQracksnma,and newswim swvlces such asthe CanadianPmss andths Associated Pmss.

Only Pay 30 % Anat Oat l OOYe OualI y O n Ink/et CarlHelges

Explorer for hsndhelds psmdewed HANovER. Germany-lvrxxosok pmviswsd its new Internet Erqrkmwfor the pocket pc at the CeBITshow In Germany in early March. The companysays theWeb bnxssersaltware, intended for uss with the Pocket PC hsndheld devices demorwlrated in January, alhws uses to access any Wsb site sny Eme, anywhe~ h ether they am connected to the Internet or viewhg content ofgine." Pocket PCSsrs expected to ship in Omfimt halt of this year fmm such hardware manufaclumrs ss Cash, Compaq, Hswkm-Packed, Ssmsns, and Symbol. PocketInternet Expkvrw epmtedlyincludessuch eaaraf-use t hnologim as:a Shrink-to-Rt capability, WMch "dynamlcagy rsskas a Wsb siteto mmdmbs vieviing on personal digital assistants (PDAs); a Smert Addmss Bar, which lets uses type in a Web addressb y ~ Wsb site krca5ons; and Automtsts. which 'automagcagy detsrmhes if the device is ccnnsctN to the Internet snd, il nct, ~ dive rts Om browser toa cached verskm ofOm W sbpage.* Pocket Inhmmt Expkww also supports XML (exhmded markup language). Said Roger Weed, dimctor of nwkegng for OmmoNe devices division st MlcrosofL 'Internet access on the Pocket PC will pnwide cuslomm with the key CEonafly they have come lo expect browsing the Wsb on a standard PC. induding phctostus5ty screensOurtdkrplaygmrtchknages and grsphkxrOm way Om Web drxdgnerbreaded. -Iyewsbyfes

visit our site www.inkjetmart.corn

OVER, Gsrmay-Alongside the several new moNs phones unvmTsdat COBIT in Mmch, sson Btkry/Nww.sccsscs.ss) showedCEfour lww cellular, glxmcs ~l

Paying too much for inkjet cartridges )I www.inkjetmart.corn guarantees high quality products with up to 70% savings on all your inkjet cartridge needs. Our friendly and helpful staff from our Retail Sales, Mobile Sales or Internet Sales Service guarantees

y, sincetimy enable wlrelsss corn l l l cHboM llmchins to mschlllS.

Ths Swrxysh ccmmunes5ow vendor says Omsemodrgss cari be built into a wide Variety equipmsnt;incuding domssEC ingenues. industrks'mschkrmy,metedriy stpfpment and . 1hus utonuxhn a lot of func5orw.. , The GM22 m adusI-txmd (900 MHS/I;900 MHS)GSM inoduie handiiny vo(cs, SMS (short esmgkrg system), snd,fax, The GM25 isOLso8 due&end GSMmodukr, brd handkrs vmce < data ln addnon to SMS and fsx.' . Ths DM1 0, ~ , is 8 duaphand AMPS and TDMA (Emed'wision mulEple access) ;: r 550 MHz modvfe, hsruang voice,SMS,tax; snd Orle. ROSEy,the DM20 for AMPS.950 MHi . TDMA 550MHz/1, 900 MHx models,handlesvoice,SMS, fax,and dahi ' Jan ~ vice p ssirkmt of Edcsscm Mobile Comm~ swd h e forsserm le commtxfcsgorm dsvlcss tewming very popubr.vr tbs rrjoNS ccmmskrdrvstry, fhe::,

100% customer satisfaction and convenience. Want to find out more?

Simply visit us at www.inkjetmart.corn

' intsiaNm of 8 wirelss's mcd Vs info 8 wkle range N manufactured products is.

or call us at (604)232-0563

TOLL FREE I-888-2833-INK Address: 4)55 jrjajn Sjreej, Vangouuar, S.C. V5V 3AQ,Canada. 11S APRL 2000 1HE 0055INER RIPERfc EDNI0N wwmcmscsxwsxasscrm

us|aces Owt support ncn-vruce spplbauons Known as commuruci5cns mcdukrs, the GM25, QM22, DM10 snd DM20, as they.ms , funcEcn Eke e,moNO phone, but w'shout the ~ „ssr pkrci kjrrpad, or dis'-'.

ready bsgkuung and wlf soon be tahe for granted,'much as the iritsgraEon of the p istoday,"hesaki."webesmm thatths market wfi expand most rapksyin anxm sathe autcmoOvsindustry, gest msnayerrwruNehickr poskkxuny, snd u55588," he '

•

'95

' Alusnbrtng 98kl the mcdukrs we klunldsd for Usskt both nuxsto-macNns smt mscNSS- '4c jw beati'cm whws thee fs8 need to send wxl rscehm data or%MS, is welf as ' • ln tskrphony spplica5cns. '

wshytes

Adrwa csmpulemLid.

•M9 52

ACP Marlm5ng

Addwc marner Cre

Advsriice InTCP

..11 •

Aors Monhom

..113

..117

Ahwd Insnulo olTochnolow Silat Tochhalagios file Affltw: cofripfflof Tschfuaow

..113 ..10

Awal Tschnolopy ASUSTek Aygt ATIC Computer ATOPCompuler . Auclkmml.com Azflfo SeomnenCompuler

.. . 74

..121 ...13

•

High-Speed OC-3 (155INB x 2) backbone

Qp+ p (m y

EXCHANGECORP

50k diaiupunlimited $15.5gfm

'M'.pa ..01

•

.. 21 .5 ..112 .. .41

$0hoorooccloforti0,00/m

CanadaAssai fmhadfllf4dof.COIII csnaeancompact slow ....

..112

"' Fainil Safe InternetAccess

CCWGAmcrlphrm cE compulofoff5ol

..110

Gamu t Celrlpflloro

CADViclon velopmenl Cap

..107 ..51 ..Ilg .. I13

CflnodionLabels CSL Dale AecoveryTechndoew

NOBUSYSIGNII

Block Porno All ra hicsites XIII 2 79 8867 No extrachar 0

..M ..101

Clmplsfc CHL SystemDislributkm Ltd

..114

CCIIIPfflor SwoPMeal Cafllo Cahada

.. . .I12 ....Ilh

Woshl PC Sowlces Crvclal ComputerLld CSEM

.Iw

1 38-2981simpsonRoad, Richmond, sc, canada,vsx 2R2 WWW.aebC.COm. infO I aebC.COm

.. . .114

• •

CSPComoulor CuhingEdge Computers

.. . .103 .. . .110 ... .\IS

Cybeflec lrfduclries Inc

Date Reawerycalm

•

Network Design a Implementation

.. . . I l •

Daylek

..84,75 .. . .'.2

OehCanada

Network Cabling mm SQ Internet Connectivity Emergency OnwSite Service

OI4fimrfd MUNlrnario

DiewmnlComputerClub Doaalfocl DraamWebInleracliw DW Teehnslogiec EMPAC ESS ....

:::.:ei

.. . . .Sy .. . .113

.... .5

....toe

Efrlacmn

Ewraource EIIIMIIC 74Clihefonf Ific Falmst Comm unications

.. . . 11 •

•

SOV ASttb ESQMEtlllrf

ftstifsu

gccmlryCageSAG Cuwm MadeSizes HowboekDefwml SuhOsgNewsizy Cebh hu ehSewct. Timcf ce!e. Mefiflee

Wewill be here lo seNB yoo.Weareone thelonsss! advs'sere inThe ComputerPaper, since July 1 990

nmhyeooae

ny cofllpiri4m

Pacer VaheySystems Fnmaercamputer GD Systems generi Cempuiem

.. . .113 ..24.2S .. . .103

GCIOEcofn.colo

HagPricoCom puter SeAs HowlerPadmrd

Homelwe Inlonml PubblhlngLid..... Hoirclofi

Hwon Canadia n Enlomrice Lid

Ioi Conmurer IDImcl Hesllfip.corri InlomelchInternal

fnlonneaonGateway InlonnaaenHighway InfocerveTechnsfow InlohiganlBaaerlosIne. InlemmDirect ihlorwl Gaowoy InlerieehCempuhrm iPC IT SystemsInc JNLCompmer JfiS CampulorsIne UCI •

LeplopClosuoutcom Lso DaaorComputer

LynxInternal

MocSladon MemoryHosesine Micrfvgler lnt4m4lianal MlwoConcepl

Menllor Klnp Mr. Notebook MuuimahsTechnologmfr Nsfilroif Syslafis

NstlinkCsmputem

NelNsdonInternal

NSIPIS Corffpiflofa

N4lwofk Conifer

NswTypoCompur4ro rnelsw Ccflfpfrlofc Norekcokcity . Nu-AgeCompuler Plus OA CampInc

Faute Oniknriiic PC Centre

.. . .107 .. . .105 .. . . . 10

.. . . ,03

.. . . 27 .. . .113 .. . . .5'7

138-2981Simpson Road, Richmond, BC, Canada,V6X2R2 Tel:279-8867,Fax:279-5510 www.aebc.corn •

•

Online

Wem Trataiam set IC86

.. . .10S .. . .111

...7S,79 02.03,124

.. . . . . . . I I4 104 III

113

80 47

Iarily,'Is.la.20

WebBasedOnline Training Courses For asrowas 6.00/tnonth!

dpeCNaebC.COm'WWW.aebC.COm Call: (604)279m8867; Fax: (604)279-5510

Courses Includes: Internet: Beginner's guide Excel97/word97/Access97

ft' MC SE Course s Vis ual Basic 4.0/5.0/6.0 MicrOSO A+ Certifteatians J av a Serious

Lotus Notes 4.6

C in 21 Days

Dynamic HTML

h nd many more APP Pddsfso Cheep

.... . . .. .II2

ira 89

• • 0

35,37

'el

Please call for the beat headset solutions

88 73 108 .72 107 30,31

•

No surcharge

•

NPIANTRONlCS

PC Pllwfal

Phsee I aeeiemi Phil KuehnirEnlerpriaec Portable Worid Powsrsofiic Cofrfputofs PrimexComputers Primus

Printersaiuimw

PfsprossMedi • Ouplicaaoff

lt4 II2 .55 .71

i0a I 13

Rebel,earn

53 IM

SAIT

lie

saimm toc Indusrnes Lld

113 114

Rent.Nel RockComputers

H91 Encore $140

H 51 Supra $90

H $1 Tdatsr $140

T10 Single Line $135

310

Single $ Mue $130

CS-10 Cordless Headset $300

M12 Adapter $130

SR 1 P C Headset $40

SimplyCompuang Skybie SOHOSkyway

11 •

. 114

Solirhol glrolfs Cofripirlofe

supetDals TechnmogkmLid Taluna TCP Subcwlpliar

TCP Year 2000 Edilalal The Corlelis Group The One.ONCOShop Ine TomMoniler Aspairs T rlcere Computer Center .... . . VancoCompulae

Western ImperialMapneNcsLld.. WorkhndeComputers ... WWW.Iifli icrffm fI.Cofff

WWWEbPromo YHC CacceNeInduslrlsl Lid..... Zohrlx lnl crbig nArmedoc• wuvlceold

.. . . . . . . . . . 12 115 120 95

•

2 Montha(SE Elnteynet

Aoeegg0 1~OnS(vnnatCeleron 400 MHE 9910 web based online

•

Pentium tii 5005FSS

91,510

SusirmssLansing 5 ehhn Aws eX tgaaa Makafbaard Sate or PCIM SOAAM ante ol PC100SOAALS PamaxNe I JMMBHoppy Drive Punaaonn 144MBFlopw Drive Fuihw &doe HDUOMA Fuihw dios HD UDMA

Trsinine Courses for eny ewuwwLaamw3hnm Anus Mdlwlmord system purohese

11 •

I IS

•hx IDE CD ROM Dmo euih in VGA WagfatW Sound wfSpeskem Fuglsu Keyboard

I02

.I le 107 113 . 123

unco\I eveImm raw

mw wnWl nw m

Mu IOE CDROMDrive

AWMAM vMeocne Cmadw 120 PCI ANocLansingACS42 Speakers FuiNouKeybaud NLoghechMouse Loshah Moves hscrawe Win 88ver2 MfewmaAWm90 vee tign SSKV.oo lnl Fax Modem USA MK V.IS tnl Fsx Modem 2 monthsFREEInternal Accow 2 frxmthcFREE Ihlawl Acosm I MonmonrmoTmewfgcow» I MarshOnhmTraimg Coums

Pentium Ilt 750 92,815 SuswessLeasing0 Mhn ASW eX IMMW MWmrboad 12$MS of PC1$3 SDRM5

Psnawnle 1.44MS RoppyDriv Fuiilau MGS HD 7200qw gx OSOvO RDM Oriw Suer InVideo

soundenaer ws FM

ANoe Laming ACS452

Athlon 700 91,975 SudwasLwemg0 gnm Aam Magwlmacl

128MS ol PC100 SDRAM Poneamic IASMBFloppyMvs Fuihw 1MIS HD 7200rpm Ms IOECD Rom Onvs ATIkiwi 2000 AGPxh 32MS

CmmlveLola 120 PCI SoundCant Miaoewg Win 00ver2

FugtW KeylXmrd SLOSIMCNMOSW Ulin 50K V.90 Inl Mafwn

MareooAWinM vera

Fuihw KeyboardNLegheeh Mou

2 montlmFREEInternal Ames \ Mana OnlmoTraining Coums

2 monthsFREEinfernal Aames

USR SNKV.M Inl Fsx Modem

I Month OnbnoTraining Course

toL 0$8-2120

wwwcanafacompules.oom ME COMPUTE R PAPER ac EciTIOH APRiL2000 1 ty

N TENNONUSBI GROUPN Scnri h yourIwbngSIWN Imel 120clnuclssj fuf lfo Msif wle ALT26%UUNNNWBI IHBI BI0IB Mwmg CAHIUNW0NERBVUWUBEB GMNWCON. seta Feny ctosanew d yecUC csun FER ENCL Seplembw & 11, 1996. Oolo kkd bypnlwew h Reri uMLnalk cl ML %rif tkn Meme olGwnNCC snlo 9pw Hstsanly Opon Roori'. Ccnhcl lww Samnn, loerne lw wonhgckgl Hekno.Fur nee bteglntk 2912Momee Or.%,CrigsyAS inhwn5w sebcl Bse Nio emoil ol 72AHW.Uriw (HNI 5694562 Fsc(MN 9850fetawinwecslln In cwyrihoe 5694001wouk ~ CM Sa WVIC OUISI SECINR (CMM's laynl AMOAINBI Gatggf (Fsernmd Formoognp AMCSC M hr Canpubnhohssbn+. Sa Oneseel phwak RnyIbnm 589.7199w Mcmbsow(W udwlde mriweabo sd Roget Hery 0824%8.SSSmebso 270. f mriMAM deekdmel ~ d ae NIMOWaeriblgs oml spsdol owwls. %semis olloel for okdwl mombsaPO AIR% ILC. (NHWUNH SXLTV. A Iku Ikn 20%2,HoweSLIMMe. SC%2%6 Snap hrMebask wdSyphb. Msktue ReeBSG601-BS w ye (Nuj 68&1070 moelhwso m 381 ~ d osi mark d Ikewe HaseEchnl e vsmnw Renet meMOarin. sl 7 pe. Nwke sd dhn ~ RNSOFT , EOMOSOWS RRSLIB IBBB grado asboMmNMIHL Aeh I mocgrUS BNIR'-seel Tumku, 7.00 pm, 6et worn Ictbhntny d ess mmlbnl 7pm.d MncE wsn CgyHebe Canpuo,EmWng, gu Cwkry Hase h New ccbnbsbc.Fw Rwm C-137/C-135, 107N.IMk Ara Moor baeufM ad 837-%5 w 299. CCS IRt Nnn Hoser d 8374315 w Rnbh 95dr. BMI d aio-3712(OHOhfo Ongcgw W ATNI 0%8y,Vaanlaenue, SCWB ML SOS857-8105. IB adelmlwS.I WaOslkekc3340%. MOBSIOBWCOMPIHBI CONSULTANTS 2357eskm pueue,KHWLc WM2LS. ASSXSON MOF8C.Tie NCAn 8Amcmfa wmrifdw IricwsesnhINSOplwlfk! sonic. BN USE R%Ma F» msn riienn50ncd at htsedw Tmleh m tke 5324201(mused, oreke met5%4219. w h lu NOM IridwgM ofON I NCAIef lo pnMCCshMI O.c.NNASBLMI Ikec Gnm (scdgLUB wleeMsests as nokmk wile seb prefes8twe br ae pnriwaM yond Ide. MdmgoIdun,will nips m l iud INN I. sd shake d 50mnmbsn lnsdk gs nels 8flri cenpuhfsea Ittwey Inwgngs celmgo Cl wkkNw, Ides, Ml opISIWL wiN SMkom.I'» Moor eamkm caNMI UM ymq moe6oys we MM Oe 3rd uok POSC N020,0WNMBoem.Vsmnw, WCIMCWnt wwy ee nfeuf It 6;30 paf SC VX BN bt 652-2TCThc HH4916 wile bwgw Io be senal Fa bdker krio emoa kcnOmhdiralacn I Wmk pknwudlnkcME 2704066 k gu y ~ wgam f

by Fafsy,Whrcn3'I, HBS.Subnlkues nnw Iores monteonlyin le IMI slibcn. Nu CompulerApsrrmcneslko riolt Ml to prin cubensM wbdf nrnriesnsl ueuilsue. LOIX NOBS.- M Vbak em Ue carat IL tbehyks d 0784M0 w Msy Meria UMmsonny ~ In h r. d jnriseilswewsacsn. amp" IM It: IMHSMM bebide fde. cdsri,lst wolal IN!glott 0ksnleek gbnou WVMOUSBISOSARXOUOHMAHOHSrs. MAC WESI CMSNBI SXLTNMonfny be PBH 00055ILAM (NHW UIBI CLINL ceblm Mad%0203L %% INBI BNNMbhoaUCse MMw lw Aeneas Iel ANNI lndulo PoMPyMCeweM,AnripeaNM.Iua Ha Tueoaw WMCHN%NUKED INBB SXNR M Id Wehooae d esa mae, aekebs cea Gseol msthge 2al Itnkeriw d TCMpw., Ramlgo, GangsRehw Jr.Soc. VWLatOe nwuk,7:30 p.m. S.CLT.8by. goalk Ite d O.clT.Tee acmeRem'c' eai mwa; Oegknwyo nwegnge hri SckwL1390taAr Aie., Pal Coougom. fw Canpus Briy.SW5Roan 1850. Caemt . Case OWBSd gantotg Ior Wcriws% cl Mk mae. Try P,m d 685w bamslw scut Ed Opnd %2- Fimk lnnriw(Huj 5824%2 hkmwgw ase CcnhmwCede for mwcnys ad W552NN%OBM OEVBIHOX ASSN%. MNCOSSIWIIMINBM~ ON WIMgel uk 26H539, POW BI SINRELUsoyoup behg hmeL WW Iwoh sel s Mef sl ywbiter VBI POHMMECMWU1% CUB MSACCESSIEOSCAL %BI'8 6RBM fw Modnpsse IemodIor asl Wsbwrie To MowgoeMHsdogke,mewtakAMI WMBNHBISIHRIBXBWXBW (Waaj WMeww8flbpegripMIA snrinpnNNS seg cngRrtwn Spamawohpmd wee Msassl olOokSLtbe mooey isussty w h w CBrid ue yuO nwcyhori bygw nbat MSAewo. Foreanugw ce Greg Mil %&2606287. Owseel w ae Wwh etgu neCS.Rase M nri d 8584262, w w lin l o SOLSBNBL Usn ysd bnhy fmnel dum wohao hr dobdc, lgryhwwlrin. lkmre Ihso' hbmdsel Aee, ad sd. wesL kfIML byNwnNMooengosoke w M e&We . ~ .kbn l Ibo pupae d la yea Mwgny se pbmori ts loot Mmhy.To mreanABOktbn. SslhiritlnbM% d eeyeae dy pm d k b Wwkh 0 aemw wri neke faum f s WSC ROUNON UMRS 6RNH Ibs Ump Is cwolwpWsm Syum hweeao nlwke PSCOmeer TmhhgCsee, Hongaeg Gobe dwokee b yl hyde wt dwsc tndueri h MbmriM efri cleat Iowmg. met 60S.2%4207. hridngmyeweslGosgh NrwLW Sripbnride baoc.aWeriwykweteg Gnnk Tbn Pehds emend hdurie Fhck, B. 0WC epode dOwInrisuam eeiaseri an ACNWIBI S.C. Mnr Uws Gnep, Mgaw secsri Iin wnel Tolee IMMM OrenmnwM, Bredw, Augewse. Wd seylboahy dMSNI sd pnnebri we smokers an Osesbn.Forakwaul hbmn5w phsn NmMy-25HL710pw fmhhMdw cng wbhri hue dcbgoriMIhLpkels mlri Ise Ou Rebec mace cpwogngcrdem.TM cs VNC I C cwri w l ilhal85w lu criri s wnh. sdNgcl0734858(wehyj w eed lba eoriebm., heridfewm Foe60&73&I ae bulMSS'8 Ielelmbdnr born TENSRUNIC(NNSI INBI XBN Fortoss swam Sagum, nl TOIM le CXA snes bkwsri U ( haasbftM diet GW-730.HSL erior geoged ISkhnwbd inridra mnle 8 Wessbkm ethy d Mud a%pm, OLNCISINS SXNR 808hen Cewsh pnblf Inlshri pm(nds fngumy,WWW , pfo. VUNICBI FON RMINBI Gpodi wowJw- Msnbor. nneumhn wri edwri prick u OpeeopSee(0 CO.LI. gmnnblg,gmlsa erengl Tkonef goals mo.ae mecllng Ikfw oal locnboa hh: owks SIsuwslnhewe«enrcuwmOPE NSNP INBI SNEIV(VNUH. Sw Srilki Io slee canmrierIeonlorimoml lo moke Ianbew d buanpdfieulewcan wJoy kriunLFCIbrie Iriullwbnl W uwslep loth CokmunOps%opBad EICOLL PAOHCNOTES INBI GWP HACNUNlfrinsNdssIweoIwnl IkoIW NWebwn% nf NM Be A US • NM cndf nwIHLk15WNd Rosuo el Retnwf sl Jdy 31SLCwind Maes Snkr 81%0.2%1 re~ can PCIMACIMI BINW Wwbd HCIWWM

WARRANTY CENTRE FOR WESTERN CANADA

Wmi $i

An i

ALL BRANDS WELCOME

FULL OR OUT OF WARRANTY REPAIRS:MONITORS, SCANNERS

tgolds of of%fat(on: Mon-Fli- T(j-5 Satufday - t(7%

www.mr-notebook.corn

Cood, llsed hlotebook Computers!!

4P49-$599-$996I-$1499p 485's - Creat for Student R Writers! Compaq LTE Elite 4/50CX 24mb RAM, Color .............$549 C ompaq LTE Elite JI/SOCX 24mb RAM, Color ...$3994 6 9 9

MAC PowerBooks (2) Mono Displays...............$249-$59$ MANY, MANY MORE IN STOCK!!

Compag LTE P75 TFT Display, CD Add $100 Toshiba 410CDT P90, TFT, CD-ROM............. IBM ThinkPad P120, 12.1wTFT, CD-ROM ..... NEC Versa's (6) P150MMX, TFT, CD-ROM ....

A: Call 1-877-898-9701 (automatic price quote Hotline). CL How much and how prompt arethe shipping? AE Free aCrOSS Canada and U.S.and Same day ShiPPment with UPS express; OS HOWmuCh are the Credit Card ChargeS? AS Free. 08 What PraduCtS We Carry? AS PC-100, PC-133, NOtebOOk memOry, COmPaCt RaSh,

OSWhat brandS dO WeCarry?

..$999

As PQI/, One Of the biggeSt and beSt memOry manufaCture

$1199

Carrying Case, INTEIJCPU, and Toshiba/IBM Harddisk.

$1399

• •• • • n • • • • • • • • • • • • • • • • • • • •

Mr. Notebook

Burnaby Showroom: : Second Floor (@206),: 5050 Kingsway

: Coquitlam ShOwrOOm. : Second Floor (0211),: 3030 Lincoln Ave.

638-3104

464-5268 • • • • • • • • 0 • • • • • 0 • • • • • • • • • • •

188 APRIL2000 TICECOMPVIUR PAPER BG EORION wee ~ n

08 HOWmuCh are they?

..$699

WE NON LISTOVER 300 PEN TIU NOTEBOOKS

• • 0 • • • • • • • 0 • • • • • • • 0 • • • • • • •

NKa6xxC~F m eChaaSKxmpGImdhaX e

Smart media, Mobile CPU, Notebook harddisk, and Notebook accessories.

PentlumS!! IB7$'S tO PHOO'S

• • • • • • • • • • • n • • • • • • • • 0• • 0• •

CONTRO INDUSTRlAL INC.

ance

in Taiwan, ASUS/IVIotebook, German DeSign DICOTJE L/ ©8 What are the guarantee GbndRMA POliCy? AE 7 dayS mOney baCk guarantee,Obtainan RMA at 1-877-898-9702. Replacement will ship to you within 48-hotffe.(SOE EEe reSIFICtion aPPly)

CGEZÃ3ZZGCh8hQM%93 •

•

Info controcanada.com 0002 OAK SK VANCOLIVER, B.C. CANADA V6IS <$9

'I ~ s ser vsks me It 6$HMM (QM 0550 a Fe e NSO065& IINQRltmPCISMS SOQEIY )VPQO), 2al lbedsy. Tan al Is Psdk SpamCeba llbuIhsmwa Reutstw) mambse fns sd gmsls$5shtfdw kcsbel GSAwan 6knbmpneehge Gr

ffl55iei IslasdUCab! Nidefwifi efr Ieiibff5 antSu!gowsl pifbk w IboeSIONaid tUbuff hue b PNCICAIceipilhg nid ta pnNlds a

snhlwtet far Ibshebe& stucuhm sd pssel em al mho. aepuhs. Ik alla m da aswshnr udwebnd smbsu JNNM IlilwinlyoUpcisa capamlo VPQO$0 NIIIU5),ed IIINC,Csp290. 1%VC NCQRSOSOLSaner IhsmOnwpls e Imleede mmyagl ft5!kde bl Pmvefig nl Memew eclnfiga IWAA MamagSOLSana. Iaeung ih Snuudb IIUN6oPCmdAG UsssdayJesey 71999 km 6 39PNla IL35yii, Fof neo IAbmfeSaf,ietenwlb 898at www.wwmLors POC AS:OI D9538.

wao QARI0N.TIPG PETUso —Dele is 0 dlasiwfuwu5lnd. I

hangNi gwesmsl sabmmnnul futmncwsn& edfw su vnl. RNCQfyBIUMNSSERSwly-Aysupat sbshnls. Puwianls Onl suedlb0036Whdswssekann dwshPmm kei e seem ltdf leal hnyega sd ruosdk bsndsbnpmducscompmh ads ed ama. SsmeNcnIs 2ml Tienhy cf ascbmen. Ccnbsl Oneh amytsr eneimls wilbacanmunberssl in Lhm. Se andOpen dwgs .ubc.ca a Urgbe Groan spNNWLIIIIN Ic8ffw, PNiffuy pmfau opNanig sinlirn br assai. Sglt Stra Irt nm bt sd aa nedy fw. 1UOlusty SU albach a Oshfur. ~ d aepuum d80type Afee buswhdis wshmai s )sb nstllG. ants d psgdyumborn sennsd pfshakW pmysmmmla nsw vsgbhDnbfsc CsIOIiN85fig Lib Iet lo gd euOfiwa95L ines wl Ibs cwkms.WwhIka 1st Wehndu d uey mwn n IOQOINEIIU796- Hswb Ibube Mguwud 6sl hlme Ie IICsr- Fw msnbedk Alanebfmplass vbRIe Lbw in vsaelw Inib SNpyfvfww.vecnelorsbtetmcsmfweka,a sel msmyn Mestee Caen JsbnCea, 736.7782. nul sd SNWsbwin e nsekmce yka. Cwha JssUenpnmkr Ms le bkaimmln.cs trek. 8056W& WQOOSOOhbf OfmiUes GfauP)ROP bels h ai COA NSmdime ISROSI2IOERSlgly. Albehd by 092 yns wd nmkas d de esnyestwgb cinchmbnncah peale IbingaUek3 5 VPCISeeyalaa ~ de s I ps sd ~ ts WNCQA ThhesNIIWN ynwmdhbmwlhsgslwebesmalee bnbdukh pkk e Oadknlnmna manbg.Madngsfar Ibanot luw sgvsnfea d ~ ta W buws NdS.OO Gwbal ttfdy RbesN 8NN nee slae scTslsuldn) 3777nngnvsy,Bumsbysmlslwls at6 85 neNN wislmMsmm, ad ksklal 8Iscsl pub.Gehct bsd fnem, 7314NI39,a sask ~ can pm.Gmbel JimSnwclek 8784709. 037-7222,creeilke ~ cw SMTW SSSIG$8 -IMOisle phe Npmsu 8nstwwkshe. WE STBS CofntnBKUJECCIGtgm Banks WQWSh8sms. VPQOEtinebel Gsmiwss — Mantes 35,Heonmbm 515. IIFCU bose ed ernestaIne fmmbathy Ne led agske 8 wsl, a INbiwism fwNagesandndwm dmlesn kcwwe Ulaillbwg. velNNsu'cs, fuiNOwddem conhd Gwwh ewual,7374678. hello isl5biwsi pmfsi wte ONUoly asswlei tm W8Iskng dun& U hg Iden IOCU t bUROlg nefbfig ~ wsb s iss. INAS na WCUS HIM.AUIHORSGSC-Sis 96a agaudphcuhwns fsr bhr- Guttastdries spa ukh isis eepsft lilac cwfwk ai Noun,wc'fu bel lalanel applkatkm dmslaymwt kmh. Gmd Omni to wl emeke win eer HN&dwshpm a lo gslswn m buM- knkhgforvubrees ltsme h yabg Sis 95 ymgspun Camel iu iflfg oir w5b abi ft lobcfkuuwwcwug.ag fsr de lg sfec.m Iu taf 228.2183 fiu frig Imafunr wd pseml INI 88yn. Tskr &Urn grapNcsisid Deci Sobmm'~ HNIL PIUtHINIe brace was,Jsmtmcarncgrk inca ed ne- nea hhfmew

AOV ERTISNG9 FREEFORINOIWOUALS. Fa businsss,chrsigah

:N"etwork Your Home

serf pwIma (80cbaresm). Sadinyour at, sleg wilkyaur paymel fin DsNhyissuebyFtky. Lbfw 31I 2MO. UeCaauaa Paer ranee SNNgbl NNlo priat submissem I

I I

with PANDKX PC

Cgfdtus JIOT Atgtctss — Ohte mb PagoSeinss Uwl Eelee GuiAIRNSGNInra Lawpleo, mb BlasFcr Oudnw Or Redy. Gm'ass I lbh 6rasl otaabmk 6raslTe sess Fsrneo bnbam NsCamynr Nsstsd, wwwJpftfepcw ~ Msk ksIsreuasxtgtLCO M856761-13112agl& EJUMSIU OWNRNIY h Tdsam, Eafemam, tacutckr kannt6Mmt Greta 8LRsteu Iwea w Ibsma sado Tadayl lk Umpls, Rn6 Rfdyns Tmbmg6Support IUNO2324ttgl.

DQ J$$(Q

ERIES • Panlium /AMD' MMX Super 7 512K Cache AS NACffm Moinhoord • Trident Blade 3D 2UAGP Video • AC97 PCI Audio • PC.100 32MB 50 DIMM RAM • 0.4GB UDMA EIDE Hard Drive 'triUhSpeedHOMAL Access '

PC'8Cbssp sd 60 Buy ae», nsw, Susnyl F» dunmlss h stmmfe Fnmsbdl Ued pcaummt lmeias. aadt cant oosvsy

Simultaneous Irdernet access

Iel INMNIeuw.bifkfffdn.nmi aml I 407 Mg 2225.

$9$9

AMNIs 2 5N

595S9

AMDIS 2 S33 Co m lny Soon Msf IS-2 550 C omfny Soon

eekn siuel dslatwra 0ncfspmen Nasl efsffnuWACC OW WituaisnV Seer, compslsliva toom; 608.572.5MT esnlmwne-ense fEASt%MS QO

AMOKri.2 450

l I

Share scanners, fax machine

Video cenfemmcing

Ikao Cs&PQ,Andbch654hgs-30, 2.mb;vtn saws, asung hr $30fbm.07&2516.

ES ® k .' t • CalsronvSockot 370 ATX IAIUPGIO Chipralr AS int)no Mothsrhoord Built in Intsl Video B Audio • PC-100 04MB 50 DIMM RAM • 0.4GB UU MA Hard Drive

LEMNc, c++, Jfn& viol, HTL&sml Jfwuscra ~ by Easgwwmabauhg.mm km REW Atlos fsr ourgnp,rusdhg smug, Sslwlfig Io iriiaic, shop.

'lrigh SpeedUDMfbd0 Acers '

Share f)les, music

Share printers

Plfig, Iuecbb& NIIOIIAgcNfleh, Pbdfu gsfNC,ONllg al am.

SN Lemlaens bra)e sdaley. Job etogoov yugeesst SM ye sd PN ta yw mkmahbm. far baa. Fa hh hsm

and mom.. . cdnnnee45$ SSEP39

etwork your

Gkwylwwaw $39$9 GhcrrINASNN $SEEE B9 tekel'ANSSn 53 Mfg

ome fN:s and

CsmpuhrWhwelsd farpAah avehg lance anecsl amlpow. eyobl imematbtsueecsd caN melmmar isava8mamosal 075755Fmu

Play games inIhe

veryone can

SERIES )N

njoy the fun of WINId

igh-Speed GfRS OOATAmbythembsdCbdr Caemk Geyay Math2&SUO Sun 11w lo 4ya81DaVhewsr NNN Qub495 Umtla lee. Pmls,Reb Gdkcsgesd Cds. Oeegue ee eeb epadmd

AGPATXM otif boofd

hare files, gcan~

,or~

• Pentium' I/Sl i440BX

• • • •

nternet highway,

09C05N UTBt 95RPMEETGsbukytpd 1,2$9 lrom t tea la lylfi ft Ibs CfwsNICINNO I Caaw 3?50Csmesdd Ofbkueccne Agmekn ls$3$&For neoshee te05254UOI

to lan silksCs pNslnl CsmmuUNy Cesar361Swtb Heed.ssdb Suwby.Admieke is M.gtL for nea Infa csu16WI5214308

wtwifIN eo

ancrease

$1$3EB 51618

$3999

$1 yy$

nrnmrs 7% Sgt49

ij j+'

$2E520 9 .

fflciency.

ILRAILC,WMRAOONO COMPUIBI SNP CSEf- GW IOAYJSU • Nm fnm InsnTOCan sl Ie ECAACehr,121lg 224th SL

AU nbooo OysuoemSectudor

nhlakn fsQ.OO ,Tsbkw61gdk Farmao into ad Tsny166SH655710a MO N)S)S)CSU2957

Pononvfn I 44 Floppy drivv, IO Mid Tower Cine, GVC V.90 PO Icnmol Voce Fov Modem

sorimvi~

LMOtm COLIEO ECONTINtDO STUI%$. 100 mwl UHA Avsnua,yan.SCVSY226. Plena: 323-S322 Fsr;3235899. lbUmsd'eCwse lor Baglmsm6 ndaslaela fnbn BASS OSIOSESGEgtKDRONCBflREogsrs sdtcephycd ~ Seb um wslwmbegnby ke Ssmfnw Sue• is seniw beer,ede, nenepar cahmnht, efeth& ad kss opashd b'e awnfwmscu lumnafsm bsbsss for tbs psst laaha lasscssstella bn mao bus. • IIBOSTGE CSHMO RNi PRINESUSSL OEV ELOFOa tf. ONm ftfabeusn loJavaLmemyaWsbGh bend eieg McnsuR Fnepuw.Omkkt ub)sck Jea 609)fek Fin ne ssl ploNI INceilllss,slee Caf Ie bwfe Heimbus ukMgvlwww.kwfclbeymh,cafwd ASP IREeaya5m RsmeSCIShs5W Snlsty is8mmyan delmh eynhsnngl C,Rsp025.tORFSLCbsnly Rsgggyal 2 2$. Rms $00 2IDSH2.

PC.100 04MB GD DIMM RAM 10.2GB UDMA EIDE Hord Drive ARXPW99vd ~ O MBRAM Sound Blocmr Lilwl Valuo GcwndCard Aadmns Sn SSO99 yufdvnPUMs $3$5ttt Padwfr • sn SSOS9 yehnPU459 Styeg

"and more to

OOCOINIIRBI SSNP MEETaturdsv Mscb Nb,2MOksn I len

DEI L

~-=)gfff

For fwrrhur Price d' WPgradn OPrianr. Punra rnll oar nnrhorincd rcrrlkrrl

ent~n gbtsrngeurgOM SMa Uiw ll-13, fsouo ciovfwoonptOCO. nnfvnofvf Uc Vsu 208

gyrsaoeapdm a

tffoci Ucc.em PWI

(OOC)258-9uas

vusclif: WNIW.UAAVANGT

' GMAILGAfvvn,nconnfwANET nwni

JU l s4epeesalw o umedueSetaehe frrfmm) (Lsfuhy)

ppr-t244

5C9-PPCI

Tech (COCI 248 OI95 ,

ngr IDE CDRom, 120 Wom Sivrvo spvfkvn, 107 Win 98 KorboOrd + PL/2 Mourn w/Pod,

' 1 871 SC OAI WA

o Uo uno Invvuvvn

on m

(famfospsi 357-IPCI os sv~

ww w ~

538-2574

FlmlleNt Csapstm (Orfla) 59l.tddd n on ou r i l nona or4

igum aori

833.6!up If nv non non

fa. bffcfunaf)

ppr-Jcry .:

(Ovnrsnf

rctrgrfp anv so noon

pute c om THE COMPUTEFI PAPER 80 GDIUQH APRIL 2000 ggg

The Canada's Computer Information Source

The Computer Paper Year 2000 Edit oria l Ca le nda r er FeeUre

. gg g gr rrgg

Q>adage@+~@ ek kr~

May .'

Tuning upyourcomputer. Storage

Backupandarchiving

T ues. Mar 28 Wed.Mar29 Frl. Apr 14

June

WorkingtheWeb: Tools forpersonal fameandfortune

SecurityToolsand Techniques

Tues.May 2 Wed. May 3 Frl. May 19

July

UltimatePedpherals and " Monitors AccessoriesGuide

AIIeggt

sskarsnewIn

Toolsandtechniques to Improveyourcomputing

I Ink)et

Iprinters

PC Music

New Media

Knowledge Management

sgptgubgg for greeks andsin rrareg a career IT Ies

INuMmedla cards (audioIvideo)

IdeoConferencing

October

Flat.paneldisplays

mall Business ssentials

Mondo PC:the

systemyou reallywant

November

TCP'sBest of Breed softwarepicks

December

Gift Guide:Great '

Tues.May 30, Wed. May31 ', FrL:Jun16

presentations

Tues. Jun 27

Wed.Jun28 Frl. Juf 14

,gues.Aug1

Wed.Aug2

Fri. Aug18

' ues.Aug29

Wed.Aug30

Frl. Sep15

Multifunctlonmachines etwork state of th e

Tue s. Sep 26

nion

gifts for comput(triste,.~g

Ifandhetdcomputers

etchingthe pennies:; ' Tues,Oct24 ccountingandPayrog oftware

Fri,,¹rvn 10

Advertisin In uiries Phone: (604)688-2120 Fax: (604) 6884270

Editorial In u i ries Phone:(418)588.1580 F ax:(416)588.8574 T oll Free:1 • (800) 465.3517 SchedulesubJect te cheese Editorial: tcpeditorial©tcp.ca

A S U S T 4 K C O PS SeU T S K S r e C

hearn //www

n o on nmmv ow

T e knee e 3 3 $ 9 1 3 6 6 t SA X te a e 3 3 9 9 4 3 6 6 9

Combining fassmt hardware cpm ponents tha most reliable mo*erboard design, and statoasf~ st thernsd hamglngSbsjcNte Irfkt one sgm. 35mmALLANu3NE Notebook PC! k /dc/Enele//yand powend by Mobile pentium III processoy featuring IntaPSpcsdS/dpm speeds up to 700Mhs. the I OOMHs pyocassor side bus system prcndde the bast performance of mobile computing in tha world. Together with AISP Sx. S millions triangles per second setup angina, the true color mdkdertng chip enables*a system to deliver exceptional imagequality and the fastest 3D graphicsthrough the large Iq.I"acdva matrix color display. Add a MINI PCI expansion card andtha LS400 Series provides the most gmdble system wkh expansion opdons inculding Sak modem/fsx, IO/IOOSsse-T LAN network/ng and even the I 3'H Srewire™ for high-speed digital video data transl'er. High<peed Xqx CD-ILOM (or 6x Dt/D-IICIM j and Soppy are both built-in for ma3dmum availability, Equipped with two USS ports, an ASUS Pordkkr connector. high, quality Tt/tout with Mscrovision protection compliance. two type II or one type SI PC card slot, and RJ I I /a5 combo phone jack, tba LIMOO sertesprovides users the most familiar snd easy-

ttbuaa conkptktl/Eg envtyvmmena

ASUS Notebook PC UHOO series, the Year 3000 standsrndkworks on demandt

ooeyapP ,ftrltjiam+ py I ~s ts uu I'

, I/P8

r c

I 3•

1477-898-9833 www.contrttcanada.corn

•3

•

The morc conmact Allumono

I a. I Ubolatdvperemname As mam

Fhuabmtk PC I 2.1'/I 3. • ' TFT-ECD

Hmebook PC 2e AGp 3D Gh nnucm vRAM aml Tvace

6/'ll GB HDD 31 e 160 M S m I n m emmy

atettttnpfff

i d e tooo

•nd Pentlum»e manta ed T mdamnlu of I»bi 4 p a u

•

Pellneea 4 Peliaoy

y ear'Tpwarup™ ~

I/mt, Tl» I n t I

•

tw pom d

Mat 'I Peruw r l b procena 100MH2 6/11 GS 6»126 MS et 192/236MS Wm

• DvodBIM 4 n opbm

Sup G m ven bk ,k-ndndk Full Mtsnorkm Thin 6 Usta Hcnebook PC 12.1 /1 3.1 Ty y -ECD

• ketlepteeeedoe pmcetw aotnok 6/11 GB HDD aa to 192 Ms main mmnmy • koomn d .ee Ikrd Dhk W u k a « Ihe Ianle tittle

lmer Pmnum 9 pnnntear• DvoatDM modd vns be nmly by Feb90

Gne Flawy Dbk Drbe 6» One Modular IDE Drive Bay lor CDBDM, Dvonoak 4 bd ekd Dkk D/W 3»lel Pon Paralkl port Tno P32 pruu

VGA Port

Audio Iack

Johnny Canuck vs. the Brain Eaters

•I •

I • •

•

I •

• I

returns, and thus encourage more superheatedAmerican a!«!valent, of competitiveness), and to change thc 20 technology IPOs (initial pubare due to the conser- Canadian taxation laws to allow lic offerings of stock) Soated in vatism of Canada's m ore Canadianentrepreneurs to get Canada in 1999, l6 were initially

or those who follow nat ional «Kurs, the debate in the last year concerning the Brain Drainthe Sight of high-tech and entrepreneurial tal-

financial i n stitutions rich at home. It may be that a dassic and investment commu- Canadian compromise is in the

nity, which bistoricafiy making. Perhaps in the high-tech tended to avoid the risks policy s«ctor, the go vernm ent will of betting on high-ta:h attempt to balance the competing

ent to th e U.S.— has

start«ps, and have thus

ofiaed an illuminating peek into the alwaysinsecure Ca nadian national psyche.Canada, the country that the United Nations s«ems to havegotten into a habit of naming the best in the world to live in (what a shock to our self «steam when some other nation eventually wins the prize!) seems toconstantly doubt its very ability to continue in a«stance asa country. Whateverthe cause ofow anyt,

avoided much of the social programs, encouragemcnt of benefit of the Internet economic yowth, and rewards to boom. high-tech risk takers and talental

the fr«ttiug about Canada's imminent doom at the hands of the Brain

Eaters of Silicon Valley sccmsexaggerataL Bveryone in the debate over Canada'sfuture seems to ayee that

the country's most critical resource is its brightest young minds, and an unsettling proportion o f

For its part, after

Orpilal venturing forth less thnldly While a comical parade of incompetence,coverupsand patronagescans to characterize much of Canada's ment did more recently admit that federal and provincial politics, the the lossof key intellectual talent was country is actually doing a lot of

The Yankees were using dastardly

tricks' to snareunwary Canadian talent, including free tickets to San3ose Sharks hockeygames. Thehorror! a concern. A humorous note was addal to the debate in the summer, when Nortel attemptal to suc an American network technology firm, which Nortel allegedwas running a

Hat sbowal how to turn the previous paradiyn ofthe software busi-

ness on its head bycommercializing

in vestors. T h e

the Linux movement. In Young's

Canadian banksare gening into the high-tech investment game with somewhat more eagerness,and the pool of venture capital funds available to hdp start ncw technology enterprises isexpanding. One of the bright spots on the taboo)ogy venture capital !rout is X DL Capi ta l Corp . (htlpyhnm,xd!.cea), a companypartly founded byex-Delrina Corp. executives. Delrina, a Canadian software company recognized internationally for developing WinFax &zing software, was purchased in 1996 for more than 0500 million by U.S.based Symantec Corp. Delrina co-

opinion, Canada'seducation system pmduc«swonderfully talental executivesand technologists.

founder, Dennis Bennie, took his share of that wktdfidl, and, with some ass«cist«s, started XDL specif-

colmtiy. Young b«licves in "building an ecosystem to promote gmwth in

Young stated that he believes there is merit to the 'duster" theory

of economic development. Where there is a critical mass of talent and

some strong motivation to czcd in some specialty, it's possible to build globally competitive companiesand even industries. Canada,Young says, has a tradition of innovation in telecommunications, networking, bmadcasting, and yapbicssoftware. M uch of thiscan be traced back to the physical rcquircments of linking together a huge, thinly populated

icafiy to find, invest in and nurture the Canadian technology fidd. One promising Canadian technology reason for the disproportionately s«utups. An initial investment fund

large infiucnce of the Internet in

of $25 million wasrecently bolstered by $150 million. In early February, BobYoung, the co-founder and president of Linux thiny right, in terms of building a software giant Red Hat, came to vigorous digital economy. Although Toronto to announce his participathe Canadian high-tech in«atm«et tion on XDL's advisory board. In market is not nearly as aaive as the conversation with The Computer

global economy isthat it has provided huge opportunities for growth of new companies. If Canada can aeate an environment that fosters the

development of its citizens' citutivity and skills, it cancom pete asthe equal of any of the great technology powers.Ct

campaign to lure Nortel's top net-

working brainiacs toCalifornia. The Yankees were using dastardly tricks to snare unwary Canadian talent,

has modified his line somewhat,

induding &«e tickets to San Jose Sharks hockeygames.The horror! Most rmently. the federal government has indicated it is considering changesto investment regulations to allow Canadians to invest more freely in international markat (to let

admitting that parts of the problem

Canadian dollars pursue thc highest

tech talent at home. Since then, Roth

cr««tora.

Prime Minister JeanChrctien vigorously mocked the existence of a Brain Drain —in essencewriting olf those Canadians who choose to leaveCanada— the federal govern-

t hose

minds doscam to be leaking southwards. Yet, at the same time, thousands of otha bright young people Sock to Canada,and toour universities and high-tech industries, &om nearly every other country in the world. In the balance of Brain Drain trade, Canada may actually be running a slight surplus. As we mentioned in a Last Byte" more than a yearago, JohnRoth, the chief executive officcr of Nortel Networks, blamed the federal government's taxation policies fitr the difiiculty of keeping our best high-

needs of underfundcd national

p rofitable t o

Paper, Young pointed out that Ral

TBAT tdPNIATOI WIII

thg GhttyhCIBD IN Appfgzr((v(AIKLV TR(yg

%555'

dgrAV,0thI)it NaxfIdggrr

TOtdhttR ASKED dSFPBB BSBAKS txg(!I$' VdgtBdr Ssyrlygs'Jd yyfifi Ghxtpw!BR CAICUtAII()hig 8QT.2!IB SdryNSNg&tthhl IHSBB HIORB IBOltyr A QIPBy SBIBBKI!

DIRER PRICE + QUALITY+ SERVICE = 2OLTRIX COMPUTER PERIPHERALS

m~ ~

utfoeg tit

MBm

Eagle Cam will automatically capture up to 30 setxtnds of video for you, and instantly E-inail it to you at your designated E-mail

address, even though you are far away.

This software packageconsists of Internet Phone, Video Email, Internet Answering

Machine, Internet Fax, Internet Video Phone, and Internet Chat. Among all, the Video Security Software enables you to get an instant message if someone enters into

~gag

• Using Conexant's latest imagination technology • Full Colour and Motion Video Capture • Makes Live Video Conferencing • Sends Video Email • Captures Still Picture you can Send through E-mail • Edits and Creates Your Favorite Clips

• Turns your PCinto complete security device!

R4~

R K IHI W~ I

ZoltrixGenieTVturnsyourcomputer into your personal entertainment centra! It provides youwith Super Quality TV and Video Capture. With the programmable IR Remote Control, you can watch your I'avounte programs just a dick awayl You can even switch olf your computer with it too!

• Supports NTSC, PAL, SECAM • Full motion video capture • Sizable TV with moveable windows • Auto scan • Supports Intel InterCast and WaveTop • Supports closed caption functions • Supports Microsoft Web TV • BTSC stereo decode (optional) • Full DBX noise reduction (optional) • Compatible with home camcorder

• Wireless IR programmable remote control • Switch off computer by remote (ATX computer required) tdslt out osseousioeUeoteleut Pendent oooo, usdoteo A ddeoeo 4

neeueeouunooenuneeoet.oouNen e ~

eeno o tunteeoeeeeenoeesenseeenoeneoee.

OOT A PIIOULUIIT CAL L OUA TOLL PAUU TCCHNICAL UUPPIXIT 4

'IN'g'g 7Q)tf)g CQQ $ g)) fog gg CAUUIfeeosd eases'

YOUR

BUSINESS SOLUTION Loo/dnff fbr ffie Ifght Canadian Cho/ce for your home or fnisineset IPCDirect gives you the choice of solution in these great packageddealsl These high powered, high quality systems have everything you are looking for - without the high USAprice tag. Each system comes fully equipped with today's leading technology with high quality processors, extremely fast OD ROM's, monitors, cutting edge software and Modem/LAN card to hook your family to the

informationSuper Highway. Notonly doyouget these Let y Ou r B u e l n e e s t e k e O f f W l ttf...

W lN D O W S 2 0 0 0 I PC BIZ Select

great options - but you also get Toll Free & Local

Support, Local Service, & Local Upgrade Service!

C 5SS

s Intel® C e le ron ~ P r o c e s sor 53 3 M H z a 128M B S D R A M e 10.2 G B H a r d D rive h e 17 Monitor a 48X C D R O M e 300W S p e a k ers w/ S u b - w oofers s 56K V.90 M o d e m a ATI 8M B AG P V i deo w/ T V o u t 1 0/100 LA N N e t w ork R e a d y e Phelps Free S p e e c h 9 8 e Corel® W o rd Perfect(S Office 2 0 0 0 e Micro s o ft® W i n d o w s 2 0 0 0

I PCBIZSelec t

P850NAL

pentlumsl /I

00MPU lE5 S SS S

I ntekS Pentlum(S III Processor 53 3 M H • 12 8M B S D R A M • 13 G B H a r d D r ive a 1 7 h McnitOr IPOEA EEO IESE ' 27 Gs Henl Drive (7200 BPM) hvtsa TNT2 32MB AGP Vldeh

POEADES I'K S IQ' Mhhila

a 48 X C D R O M

e Phuips Free atpeech 98

SPOEAOES PK ' SX IND

a CoreSS Wordiderfect(S Office 2 0 0 0 e Micro s o f t(S Win d ow s 2 0 0 0

$25S IPC ab SCI-A-I-Sdeadz

SPOEADES PK

a 450W S p e a k ers w/ Sy t f N 5 & ra a 56K V.90 M o d e m nVidla TN T 1 6M(aA G P V i f le o e 10/10 0 L A N dvietwo/tt, Ready e Norton Anti-Virus,20 0 0

hvtsa TNT2 32MB AGP Vldeh

Sss

IPC elf SCT-AmB-583 SIZ

I PCBIZSelee t

S O OO

e IntekS Pentium(S III Processor 60 0 M H z 1 28M B S D R A M s 20 G B H a r d D rive a 17" Monitor a Toshiba 44424 DV D - R O M / C D -R W a 450W S p e a k er s w / S u b - w oofers e 56K V.90 M o d e m

4RVLIP e Intel 3D AGP Grapfuca

s 10/100 LA N N e t w ork Re a y a Zoltrix USB C a ryssra f s Microsoft Ga m e pa d an d G a m e

IPC BIZ Select - S 150 a Intel® P e ntium® II I P rocessor 75 0 M H z e 25 6 M B

POEADES PK 1

• I leal pofsums dl fhcessorSST MHC ' 250MB BAM

sass

e No r to n A n t i - V i ru s 2 0 0 0

a Phelps Free S p e e c h 9 8 a CoreSS WordPerfect(S ONc e 2 0 0 0 a Micro s o ft(S Win d o w s 2 0 0 0

•

S D RA M

e 27 G B H a r d D rive (7 20 0 R P M ) 19" Monitor • Toshlba 44424 DVD - R O M / C D -R W fftfdt e Hollywood 4 p o int Surround w/ S u b - woofers 5 6K V.90 M o d e m a 32MB M a t rox-G 40 0 A G P V i d e o e Intel® 1 0 / 10 0 LA N N e t w ork R e a d y a Norton Anti-Virus 20 0 0 s Philips Free S p e e c h 9 8 a Coral(S WordPerlect® O ffice 2 0 0 0 e Mlcro s o f ttS Wln d o w s 2 0 0 0

POEAOEB PK 3 12' Mhhllh

UPGRADES PK

IDMEGA Zlp Drive

. UBB Camas

$14S 3 3 IIPOEADES PII 3SCMB SAM

25S

Ipc es oc1-E a-yao-ssz

IPC aa SC I - H -SHKXOSEZ

All systsno above stduda Mouse, Kaybowd, Integrated sunound soundsnd 30 Days ptas web bom Internal Dlron

4 ORBAT RE A S O N S TO BtfT AN IPC ~e

ht % r in

hss been malong Canadians happy for over 10 years.

ui sys tem ls

ump your money a into Canada.

shipped oul ot

Toronto. (not U.S.)

IPC Is partla l s d rvlth

Canada's largest Independent I Internet dorvke prov(der.

Internet Direct (nol a v.S. conglonlefste) You fuel the canadian

eapfnOE

Ys u s aaaua41 u am

, ' Your Dollar stays In ,Scutash

ttaa~

a W VVWetPCeCS 20 Itouvs

1 $$$e446 4472 Mon-fret g-tl EST/ Sai Sd EST

Visit us © w w w . i pc.ca & w e c a n c u s tom b uild one just for youl dlohl • llaa Is OQSOSI aae hlNNIN td oea h a a o l e h ae dac l ah s oNa

dames

• Ietl a ne pah calaeh ahaa ncae ~ e d a~

ad a e a d h eoaIa n adelal eaa ames aa neaer a nfdal an ale I

el lhl e h d a l h a e f h s ehfeoec dah sdoalenesaea o aasp t a lalol eppaf fanhcasaeaNeehe eeaa

I m ac teataaeaena oheh aha hhl asaeas hd am cadsacaaee sejoltf dehasafe ada, ed ata as ~h d hNS ~d

the peed

a ds a eaaleaf ea sshn

hlhdlda alheaaef aaphy a na usldam cn oeh cele h csah dassent @ ~ a Omahas » sseps sfd «sada Qfaheres an taper tds a d Iaetmse ssaaa ealaala ad aa ap caaf ealfldaala dde ed cspea Ip cad de • o aee aaseafea sashes . easel ao fd Is eaer a dda fas d aa h aloa Ipflca nhasha caa phhahl ef d percha .Shad a e a p • el hah nemeses! Saa Iae Iaal IN ce ffefalsad oho Ihshas Cndoas eslhlhafa aaeas doeo censer h

mao a manna

teel peace em a soda dl• I as

IDGICD.B

names are re g i s t e red every s econd. And t h a t w a s b e f o r e

i t was so i n e xpensive t o register a d o main name. W orried t h a t t h e n a me y o u

w ant fo r y o u r b u s i n ess i s

already taken? You should be. So register your b u siness domain name now at

easyhosting.corn.

*rS o o is t h e t o t a l f e e

Ne other charges apply

a~s'~ » s

I c