AU2016244220B2 - Human CGRP receptor binding proteins - Google Patents
Human CGRP receptor binding proteins Download PDFInfo
- Publication number
- AU2016244220B2 AU2016244220B2 AU2016244220A AU2016244220A AU2016244220B2 AU 2016244220 B2 AU2016244220 B2 AU 2016244220B2 AU 2016244220 A AU2016244220 A AU 2016244220A AU 2016244220 A AU2016244220 A AU 2016244220A AU 2016244220 B2 AU2016244220 B2 AU 2016244220B2
- Authority
- AU
- Australia
- Prior art keywords
- ser
- leu
- thr
- val
- lys
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active, expires
Links
Abstract
Antigen binding proteins that bind to human CGRP receptor (CGRP R) are provided. Nucleic acids encoding the antigen binding protein, vectors, and cells encoding the same 5 are also provided. The antigen binding proteins can inhibit binding of CGRP R to CGRP, and are useful in a number of CGRP R related disorders, including the treatment and/or prevention of migraine headaches.
Description
(21) Application No: 2016244220 (22) Date of Filing: 2016.10.11 (43) Publication Date: 2016.10.27 (43) Publication Journal Date: 2016.10.27 (44) Accepted Journal Date: 2018.05.17 (62) Divisional of:
2013205271 (71) Applicant(s)
Amgen Inc.
(72) Inventor(s)
Boone, Thomas C.;Brankow, David W.;Gegg, Jr., Colin V.;Hu, Shaw-Fen Sylvia;King, Chadwick T.;Lu, Hsieng Sen;Shi, Licheng;Xu, Cen (74) Agent / Attorney
Shelston IP Pty Ltd., Level 21, 60 Margaret Street, Sydney, NSW, 2000, AU (56) Related Art
US 2005/0282252 A1
TAYLOR, C. et al, Journal of Pharmacology and Experimental Therapeutics, 2006,
319(2), 749-757.
DAVIS, C. et al, Current Topics in Medicinal Chemistry, 2008, 8, 1468-1479.
WO 2007/076336 A1 US 7,288,251 B2 US 2008/0057063 A1 WO 2006/068953 A2 US 7,423,128 B2
2016244220 11 Oct 2016
ABSTRACT
Antigen binding proteins that bind to human CGRP receptor (CGRP R) are provided. Nucleic acids encoding the antigen binding protein, vectors, and cells encoding the same are also provided. The antigen binding proteins can inhibit binding of CGRP R to
CGRP, and are useful in a number of CGRP R related disorders, including the treatment and/or prevention of migraine headaches.
2016244220 11 Oct 2016
HUMAN CGRP RECEPTOR BINDING PROTEINS
The present application is a divisional application of Australian Application No. 2013205271, which is incorporated in its entirety herein by reference.
BACKGROUND
The instant application contains a Sequence Listing which has been submitted via EFS-Web and is hereby incorporated by reference in its entirety. Said ASCII copy, created on December 14, 2009, is named A1472PCT.txt, and is 312,447 bytes in size.
The calcitonin superfamily of peptides includes at least five known members: calcitonin, amylin, adrenomedullin, and two calcitonin gene-related peptides (“CGRP”),
CGRP1 (also known as ctCGRP, or CGRP) and CGRP2 (also known as PCGRP). CGRP is a 37 amino acid vasoactive neuropeptide expressed in both the central and peripheral nervous systems, and has been shown to be a potent vasodilator in the periphery, where CGRP-containing neurons are closely associated with blood vessels. CGRP- mediated vasodilatation is also associated with neurogenic inflammation, as part of a cascade of events that results in extravasation of plasma and vasodialation of the microvasculature and is present in migraine. Amylin also has specific binding sites in the CNS and is thought to regulate gastric emptying and have a role in carbohydrate metabolism. Adrenomedullin is a potent vasodilator, adrenomedullin has specific receptors on astrocytes and its messenger RNA is upregulated in CNS tissues that are subject to ischemia. (Zimmermann, et al., Identification of adrenomedullin receptors in cultured rat astrocytes and in neuroblastoma glioma hybrid cells (NG108-15), Brain Res., 724:238245 (1996); Wang et al., Discovery of adrenomedullin in rat ischemic cortex and evidence for its role in exacerbating focal brain ischemic damage, Proc. Natl. Acad. Sci. USA, 92:11480-11484 (1995)).
Calcitonin is involved in the control of bone metabolism and is also active in the central nervous system (CNS). The biological activities of CGRP include the regulation of neuromuscular junctions, of antigen presentation within the immune system, of vascular tone and of sensory neurotransmission. (Poyner, D. R., Calcitonin gene-related peptide: multiple actions, multiple receptors, Pharmacol. Ther., 56:23-51 (1992); Muff et al., Calcitonin, calcitonin gene related peptide, adrenomedullin and amylin: homologous peptides, separate receptors and overlapping biological actions, Eur. J. Endocrinol., 133: 17-20 (1995)). Three calcitonin receptor stimulating peptides (CRSPs) have also been identified in a number of mammalian species; the CRSPs may form a new subfamily in
2016244220 11 Oct 2016 the CGRP family. (Katafuchi, T and Minamino, N, Structure and biological properties of three calcitonin receptor-stimulating peptides, novel members of the calcitonin generelated peptide family, Peptides, 25(11):2039-2045 (2004)). _ la
2016244220 11 Oct 2016
The cidelfonuf superfomfiy peptides act through -esen-iraiisfueoibrune-dotnam G~ protein-uoupfod receptor.- iGECRsl 'The caiettonin receptor v'Cl ”C) K' or' I receptor'5 and VtsER :.·! ρρίο<- ne u pc Π $”tufesy fT’miPt Ks, nhftb lumfo n>· hides other GPCE- th.c rceogm/e regulatory peptide- such a- -ecictin, glucagon urn; \a-oactrie intestinal polypeptide < VIP). 1 he best characterized sph..\ vtrianls of human caicnonm receptor differ depending on fo-e gfC-eoee Dm moth. t ’ Ri 05 Ci E ί no* Ιηουη as CI -. 5 oi .foserec Ebe nuijOf -pin e variant, formerly CTRip er CTKy now known, as CTy) of 16 amina. acids in the first intsakCiiubu loop ckirn ·„ί -J . I -pres-lon of two human skeletal caicitonm receptor ixoforms oloued from a giant ceil turner of boric; the first nth'aeeihthrr domain modulates ligand binding
H) und Mirm. U'<H>oueOo?i I t. hn hired u bbfok^oo: QoodJIey * d Amy ho i-vcgtois mofocuLu coropoMtiou and phuhnaefoog'., Bioehem v»e, Dan- .. 52 Αό-'ό <2150-1 k Pouter e? al . dfo)?) I he exidene.- of .u u ed two t 1 IRP uveplor -pfitype- hud been proposed horn dilfetenhai untagemu dfinuhes ami agonist potCiivses 01 a \ eons oi m y*.« and ui ubo 'hfos&says, (Beams et aLXGRPfod’fi A calcitonin gcoc-rcbhcd peptide afosgonid rcvealrng calcitonin generated peptide reeepnu hctetogeneifi. ui brain -aid peiiphecy, j. Pharmacol. b\p Ihet . de : Idd I ?5 t P^fo 1) tup- et u<. Sniufiue ,»do dy profits of e detfomn gene related peptide in peripheral and brain tissues Peak-nee for multiplicity, J Phan-iiicoi Exp '1 her. 22 I ft I h- ”25 < 15>>S9); Dumont et ai., A potent and seieefo e CGE.P2 agontst, iCy \i ΓΟ?.~ ihi’GRp- eomp.inson in psotoiyp:e<b <'C»R fo ano I'GRPd 01 uh'o assay s„ t an I bTo stoi Phat inaCoI, ~ Go ”! - hi I oo~ μ
I he ¢. i SK Pi receptor subtype two found to he wnsuhe to me antagonist fomm-eth f'GKPifoG~) (Cuba et id , i'aieitomn geii..-i..iat.,d penude receptor antugonsst human ( GRhCG/1 \m. J Physio;,. de-OTEGI Ted? < S'dlhl Dennis ci al (l’>0(o; \fimeauit et al.
( -'snipd disc ufFiiilft·' ami OUgmud·. [sgcueics “1 wnwms fouwm e fo Uoma geue-ielPeO
2? penpda Imgmsufo on e-tDinsnm ^aoc-iekitec peptide rei.„ptois in ο.,υη did pestphesw J
Pharmacol b\p I het , dps- lOV-t. |pop sfoOjp p}\ eontr.isk the t <«RP> receptor v> us senMtfi·, to iincnr human CORP ihCGRIG analogs, in which thr cysteine residues at positions 2 and ” wete des oah/cd < z g w<ib acetoemmeinedpri |iA-< AGMo jo5 ebe Gmtde [Gy μ! G pom ( l IEP fceepio'· wa- oisci-ebye to huemem < GRP<S- i'i (Demo- et .0 (1 'foOs r}?.!Si,„( et al ; I mGp Dumont et al 11T5
I n-anei-pet d'selt'. of calcitonin feu.-ptor -aid cakitonut-hk·. teC',.ptor ί 'CE'\ < I R.”o.r “GPt H h depend on the <ο··..-\ press ion of members of a family of a.eessoty protein-, utifodfhe • cecpto? ubsu\ oiodus uig poum-;E \\1i\i i'<», RWIPfanidy ineSodes bnee pmypcpndes < R WIPE R WIPd and RAMP?s that act as receptor modulators four determine the ligand
2016244220 11 Oct 2016
Spcclficdy ofreceptors for the calmlooin Bmiiy members. RA'MPs are type ! fiansmemhrane proteins that share about 50% amino acid sequence idenety and a common predicted topoiogc. v nn short-g tophmnui, C~t rsitnt one truns-inmntnvine 4-'mrtfn ted large ,’srra-e!hf:af V termim nut art sespensihie for the smenkm {.Mel atehsc et al. {Nds) regular: the transport and iigand sp.-ct itchy >u the xMehonin-tveephiraihe rt'ccptor. Nature- 505-533 h‘<Fraser et ai, i I'h'iOj fbe aunno of:receptor aetivhy modifying proteins is a critical demrroi'htmt ofgiyeosylaiton state and lighnd binding of calcitonin rccoptordike mceptmy
Moleeuku Ph-umjcoiom,, 55 rtSM-lbf’U
Io room the CGRP tc-eepmt vas identified as a hetetodmaer compos-., ri of a novel 10 sued transo-ienthr me domam <ί-ο.-Λ\ο% ponet-· reeeptor aetuoy-iunhus eye pm-s-m 1 <R \MP1!. -aid CRLR (Mei -nelue u at. -amort f io^-lmkmg espettmenis se-gg-,sicd the ( tIRP ν\·'ρΌ! en?'srt\'d ol <j one-’-wme s---- h'emcmt coiupen cm m CR’ P --nd k \MP' (Ihiaeet et al .ikt 2%, 43132-421 'Rl t2m;1 tt, tn<tre teccm stu-hes nsme smetal rnethodoloeles such a-- BRh I md Bd f mvetded that the nmehomd CORP receptor complex:
1.5 nur- be composed of as\tumenu homo-obgomei off'RI R and nsonm-iei ot'RWIPl iHetonv et< JBG 2S2- eii<l0 MUD<200/'P . . . .·...... J.-\Z pntttiedi Ri R \-tettntnai Jotrsam ti<js been sheen to sne< du'nlh btnd ~ l-CGRP tCkuiih-tn et at. Bmeiierutsi>\ -bh \2 ;200>)b eonittrnmg the important and dtreet ntut'aetion bx’rtwet! the t Ή1 R. ouh CtdfP hg-md hi pt-m- -dar. 1 en 34 and 1 ,-u 3-1 oft Rl R uv bebexCd to eommiute the dm. I nm site of me * 'dermnms l-Tsc-M ot (f d\P {B-snenec m al BMC'
Pharmacol o I unhetmore, Roller et al. thEBS i „-n 531-4-% iph t?f?P2tj obtained evldems th d th.e th-. \-tem-uvil 1 b annuo seal iesidues off Rf R <. otriribiries the -.-. teem e intefaetton with CORP or adrenomedtillin. and inner e> td t Biochemistry 4 h ή f’ 5 ''54 t20tUp μ, λμλ, ;h tt ;he \~t os na- -- n- m - - 1 te-n- tea 3 B rat e+\ P1 R necncre assocfd.tioi wnh RAMPl.
stmt tme-iun-mm a nah sts of R '\\1R1 menttfied r-’->i,ines '* I 10 o nhteh ret relate Jo “helis 2 tSimths et al. Btophss .1 °1, 6h2 mm >2000}5, ι·- pot-antalR signukem ut sme-’ tetton uh CRI R- and r, ,nines Typ'd and Ph.3 as potenik-ib mierm. tmg m tih the f tIRP hgand in connection mth its lundmo to the < GRP re-eptoi eoutpiev 1 teand binding studies using a human r<u RAMP I Mumem suggest that the binding she im certain small utoks tde tt-iulmoi-< off i IkP R p. g BlBN40OoBS), is Ιο-, med u dl-os ,-. region e- Inch n-elud-'s ammo acids ho 10? W R RMPI < VtaPcc el-d JBC - U?ri+ t ;2<ff i20d?rt
CPI.R ha-. 55% ox-a-dl ammo acni -iCipteiice idetnt-s +h i 'PR- although the η'ηηχποηί1·οηί/ domains ate ahno-c 80% idemies! {Mei erttae -t al t pug»; Royuct et ai .
2016244220 11 Oct 2016 inteniuttnunl union of plmn-iutoiogy ΧΝΧΠ The mammalian oukiitcnin gcsic-fdatc-.l peptides. tidrcnomedudm, amyiin and calcitonin receptors, Pharmacol Rev;, 54:233-246 < 300.20.
CRLR,kss been shown to form a high affinity receptor tor CGRRfwhen associated with
RAM PL on to premrentiatly bind adrcnomcduiiin ebon associated with RAMR2 or RAMR3.
<M, i ii’biie ci id < !uOSi, Sestets et al, Pc.cpnn i:cts\<L modsiy un pn-tems. ( > ikd <
Signaling. B' 73-h3 LiOOi s. Conner es id , interaction ofc.dchoniri-gene-rehovd peptide with
Bn» ivtiHCd: SoeieO, isansueinu'S OVLtids 451-454 t20C2)) The y!y< ο*-\ t moss state of CRLR ss associated with As pharmacology R \MRs L 2 and 5 franspttfi GR.LR as the pksoiin sur'nbonie aids smut u etncieni tew howe' e? R AMP! presems ( Ri R r- <s nusmnally glyeusvlated, marine gccoptntem and a CGRR t.eeptoi whereas RaMRs2 and * psesent t Ri R >o ci imm-ftitre. tore civ- osy lined idw-non·. dtdiist recepics f'AM'M? AMRMn 'AM reeepuu ii'ras.u et-d i I ooo)} Cauru. ters/atson of the CR,! R, RAMP2 and CR.i R. R AMRA receptors In K0K293T ceils by mdioligand binding L'daidtenontcdohin ;is radioligands.
1.5 iunePems! w-sa·, <c W1P us';aMcm:>?>ii. <st Ιη-'η'Ιιοη-η ,·.! analysis < MA-puiym ty iar-uie get eAettophore'-i-O re\ eated them to be indistinguishable. esen though R \\iPs ? .mg 3 share one R,s''<. asniiiis aeM s.<i-s -n- c id. d'o .n at P’’s ,,s Phfierene·. - busa bo. n ob- \t, howescr nt the pitanmsconmv bn < Ri R c\po.wed wsth R.AMF 2 \er-us R W1R 5. slosh CORP and CGRVf-32 >.is well a\ ndrenssnu-diiihn and the adrenoincbulbii-derixed peptide AM
2(i 22-M. .ne nets'.< at the RAMI* 5 heteiOdimot, unhealing that this complex nm\ act as b-nh a
CGRPmse an AM sexeptor (Hon it: e> <d , Brush jons-nal of Pharmacology. <40:4 7-4X6 <200$) Mat’ <-t at. Ihpertens Res . 26 ,\>-SS i.2s5tM}) tM-espsessiot'. of human CPI R with rat RAV1RR ,utd Gee ser<a. -,uaccsied that tlx R \MR1 ^pcJcs dekrovned the ph.-esnuiOiogie u et'i caetei i ΟίΟ'. o''itse <'Ri R ΚλΑΗΜ sonspRw w tbt retro t tow\etal »r<i!
nssleetsle CGRP receptor antagonists u.-ted, (Maiice et <d , Receptor Actb sty -Modifying
Rnoem ί deles runi.-<- the <χ\ίοί, v. seem Py oi non-p -pttde < t sR.P r u'oto. <noa .yunos, j Tboi Πκ,ίή 2 A Ko I-Ifo i j epos <20O2v> I nL->s toeta„d odh a R \MR. ί Ri R t-no* known As bind any endoge-iots- ligand, it is ens?eody the indy <.<P< R thought to helms e tins way <( ο?!ϊί?«·<.ί id.. X hey iol>, tot towsmembstitu. ptolutes Its can nonin taeephu-hLe agonist binding and signaling: tmplLatksns (or ias-ruly R G-pmtcin-coupled receptors. Molec. Rhasrnaeol. 67(! ):20-M 62005 ss.
Calcitonin receptor <fT) has also been demonstrated to form itcterodimeric complexes w sin R, \MPw w inch are snown as ano- ini seceptor-1 \MA ',' ΆΜ V is.” or' \MX feseptot”) cenesalc, Ci RAMPi terepMss irefesred to as ΑΜΥΛ t<- ” XMY IM ha\e high afftntl·, tot
2016244220 11 Oct 2016 sahnun .dkitoniu, angiin ;·,ΐί»1 CgR? and tower aifhdu tot mammalia?i x'uieh\nnin- Ρινί I RAMIM ree/ptct’»MAMY>' or ΆΜΑ 2 '1 and Cl seieptotsr' ? 'or
WIN ?>, a \:il<i: p,ifte.n h man tpalb. xvSe'ted, dthenfoi foe jTni’.x fie ί GRP ;a (oweand n;o eot he Mgrufk-wu at plns-.olngieutk telex utt tkutid eotwenn stiou·» I he pteerO § raceme' phenotx pe is dependent on cell ΐ> pe and CI R sphee \ aram t ί Ί' ,v or < 1u.»), p e tseni u !\ for R AMR2-getteiuYO atn\ hn n capim \ I ot a\ enpfo, a |W repoiunmi ol ovieeek.o like ».eds repo'-mOR expressed RAMP2, ί TR. and ( RUG but not R \MP| or RAMP* HI g et a: (2UO4i, t GiAopo'dos et ul, Mmopk onx lm te» eptot ao\e tn-m seeepnn aettx its -m-'foG ine ptoixit! attamenett with foee-defoinnt iaeepnn een; pteOuct, Moiaentar
Phe m -,-, Mom ->o ?d t piOOi Mnfi et <d At4 anix-m tee» pA;r °\ «ex -uk'e ftdR'v, mg t.eLMijsieetion ofncMeslonin receptor oRb teccpior acOx ny rnoclilying proteins-! or --5,
Fndot t'tneiogy. MO 29?4~3’C’ f p-GOy 8»,.-χΐοη e? .-d. (2001); Lenthauscr et ah. Receptoraeio its-modikmg proi.xm I torms ItetetoduneH with two G-protem-eonpied iX'eeptois to define ligand recognition, Btoehont, A. Ah 1,34‘Άό1 (2000k Giakaratnv et al, Amylin receptor phenotypes derived frosn Itnotrnt eakitomn receptor, RAMP eo-espres-ion exhibit pharmacological difierenees dependent ott nxeptor isnfornt end ho.·»* eeU environment. J. Pirmnaeol L \p (her , 2Α)'·ο I ~~2 t ?000t; Mat- amma et ul , Os*eot ln-»t-hi,e >vds express taccpiot aeuxnx medifome protein 2 application of Mei capone rmciodisseettssn, L Moiee, f'ndneniiol.; 3 » ?J'M2bi 02002))
Table I, below, sunmiar kes the relafionskip of the receptor components dkevss: d above.
Table I
Receptor Component | CRLR (GL) | CT (cuteitooiri receptor) |
RAM Pl | CGRF receptor | AMA I receptor |
R.AMP2 | AMI receptor | A MA .2 receptor |
RAMP3 | AM2 receptor | A MAM receptor |
Therapemte use·» cd'CGRR atnugonists have been proposed. Noda et al described the Ά uu of ί GRP ot CCRP dia'i\atsxx‘- bn iohfoume pi -aulet aggregation and lot the ireatnixnt ot pre\cn-ton M attorn-sekreMs <>r thi'emt-osis, J'P OAMk Bi) I m et al xhseh-sed tharapentn. uuents that modtd.0,’ th* teftx nx oft' fR, mt lading \ ,-Mt le-eonjoe »*ad pepndes stt-en as eslettoum and b-tmuu of GRP (WOOi MUM M2,1 S 2fo)2 OOfoRMn A;) \ dsoaetjvc CGKP pentiik* antiigonkts ,m»i their ose tn u method tor inhibiting ί tdRP binding to k GRP tecepA'rx
2016244220 11 Oct 2016 n erst disclosed by Smith ct al , such C GRP peptide eikgvui.n· were shciy-u m inhibit CGRP binding to coronary mepy membranes and to relax capsaicin-treated pig coronary arteries. il'S Pat \o i’,.?o\V'4 111;'ahU I S Pai No 0,7'd' ?05 IP'» Pkuctal Cist loses! peptide analogs with CGRP receptor uutagomst ad-s tt\ and then use In a drug for treatment and
- pwh}'h'‘ a \< JCiy o* stoeU's'is lift 19 ’t?o' | ;
CtiRP is a potent wsodbutor ih-n lets hem- unpixah'd m die p-'dnntn s tri'a number of \asomotor symptoms, such all form-» of \ascnlar headache, including migtainas iwith or n nhote an-u asd ekr-tet Va-hi he Dnthatn. Y I'm I J Mu5, GO ί 07t-1 ti ’5„2004 Mimam; padiuphy siolom involves the autsaoon of the trigeminal yanghe, ohetx < GPP h
P,t hn ?h/ed <e\| t'GPP \eis siyisd'ic.e:t:\ e., n;ase dir mg a ntg.r one eta s fhfs m tun·, pto notes u.x u! blood \es,e dp.gion .aid nemos. „ sic it Oanruamin and <ns ncto'ou rDoods, G.. Cun. Opm hn.c.-mg Ditn.\\ .1 I de I -I ?OX p?00' tt I'mtlter, the setnin levels ol CORP in the rMesn d juguku vein ere ck-saicd tn p-nients dutetp ongtame headache GsvadOv et al,
Anri Xcurol dm I kb 1Ό0, bum'. ettotts administration of human ci-CGRP induced
I 5 itcade.be and nugom1'· r- paUsi '*> 'UOCicig buns nujf.uue s'.ui'Oul aria, simps'll mgthe \ ic's that (tIKK hasae;tus tine role m migraine tL<ts,->en ct .ft ί ephahdgia dd Si ><1 ?P0d
Migraine is a totnplex, cosuntitn neurological condition teat is characterized by severe, eptsothc attacks ei headaehs and associated matures, o Inch mm. include nausea, ssnintiue, ocnstte. ns lit bgle, sound ot nun extent In xo.ns’ paifersls the he.id.it he fs pun jden m aevompan co bs an -nt ’ u ncu.k,' e punt r.a\ be seme's and Tas j.ho x' .an. ,\„e'm certain p-dtetits. Migrants' attacks .ns' drituptne to dairi life, hi I. S ansi Wextern Europe, the o\ eta 11 ntesaleiu e -u migt^me '.miencxs i- IP' - of the neueial population «ο*’,, nudes. I s- ί kbf.-mat ot hut th/nnor.·, the toedi tn irequenc'. of macks m an uijo. idti ft o, t ? mount s\ hue there -ire a number of treatfuerrs .isudteds' to r.lisw >ax? o, i eslurs' symptoms, pres enltve therapy is recommended for thoxe patients has mg more th-.at 5-4 attack.'·; of migtaca; per month,
Goii'oby. et .P \ w I mJ j M d Cuxl) np' Some ms era me pa e< nx luxe e vu tic.stcsi y, uh topmumdc, ,.u .etiteoro uriant that Nocks vdiuge-slcpenocm sodmnt channels and - s'tnuu ghn.un.its' rixepiors « WIP-k-k.nn neb potentenes G Ml A-A isveptsn' n> 1 is tfy -uid blocks earbortic anhydrase, fhe relatively recent success of semtonnt 5iΠ-d ri IP anti or .511 Γ30 1 a receptor agentstx, such w sttmutripton, in some pariesix has led resesrehejx to propose a seriUsiUfint. -..itoiog\ os the dfsordci I 'ntbtmnuiGs, '.sink; smtv patients wspotal sscli to tins treumenr. svhets uv rehitisely ο,νΛηηη η> us s-ri vis itos-sbl.'r GRP insol',eincw m mimaius· bts l-cuu the basts foi tint des ciopment and Lsime of a numb;; 01 eompotaids that n'thtott >elease ni CORP (e g., sumatuptan}. aniagont/e
2016244220 23 Apr 2018 at the CGRP receptor (e.g., dipeptide derivative BIBN4096BS (Boehringer Ingelheim); CGRP(8-37)), or interact with one or more of receptor-associated proteins, such as, RAMP1. Brain, S. et al., Trends in Pharmacological Sciences 23:51-53, 2002. Alpha-2 adrenoceptor subtypes and adenosine Al receptors also control (inhibit) CGRP release and trigeminal 5 activation (Goadsby et al., Brain 125:1392- 401, 2002). On the other hand, treatment with compounds that exclusively inhibit neurogenic inflammation (e.g., tachykinin NKI receptor antagonists) or trigeminal activation (e.g., 5HT10 receptor agonists) appears to be relatively ineffective as acute treatments for migraine, leading some to question whether inhibiting release of CGRP is the basis of effective anti-migraine treatments. Arulmani et al., Eur. J. Pharmacol.
500:315-330,2004.
Although the precise pathophysiology of migraine is not yet well understood, the therapeutic use of CGRP antagonists and CGRP-targeting aptamers has been proposed for the treatment of migraine and other disorders. (E.g., Olesen et al., Calcitonin gene-related peptide receptor antagonist BIBN 4096 BS for the acute treatment of migraine, New Engl. J. Med., .5 350:1104-1110 (2004); Perspective: CGRP-receptor antagonists—a fresh approach to migraine,
New Engl. J. Med., 350:1075 (2004); Vater et al., Short bioactive Spiegelmers to migraineassociated calcitonin gene-related peptide rapidly identified by a novel approach: tailoredSELEX, Nuc. Acids Res., 31(21 el30):l-7 (2003); WO 96/03993). Further, a potent smallmolecule CGRP antagonist has been shown to relieve moderate-to-severe migraine attacks, including migraine pain and migraine-associated symptoms, in a recent Phase III clinical trial (Connor, et al. Efficacy and Safety of telcagepant (MK-0974), a Novel Oral CGRP Receptor Antagonist, for Acute Migraine Attacks. Poster, European Headache and Migraine Trust International Congress, London, England, September 2008).
CGRP may also be involved in chronic pain syndromes other than migraine. In rodents, 25 intrathecally delivered CGRP induces severe pain, and CGRP levels are enhanced in a number of pain models. In addition, CGRP antagonists partially block nociception in acute pancreatitis in rodents (Wick, et al., (2006) Surgery, Volume 139, Issue 2, Pages 197-201). Together, these observations imply that a potent and selective CGRP receptor antagonist can be an effective therapeutic for treatment of chronic pain, including migraine.
Any discussion of the prior art throughout the specification should in no way be considered as an admission that such prior art is widely known or forms part of common general knowledge in the field.
2016244220 23 Apr 2018
Unless the context clearly requires otherwise, throughout the description and the claims, the words “comprise”, “comprising”, and the like are to be construed in an inclusive sense as opposed to an exclusive or exhaustive sense; that is to say, in the sense of “including, but not limited to”.
SUMMARY
According to a first aspect, the invention provides a recombinant antibody that specifically binds to human calcitonin gene-related peptide (CGRP) receptor comprising a heavy chain and a light chain, wherein the antibody is isolated from a host cell that expresses a heavy chain nucleic acid comprising a sequence selected from SEQ ID NOs: 242-258 and a 0 light chain nucleic acid comprising a sequence selected from SEQ ID NOs: 224-241.
According to a second aspect, the invention provides a pharmaceutical composition comprising the antibody of the invention and a pharmaceutically acceptable excipient.
According to a third aspect, the invention provides use of the antibody of the invention in the manufacture of a medicament for treating a condition associated with CGRP receptor.5 mediated vasodilation or neurogenic inflammation in a patient in need thereof.
According to a fourth aspect, the invention provides a method for treating or preventing headache in a patient in need thereof comprising administering to the patient an effective amount of the antibody of the invention or the pharmaceutical composition of the invention.
According to a fifth aspect, the invention provides a method for treating or preventing 0 migraine in a patient in need thereof comprising administering to the patient an effective amount of the antibody of the invention or the pharmaceutical composition of the invention.
According to a sixth aspect, the invention provides a method of making an antibody that specifically binds to human CGRP receptor comprising:
culturing a host cell comprising a first nucleic acid encoding an antibody heavy chain 25 and a second nucleic acid encoding an antibody light chain under conditions that allow expression of the antibody heavy chain and antibody light chain, wherein the first nucleic acid comprises a nucleotide sequence selected from SEQ ID NOs: 242-258, and the second nucleic acid comprises a nucleotide sequence selected from SEQ ID NOs: 224-241; and isolating the antibody formed by the heavy and light chains from the host cell, wherein 30 the antibody specifically binds to the human CGRP receptor.
According to a seventh aspect, the invention provides an antibody when prepared according to the method of the invention.
7a
2016244220 23 Apr 2018
Isolated antibodies, antigen-binding fragments thereof and other isolated antigenbinding proteins that bind CGRP R, particularly primate CGRP R, e.g., human CGRP R, are described herein. Such isolated antigen-binding proteins may selectively inhibit primate CGRP R (as compared with primate AMI, AM2, CT or amylin receptors) and may bind both
7b
2016244220 11 Oct 2016 fise t, Rl R m 1 P VURi mnpme uk of ί GRP R The ί GRP R bmdmg p'viero-, v\ a-y toursd m nfr'idG. mic* lea v> oh,. ot roodeLoe at Rust one id the b'viogical responses telated ίο ί GRP R, and,as ,sf.ieh. are u.-chii fot myl i-sratme the effects of GGRR Roehiftei ο» bsordeis
Binding of certain amigen-bnidnig ρη items in CORP R caw there fi.ew have one o- more of the hallowing nofivlti.es; mhibifiog, isiterfertng wifib or modulating CORP R, ibhiblthig t a\odid;diof\ decscasutg ncurifgeiue l-dlarometiois, and afiex ititiifg, atneihfiatino, tienting, prex entfitg, or reducing sv mptomc of chronic pain nr migraine.
hr one exemplary aspect, the isolated iintigen-birtdini.’ proteins seleetiveis inhibit itHtnau ί gRV K\epU'j mscom \ucn -writ the nanon \M1, VG2o' as v b, weep hs some i 0 <, tnbodtmi nN, the isolated arstyon boidst-a; n?os ι-i .selecoseh mh<b'is fire Soiw CGRR Ό-,νρην ά uh a seieetw ratio of 50 or more, ?5 or more, i 00 or more, ί 50 or more, 200 or more, 250 or mom, 300 or more, fi0O o? more, filO or mn?e, 750 or snore os 1,000 or snore The begs ee sn M'leGov. muihinou way be determined using aw- suitable method, e g.. nsnnj a eA MP assay as described ηγ the Karoples herein in some embndimenis. the isolated nnugen binding protein
1.5 speeiisealb,· binds to both human CRLR and human RAMI*;, and doe* not speeibeall··, hind to human AM'. human AM2 or a humanamyhn wcepwr te g. AMY! -os AMY?), For example, die ·>ο, e'ed amseen Mp-i'm» pswmn mas sne<dn fix bi'd hum οι CGRP R v, th a R , f uM, ' 100 nM,i0 t’AL or - e nM In spin/ embodiments, the isofated anttg-ot binding. protein opeesh, ad·, binds to human t 'GRP R <\ nh a R,. ίΟΟηΜ, 10 nM, or 5 rVf 3« determined using a 1 ACS binding ;ts*ay and analyzed, for esan'ipie, using methods described in
R ithen.cm arm, cr td.. fiw· «οκΡι/; <n <.>' finy/;; My/ ή\ nuft c CowmuncirPiy?,» 55 I ^200.5) 101)4 ί 01 > in soim embodiment;- 4-,- isoiat·, d othgen binding psoiesis h is a !\i of'-100 η vb -10 n\l, >.i n.M, <0,5 nM or g0.1 nM m a CORP binding competition assay, in some ·, mKidimenrs, {'ne isolated aisOm n bmdsm- piots-*i has a ba of' 1 00 nM, '-Ml aM <-20 ΆΙ - ί 0 nM, '-1 nM, '-0 ;- >Λ1 t>< Ό 1 mM m a laibesitbeh ,1 !' bCGRP hindum competition ,<-,sa\ to mesid'ss'ies Oom , el is expressing human ί GRR R, for emntpM. the a^say described m Example 5 herein, hi another metrp! ro «cp.a t, the isol Ucd anoeen-bmd og ptofems compete tot bm-hm: to hnmcii'GRR R, e g , the e\tia,el!u'aj ootnmi 0Π GRP R. oUb ,1 tefesenee nnssbodv ?0 composing a heavy Unno v.uiub'.e region comprising a sequence ^Ucen.d from the gmcp eos-uMiing of S: <g Π * \(> Gh-lMt as«d a light >, hmn xatotbie teeion eiiU-nuxiag <. se.teenee selected from die group coonso-m of bi Q lit SO id ' led in some embodiments, bmdtng < ompentnm is a-sessed using,1 'swum-, .bvits, e e , -is-ng,a isieco.· .maRxis, fia exatopie, d'svieed’ Ivs'jo Mu cm n-on emood' ne'< -,, 0^ '-o an ,1 a!i>gea bind „ pnMc is
S
2016244220 11 Oct 2016
- ompete>, for Dudtnc g; human CtjPP R urh ,i rclNem antibody, the refc orc ar i’»i Is etmipteottg Pl ,t ueas? cbm· wid e o atou composing a sequaioe sePeied front t < ot.p ennsximg of Ss Q ID NCx ri<L Mu, ieb >inp g s ,md (u'> η 'nfu ih.mt xatia'Pc region vompristng -,-. 'xqueticc selected from the muup eonststntg efSLQ IP \Ps. HO, NN 146, NM and 150. In certain embodiments, the reference antibody comprises ( I; n heavy chain defined by a seCiiiencc sl.eit d from the group eonstDtmj of Μ,ρ H'S 52. N, >5, 5” ami dec and Ο·} a hght Cram defined by n seuuet'ec .-elected from the group eon^-eme of M Q ID NOc id, IS, 2;. 2t ,md 25 hi more -pectf'tc embodiments, die veiesence antibody ..ompttses a frmoy J'at a J ', haht r'am ,Liieee Ps o' >, oltx, ,oi'os\ tec pans ot « acve.-i s^MQIPNO >2 atm SF-'Q IO NO lit <Ε)5ΓρΐΡ\Ο 54 atm >dQ IP \D Ht no} SEQ IF) NP 35,mdSbQ IP NO 2I; iivi SEQ IP NO- r; and $fiQ m NQ; 25, and (ci SEQ IP NQ- 5U and SEP ID NO’ 35. in one such emiiodimenb die reference antibody comprises a hmo y einfitiefrotprising Sid'd iQ NO; 42 and a light chain comprising SLQ ID NQ· 15. fn another such embodiment, the reference ’nobody -< o-mpii^-s a he.e,\ chant comprising SEQ ID NO, 4 I md a tight chain <,? np'm p nt Q ID NO c la ,.ο η χ* . nbodtm ' t fit, tt 'etc < e a , ' \'s urop >' x hemy chain iompristni* SEQ if) NO' )5 and a light chain comprising SEQ IP NQ' 21, In aitoiher such embodiment, the reference antibody composes a hem y chain eomprisnig SEQ IP NO. 5 mid a Sight chain comprising SLQ ID V >' 25· In .mother such embodiment, the o.:t>,.'t'ence antthody composes ·, hems - bam -compt r-mg SEQ IF) NP Ni and a light chain £0 comp; rung SEQ IP NO 25, hi <.ertam embodiments the o.dated miigen omdmg proteins that compete tor bmdmg to hnt!a.m ( PS.P IS also sCectody mhibn the hnmtm ( uRP t'ceeptoi, c, n Uh , -.Mei tony t«tfo m 100 or more, 2?0 m more, 500 or more, -’>0 or more, 1,000 or more, 2,500 or more, 5,000 or mom or 10,000 or mote, and suelt selectivity may be determined, e.g., using a cAMP assay as described in the Exnmples herein. In related embodiments, the rsolnted attrigembirtdrn» proteins that -. ompete tor binding to hunt nt (.'GRP R specifically bind-· to item.nt t 'GRP R n uh a R;f I iiM. ? 100 AM, M0 n'4, i?t 25 n.\E e g., as determined using t; S ACS binding assay and analy md, lor evntipk', iishnz methods ucs,i ibcd m Rnthana^oam- et rim, is >,<>;> <?' ίΟή.-ί.’Ρ'Οί tri Gmifiimrii trimfio 544 (2005) 1004 1015. it; related, embodiments the
Isolated antigen binding proteins that gompete mr binding to human ('GRP R Ease a K'i of 100 uM. ' 10 nM, ' 1 nM ΌΑ nM or mt I ttM o; u I 'GRP binding cotupetnimt assay, em a radioiabeled Ί CGRP binding competition assay to membranes from ceils expressing human:
( (iSP R. to- example, the as.,-,y d, ph.-d m 1 \ampl· ΐ he’s.ut
2016244220 11 Oct 2016 hi an> oi the nboYe-numboned embodiments. the isolated antigen-binding piotem that compete-' for nnidose to immau ((u\P K m.o nc, lor example. λ monoclonal .mtfhotfr, a pob, clonal amibod). a rscominnato unnbody, <i human (e.g, fulls humtml anlihiKb. , a honsasd/ed atfobed'.', achimer-e anubtHly, a mtUii-'Specihc .embody. or an antigen buxhng hagmeifr tfereof
Fufrter, the antibody fiugment of the isolated tin dgsp-binding protein that competes for binding ♦o ;mm,m ( t sP P k <. be a I ,,P itagm.t t and' , f ioavueiit, a H lath '5 amen a fragment, n dtuhody or a stogie chai?· antibody moieeuki and may he, tor c.xuropk', a human ironoeka-ai annbotp,,c g,ar Igui- ig<ifo, Igiko* IgcO-ivpe mttfood'' hieera-n embodiments. the isolated antigen binding proteins that compete for binding to human CGRP R f0 uno >’'» neitfitill/tog antigen i’Uid'ng piofems
Inecfinn exemplar aspect- uk isolated antig-. u-bmdmg piofiuns deseiihcd. e.g .
isolated antibodies or fragments thereof, eorupffse (A) oho or more heavy Chain eompiemeutas » defi-rtommg regions ΜΊ )RHs} s.-iei. ted bom the gump consisting, of. 11) a ODRDI :u\lne Pfrfr \G'I a A t to a CUKH? laonm McO ID \O ke.iei M'DRBd
1.5 n, e« nig SI Q ID \D ISn. and option ok <0. t a CDRH oi 1 i), io'> and > tot th,U emu. uns one ot more atnmo aesd -mbMiaPous {.- g, eonsetvutoe m-nnd red ^n'wnotoenss, .lek-fion'i or insertions dee eoUeetlxeiy final no mote fran four ammo acids, (fr? one or mere hgln ebnm complementer·, determining teuton-' ί('DIG si -elected from die group consisting of, Ml a CDRI i selected front the group consisting of SFQ ID \'Osi07, 1 < I and i iS, idle CDRl 2
2b selected front the group consisting co SLQ Mfr, H)X t Id .md 11A uh 5 a CDRI.d selected from the group ettoskhPo of SbQ ID RD- 109, 11d and 1 .lb. and optionally (;O a { DRL of it), t o) <eid igiR tn P s'ontums eno-η naue,c g , one. one, three, font ot nmse, ammo utd supstituifitos (e.g , C’tosenabY,- ammo ac’d <tohsmitoomri, deletions or insertions that colleen·»elv total no mme than foni ammo ,u id< or U 1 one or more heasy cbain ( DRI I- of (Λ 5 and one or more baht chain CDRl.s of RDF
In some embodiments, the ί 'DRIIs further sekebed from Hie group ,om;ixrmg of {i t a CDRH 1 having SEQ IP M Me 1, tut a < DR 112 having SEQ ID NO-152; (iii > a CDRKe ti e.ino Si 0 IO \t t 1 frfr and «ptiou.dfr <s\ 5 a CDRH ot iil, tut and tg-o ih u concern on<- ot more, e.g . «re. two, three, four 01 muse amino acid substitutions (e.g . conservative amnio acid supsimuionsf deletions or m.-eraon.- that collectively toed no more than three amino acids. In ret bed embodnucnis, the ( DR I is ate fmdiet sekx ted bom the suoup <. ensislutg, id'ι i a CDR ill selected from rite group con-oame of frf-,0 ID \0- '0, 100. M!, Me and MS. id > a (DR.II2 selected funn the group i-oi-sisiim·. of SI O ID \D S'k (Of, M2. MB. Me. ;md M'h iin) a ί'DkDe selected itorn the g-'-mp consisting ot SbQ ID NO 'fo, 102, 123 I d'\ and
2016244220 11 Oct 2016
130; and riphonghy (ivja CDRH ef (i), In) Arid (iii) driri one Of more, &;g,s ooos hvo, ihtee, touror more amino aud soi>hitiuons (e ^,, eonscr,avoe annuo aesu -nbsmuhous), deL-non- or insettions fh.r. cobecnieiy \ί d ηυ owe than two -antne a· uh hi othc'· -iat,-d ctnbodtments, the (ORihs an.- mrthes -Ohek'd ftotsi du group eonsi-pjm of. (>5 't CDRHi .-><keri'd from dt,.- group eon-kdng of SI Q It) k<) \C Ό, N, s2, be, s\ ‘Y ’*'0 jud IdO; (ii) a (OBJ (2 sekeicd dous the group i-oh’^mine of SI'Q ii) V > “4, ~7, sc, S4, bo ho, ο), 005, !'!h, Id), and 1 ?0 hn} e (J5RH3 ->eiec’','d from die group eon-isring of si q ID \Q γ, Ab 3k S;u, s>7, o(s, :5u, qo, icc, 4.5((1 t2 ¢, ϊ5ι,| optionally ;ο) u f J)Ril of os. (ut and go) dari t onhmis OiK or ipoix, e.g., one, two, Ibree, font or more annuo aeul Mthsimmotts te,g, eou>Cf\ao\,.
<um o ,s d sub-anal ns, < < eat is t m on* m tob-ureR tu‘no no i iimmi m neidk ίη ,sotne embodiment v die CDR) ,s are ivi-her sek-, ten from die croup -. on,oMing of (A a Ci)Ri 1 selected Roni fee pomp . oii,st,s{:ngof SFQ il> kb Rt~, 11 i mnl 1 IY <b > u i'DRI 2 >ekct/d d'om dt. “tot p ^on-oama of si Q d> \(Y ,bY 1 i md i Cc (uC a f CRl * -ekered
IS port 0 i. porno - ossisiaig o' SFQ ID \t)s Y;d. Yard' and an; on dri {. s m, t DS i ol V\ in i and mil dun, -orsiauis one or more, e g , one, two. three, lour or more ammo add odOmnOn- ,e g , i on,>er\>iri\e enmo .a- -d suboatutiotts), J ’Chous m owe1 non- In \>ίί, eniboduneuh die annuo eetd -nb-tituuons uea , eon>enau\e annuo aesn vabommori-i, ,denotes or m-ernous colls ·- use!) to: a! no mon th m three ammo a, ids per CF)R? In some embodiments, th; ammo mud suksuuriiom-, deletions or m-eittop- collci.i!\el\ total no more than too aiinno aeulspc< CPRi . In rji*.-d emhodnruuK die ( OKI s .-re turthet -elected from dis' menu comm-emi. of «< i a ( DR! i seiei led horn die unrip ιοηχιΜνίί» oi'SFQ II) \d\ '<?, b, eke ', o?, <>q, |0J, and S 10. dC a (' DRI 2 seie-u-d from di, group eonostme of M-Q ΙΠ Nils 4b -~2, 55, 5S, e >, ”0, 10-4, ids Π4, fun a t,'l)pf4 sek'Ued homdmtjimp eoUMsung ol b( (,) H) k()s 44,4>5, ?o. 59, ;<4, lof, ,m,l I (ip, and opdonalh cm a < OKI co *i\ in; and (id; rime eonbmn; one m mor>-, e g , one, mo. three, four oi mors- annuo aesd othbimthons o-,n x,,.onsetsatn., ,-,ηηηο ueid suPsutulmns), deh-uons of insertions th„t >, ode» its eh ioinl no more dutn nso aimno ends <n odmnena! r>,; iUd emhoritmi ni-, rite (ORLs are burinm -eieeied wm rhe group consisting or ill u C'PRl· i ^elected from hie group
3d eonsktine ol bfQ H,> \O-, kb 45, is, 51, e I, ? of, of, um and mb t id a ( i)RL2 eelecmd from di-, gtotep eon^s-nug of Si Q sD \O- -4 b 4m 41), 52, 5s, (,p py ti,ys d
CPRI 3 ,sek\ m<?i fr mt the uronn ^om-tamig of SbQ ft) s,s,u 4r, i' p(„ ?], and ~2. i-ud ontiouady ;k 1 a CORL ol (th (if) and < hi) ritat contains one sir more, i. g , one, hoc, three, tour or mom ammo acid subsumdoms fe,g„ eotusersahve ammo ,u,'id Md-Mhuttons),
2016244220 11 Oct 2016 ilehmons m bi one en'bod.nsvm, the torn! number m «it.iiro <n td oubuuamsus dcLnons of ntserisons ss so more tUm two ammo -.w-cl· per < DK ns another emhodsment she sir?)' <i ae.'i MibsinuPetw tue os tcj > non subsManors
In nnntbnr embodiments the isolated atiiigcrt^htndmg protein comprises at least one or ? ΐν ο Ci3RII vt m> m the .:><·« < mantoned {Λt and as ien.si one or m0 f DK I of ,„n u? me dbos e-π-eu Ron cd «Β), in >ct anoiDn enModnmi'uh the odsded auttgen-bmdmg psomin compm-cs put leasi three CURB oDm\ m the ,>bo\e mentmned ίΛ). whefe she thive CDRiri melode CDRIB, a CDKIid and a t 'DRIi \ asu'I su) <a least risree CPRi oi mo of me showmentioned f IB, where th^ thus. ( DKI.s mclndc CPRi Kat DRi e and a ί DRJ d tn additional cmbodmb-Ms, she fsvDted am mm bmdmg prmen‘s dm on bed above comprise a Erst, ammo aud sequence eontprisinu as least one CDRJI and a sceottd amino acid sequence comprising at least one €DR I in one embodiment the first and the second amines acid seno- nt e- are . omieofo bonded So vaen οίην, fn anosiser aspect. she isolated antigen ·Κ<ηη<ηρ proiem inclades a CDRB I, a CDRB?
and a < DRIP In one embodiment. < DRIB usiapiio SI Q ID \O ’K CDRB2 compos.-s 'stp IBM) Ί and CDRIP eompro.es SK? ID\D /? 1st another ensbodur.ernP 'BkDI composes Si'Q IB M?~6, CDRi I? eomprrieo SI 0 IP NO 1? :mri CDRII3 totnpnscs SK) IB Ms,'R hs another emhodvnust, CBR IB cotunrtscs SK? ID \D'vo { ΠΚΒ2 comprises >BI ID \< f SO and t 'DEB? eompooes SR? ID SO KI In aasshm’ embodiment, CBR111 ..mnprries \i fit IB \O S2. CBRB2 commas K'V IB \D \?.mJ ( BRBa composes Si Q IB V1 ri* in moth'r embodiment, CURB; eosnprises SK? ID \O:S5,i 'BKH.? comprises SEQ IB \D D' and t DRI i'< eonmnsea Sl.sp IB \O K? in another embodiment, t'DRII ί comprise* SK? ID NO:bb, ( DKB? comprise·. Sh(? ID \s.)'v's CBRH5 eompr-sC'i SEQ IB \O 90, in another > mhodlmem. CBKIB eompnsesSKQ ID \D R,„ ( DRB2 <. ompmso.s Si t? ID \O 91 ami
1 PR IB composes sj i? IB \O p ie anothet em><>d-.ment. f DRIB tompsssv si Q IB
BQ'92, CDRB? t emprises SK? IB \D 93 and ('DRIB comperies SR? ID NO 9,. anofhv? embodiment, C DR s i i vOipo-es SIR? ID \O o, t '1 )RB2 vOifsprssc , SI Q ID M'« K· and CBR11? 1 vmpri<-ea SFQ ID \O'”K In atsorher emlforimfvrih t 'BRI i I t omprsse'·; SIR? IB \B ?* { DR1I2 eor.pifses s|,p ID RD - e,«| C'DRID cmnpo^s SfQ sp \p On in anothe?
embodsmes'it. CDRHI comprises SEQ ID N'O;97, (' DRM2 comprises SEQ IB MO:dR and <DRB ' eosnpusvs Si's? IB \< s no }n ^noshv; embodiment, ί DRi 11 comprises SK? IB \D IPO, CDRB? evnsnrt ,es SK? ID \D BB mM CBRBKomprm-, SbQ ID \ρ·|0?
in atsotbet <ipe-1, {he wdaied antigen-brno-ng pmtmu metud, - ,K DRJ I x,-,pj,-;!,e, a, ( DRJ J se.jiii.nce and a CPU! 3 sequence 1st one coal-eds-ncsst. t 'BRI t eomptsscs Si D ID
2016244220 11 Oct 2016
10:42, CDRi 2 comprises SEQ ID 10:43 and CDRI..3 comprises SEQ ID 10:44. In anoiiier emk'dhoem. IOKI I roiepi^.s* ?d Q IP SO 45 < OKI J vomptisc’- e>LQ IP \D 46 ..nJ { PRi 5 comprise* SEQ IP SO 47 In another embodiment. I DRI i comprise* SEQ IP SOPS, t'ppj 2 ct-mp-u-'Cs M Q ID SQ.4’> and I'PRI 4 tempu-<s si q ip SO,50 In ant’drcr ? ^mbocamcni, ( PR I I compose* SEQ ID SO el, < PRi 2 composes SI Q IP SO e2 md CPR.L I composes SEQ IP Sp.5! hs anoihe· embodiment, CPR.I I composes SEQ IO SOU I ODRE2 ^omprlax SEQ IP S’P;55 and C PRE,? comprises SEQ IP SO;>o In another embodtm.M, OPR! I composes Si Q pa \{> OPR’ 2 composes SI Q ID S(>-s -mJ t'ORi * compo-e* m-Q Ip SO -m |n mrolhet einbndfineaK I'PRI : sompi'^es SEQ IP i 0 SO o<), CPRI '* composes Si n IP SO '? and CORI 1 comprises 'si Q IP \O J'o in ,mp*her ernbodtrnem, CDRi.: comprises SEQ IP NOP*. CORI.2 comprises SEQ IP SO;6| ;md t DRI 4 tempos-.* SEQ IP S<) 4” in anoihet „mbii-hmenE I PR! : tempos * SRQ Ip SO;62, CPRL2 comprises SEQ IP SO:63 and CDRL3 comprises SEQ IP SO:64 in another embodimeiv, EPRi I compose-; SEQ IP 1O;65, EPEE.? comprises SEQ IP 10:55 md i 5 CDRS..5 comprises SEQ IP 10.56. in another embodiment, CORE': composes SEQ ID
SOs.o, f PR! ? vompuscs SEQ JO IO 0' ano ( PRi 3 comprise* SEQ R> SO t S in ancthm emboOm'h m. CDR i : conmr *e* Si Q IO SO O’h CORI 7 ·. mimosas Si Q H' SO 7<J md < 'PRi I comp: >-<* S!.O IP SO,' i in .mother cm bod mu.-nt < 'PRi i comprises SEQ IQ IO oR i PRi comp, xys sj 0 Ip \Q 0 ,mP CPF I ' composes si 17 IP IO 7 in another aspect, the l-mialed antieen-bindine, protein tncimR - a ( PR 1. i -icqncrtce a ( PRI 2 sequence. a CPIUe sequence, a CPROI sequence, a CDEH2 sequence and t CPRii? scipivnce In one emi'odinu.n-, CPRI I cmnp.r-ca SEQ IP SO 47, CORE2 comprises Si O IP ,10:13, (PRL3 compos M Q IP SO 1 1, CPRU I -, empn*-.-s SbQ IP St?- m ( pipf/ composes Si 0 ii/ SQ-74 ami i'PRii 1,oinpitscs SEQ iP SP 5 hi ,moC-ci et--bod·mem,
CPRLi comprises SEQ IP 10.45, CPRI 2 comprise-; SEQ IP 10.4*·, < PRI.3 comprises SEQ ip 141 4”, C OKI i i comprises SEQ IP 10:76, CORI 12. comprise* SEQ IP SO 7? mvi CDRII5 eornpns.-s SI,Q iP SO Ί in another embed-menu ( PRi I eotnptis„x Si 0 JP IO 45 t PRi 'f composes S{ q ip So : \ QpFf 4 e-mipm-mx Si Q IP SO %- CPRPI -„mtsp^*es Si O IP SO 70, < 'PRI !2 , otnpttses SEQ IDS?1 SO ,md t 'PRi I > eooipnses SI Q IP
St)-s i in another embodiment, I PRE I eotnprlec SEQ JP SIE51, E PRE2 comprise-; SEQ IO SO -7,1'PR! t composes s| Q ip S(» O, CPRH i eompttsc* SEQ IP St) s2, i'PRii 2 comprises SEQ IP SQS? ( PRH5 comprises $EQ IP 1O;S4, in -mother embodiment, ('PRi I eompuscs SEQ IP So Χ < DRi 2 eompt-ses SEQ IP So 55, < PR I ) composes SEQ IP 10:56, OPRIi; tompri^s SEQ IP sn;s?, i'0Kii2 comprises IRQ iP SO.ht- and
2016244220 11 Oct 2016
CDE'IP < o'n’hes hEf) IP \O h Ir armhet er bo I rem t DR! 1 - o'np' w. χ Nf 0 ID NO 3Έ ( Dki 2 compost SEQ) h> NO c\ ( Dk! 3 compiles Si Q ID NO 3Q < DRDI comp'iscs hi Q ID NO,OQ QDRD? >t>mpn<es SI.Q ID NO so mU CDRII ) totnptt.se» SEQ ID NO.Or In innthvt emhodsmenkCQRi I ct-mptiscs M Q ID NO.tdb I'DRi.2 comprises ShQ § ID NO,55, < DRI 3 comprises SEQ) ID NO,5b, (. DRHI comprises SEQ ID NO a?, CDRU? consprices hf.Q ID NO X6 amt t'DRi 13 i ompttxc» SEQ ID NO--S7. In another embodiment, EDRLI i<sn5pri>ei SEQ) R) NO ±N EOR1 ? comprises SEQ ID NO h), CDR.L3 composes Si Q ID NOs 4 < DRIU composes SI Q ID NO >, <d)RH2 >.empitsex SEQ ID NO.Si and 03RII3 comprises SI. Q ID NO. 7s. ht a nether embodimeng CDEL I comprises SEQ ID
Nt? o t'DRi ~f composes SI Q ID NO bQ CDS! 3 composes SI Q If) NO eh CDRH!
et-mpo'Cs si Q ID NOON < 'DR! 12 eotnnttses Si Q ID \< ) 93 ,md ί I >kl I? eontposes hkQ) SO NO 94 In aroti'et emtiodotsem t DRI I - om|h sc-'SEQ ID NO 45, ί OR! compos·. SEQ) IO NO ok <'!)Ri t composes M Q ID NO 4 ODRID iompt:»m> SEQ ID Nt) e, CDKil? vomp ,s„s Si Q ID NQ 4s ί DR.H3 ost uises hi Q ID NO '3 is 5 tomes ermoetrter ,
CDRL I comprises SEQ ID NO e5, < PR! 2 eosttposes SEQ sD Nt) 55, < DRI t composes st*) ID NE) m, t DEH' mwas.o SEQ ID NO N? f DRIt certm se* StQ ID No St and ί DRU3 comprises SEQ IDNOS in mother embodiment, Q'DR.i 1 composes NI Q ID NO:42, < DRI 2 compiles Si Q ID NO I k < 'DRI * composes Si.Q ID NO 44, < 'DRt 11 corn prises SEQ) ID NOD3< EDRIli comprises SEQ ID NO. 74 and ί DRIB composes Sf Q ID
Nt) 9<< Ju anolbet -. mbodirrent ( DRi I eompttsv.'i SEQ ID VI't-fg ( DRI 2 composes SEQ) ID NO:07. E'DRl.3 comprises SEQ ID NQQS, CDRH I comprises SEQ) ID NO.9 .\ CORED eo up s, - Si Q) ID NO C are ( Ο ' 11 > un mi ο \! O ID NO Ό ie , an, t erO 'c ra i' CDRU comprises SEQ ID NO :O3. CDRL2 comprises SEE) ID NO:70. CDR.L3 comprises SEQ ID NOOk CDRII! comprises SEQ) ID NOIOO, CDREI2 eompttses SEQ) ID ΝΟ.Ι0! and
CORED comprises Si-.Q) ID NOJ02, In another embodiment CDREI comprises M'Q ID NO m> ) DR! ' - omprm.-s SEq) ID NO ”0, { OR! 3 vemposm SEQ) ID NO QQ i DRiil composes Si.Q) ID Nt4 ICO. CDK.II2 comprises hi O ID NO IE I and ( DRIB emppp-es M Q ID NO J 02.
Io ary et rife .vtose-mmmoned seemeree-Ietmcd embodiments ti.e isol.hed .mhgeu?0 boding pfot -m n\e. be. fo>' c\ rapO, a mom-Oonai tnnbed\. a pvRclonQ ant (hub,., tecmnbmam anmmd\, a human tc >' - Ebb, heist -at) amibody, a numam/ed emloeR. a ehm.cttc antibodyΛ d mnlti-speeifte imtibedv,: or an antigen binding fragnteni ifereo E Further,, tite antibody lOgmem of-he Isolated anngen-hmihttg proteins may be a Eat' Impttient. and Fab' harmeng an
Dab') tiagcncm. sr I s fragment, a mabcDy,, o;- tt single sham antibody mo'- ^.tttc Eos csnmpk.
2016244220 11 Oct 2016 the isolated antigen binding pwtoM wy he a hnfoan. momefoMl Wfoedy, and wy be, e,g„ an LTG.-.foGd Igid o; foG-Gupcarnlodv Itnthcf tic j'.okncJ,mtsecttbsedetg pnvtosnx nun be i',\itf UiaUtg uniig'··, bifi I ' _ protemx hi any of the above-mentioned sequence-defined enthodiotonis, the isolated mfogem ? binding protein may xpveitica! b bind ;o both human t 'P ϊ p and human K -VIP i tnd no?
specifically bind; to AMI.» .AM2 or a human amylin receptor feg., AMYl), for example, foe ir-oLccd «tumen binding proton; mat speeificalfo fond to human CORP P with a R-. <1 μΜ - 100 ii'vf,' ίΟ uM, -a 5 n\b c g , ax deb.rmmea axing =¾ 1 AC'S hmdmg axon and jm'dy.'ed, for emmpk, iwnu method's dcxertbcd nt Rathamiswusm, »/ a;. fom /u-nfo to and ,Rfo/'Aefo<. a;
fo *.< >·,*'· h / ,;a;;?' , 3)4 jfosOx) 100 I i01 ? fo any ol foe abto e-mcmmmm xcqucncedelfoed enPu\no;tiitx, th; «’av d untieen-Omdum emu-m max ^'eetixeit njiabuhurmm t'Cd<R Rmexii't- io the banian the Λ\t R A\P oi ,Wfo m-, <cp?o”'% yuv’b χΆ grub iatio-u lOfi ot mow, tof-m ujote, ^00 m mote, 750 oi nm<\ 1,000 os f tme, dtooo u. mme, fooOUm mmeot hhOOv of more, where the degree ;o mietoo -. inhibition may be deknohvd uxmg am xinnfole method, e.g,, using a cAMP assay m described in foe Examples herein, in any of the abovementioned sequence’defined embodiments, foe Isolated antigen’binding: protein .may have a Ki Os'- :00 n\h '' 10 «Μ ·-1 too, --{t x n\1 m - p I n\t m ,·, t \ dxP bind' \t - empetmon ax\«x e e , in a radiolabeled 1 bCGRP binding competition asxas to memtoanex from cells expressing hiuu m t 'GRP R. e g , foe uxxax ties, obed m bfonmpto 5 hewm
Another set of embodiment Includes isolated antigen-binding proteins that include one or a combination of GDlfo having the concensus sequent, es described below, and optionally, bind human CgRP P. The eonxenxn- -epneneex are fieri’, ed boot phylogeueficifoy .dated CDR sequences In one asp-.-ei, the CDR.S from the \ arious groups may be mixed and matched n- an> r nto'ul a isolated anum n-to.i-ifug prmem dsn? lands fonn -,u CGRP R to uuomu aspect, foe anti gen binding pro?sin comprises heavy end ii gbt chai n C Dfos that are derived fiem lb-. same pie, log, n- m'-Ufo-tel dee: gomp ofanbhod, clone,·, F\ -mpbn\> CDR em'x, nxux sequences arc as follows;:
KI Consensus
consisting of N and K.
CPH-C XiASSLQS (SEQ ID NO; 1041 wherein Xh ix selected from the group eornaxu ng of A and G.
GDR > I QY\X,\d’\\ I toi Q ID NO ifofo whefem X ix x, leeb'c: oom fo,· group emeaxtato fo I ana N, and X- <x .selectcd bom the mono conxkxung of Y and Γ
2016244220 11 Oct 2016 k 4 ConsetiMts
CDR? vNM XtK (M Q ID NO tOoh whc-eut Xt ts sjceiesl Oom the etonp eonsfskns, of S ait 1 O χΧΜαχχχμχ
CDR J RASQX; X>X5X4GX5LX6 (SEQ 1D NO: I07), wherein X, is selected from the consistin', o! > attd 4 ί λ, 's seitu ted from the group lOteMsati? of V end X i ts seict led, hem the gfet p ee-f'stsinm of \ and 1C \? 0 sc'eek-d feo.n rite gtoitp x N1 d k,
X. ts sutee''?O :50m iri? annin consisting ο: X and O, mri X<« 'deen/d nets· the group consisting of T and CO
SO CDR? N,-XSSN;X \i tSf Q if) NOriOX). \shesefii Μ ts sele-efed from the group
Cftkistmc >ri G and V λ' is sele-etcd ftom the eOiei ^oiiMsuug of R uttd I, Y ts v ieeted tioni rite eroup eenvointa <0 and Q, and X\ is seie lee horn the group -, insisting of T md S t OR ) \ QX X X X C\, X- ιΜ O ID NO 0’’}, 'M'esesu X, is s?ie-..t?e ho n t’t? -ίό vor-sisotig of th and I, X, is scketed from rite yroup eensMmg of is and Ν. X, D syleekd from
1.5 thi.· group consisting of X and Ί\ X.? is selected from die ejoup consisting of S. 5' and E. X- is selected Pont the croup consisting Y L and P. Ne f? selected from the group -.ousistmg of C, W and M and X · is selected from rite group consisting ot R and 1'
K? Consensus
CDR i RSNQX1 I CSX g»X X \ ΐ Y XI if) NO i 10i, wherein X, is selecfed ikon the group consisting ot D and Λ. X. is selected front the group consisting of R and R, and X is seWeri non' he utoap - om-isot'eoh X arm 1
XXxCftriMllOiik
CDRi X SsOM i CSS (ΆΛ,ΥΙ \s<M D IO \n 11 ;< wherem X. ?-> ->ekekd from da gtoap consts^m; ol R and K, \s js selected riotn Ute gtotm .ouMshtn; oM\ i> and \ X is
2> seXkted hum the utenp tons s'jgg of h , R and K Xt ts sel ,< tec lo-m the otetet i.on-'isuug of N and T, and X-· ts s>-lock'd iron- the group consisting ot D and 5 ,
C'i'tRd X .X SXRXds >SI.Q ID XO;1 ids wherein ,X 15 sOcetcd horn rite gtoup -.oiistsliuie ot I and IX X- ?s selected from die group consisting ot G and S' -utd X? is seieeted h-u-i the oinup < onstsPng 0; \ and i
CDR? MQXXXX .XJ-’X 1 tSEQ ID NO'I EG. >λ herein X= is selected from the uroup eousispng of \ and S, Nw is selc-, fed ftotn the g-oop ufhstskhg ot 1 and 1, Xo\ selected Pont the reoup eottstsfthgoi D end h\ \, is sck-eted from the e oup eonsuemg of 1 are t, -tud X f-> sen I'ted from tits' group i-oustdnu· off and 1
2016244220 11 Oct 2016
CDR? RX X'QRf’S s$f Q ID \O'l i D, Ync’em X s>, 'eeted anni she g<oup conststuvc of \ iind S, .isi 1.2.3 Consensus
C D!\ ΎΑΑΙλΑ\\\ \ <M sd ID XO 115s. mlues X m Aecxd Oom'h„ group consist ing of X and S. X = is selected from the group consi si istg of Y and T. and X«ss selected fro η; she group consisting of S, X and Y.
CUB? X;XA\d<RS \SK> ID \Q ! to), wherent X isselected from srhe group eon Ahne of D. T and R, X; is selected from she group consisting of X and X, and X: is selected from the group consisting of K and Q.
CDR3 ΧΛ,Χ.ΟΧ.ΥΙ ΧΛό\ <SKQ ID \'O ;Q, whemm X ,s sebeted from she group consisting os <; and A. X' ;s selected frooi she comp consisting of I and \. X< is selected from she group consisting of W and R. X, »s sole» fed from the group consisting of § and D. X-1·---. seemd itom the g'oup consisting of R. and A Xc <s selected from she gtoten i,o'->h-smg of X and Y .md X w selected she croup .,vi«.immg m' \ .me 1’
LsiAll. .< ΪΙίΜϋ Lb.
C'DRl XY.X .ΧΑ.ΧΆΑΑΑλΥ'ιΛ AhQ ID XAlIXf Ynerem Y is sefrued t'rem fh. gietm consumm; os X mid Q X > i\ ntesem or «bssut, and o p’, «.mt, n. S,\. i\ A -· ted from she gteup von-'fstmg of b and D. ,\.t is prcs/nt or aYem, and is present, ο Y ,Y e.
>e s te 1 so ο A gio ep son* ·, ι γ I I X s st le , d to n m, gr> , « υ <\t\ta , o G and R, X- is selected front the gtoup eon-ustsug of X and 0. As is selected freun the g>oup consisting of X , Ά I-, X< is sehxted front toe group consisting of Y and 1, \Y is selwied front she ‘’simp rosevsSutg m V end A, and Y is setceted hosts the <ponp eu'tsisfuig os S. X and \
CDR2 XA \\ RPx AfQ ID XO.i 19\ oh.-tvtn \ m .e-ecud from dm gro'up sonstsf mg of 1 h U\ 1, and R, X '-elected from the ίΡ'οΐη> consisting of X, |< and S, and X' m selected front the group consisting of K, X and Q t DR 1 \< X X u'JX X X X \Ac\ Al Q ID \O i ?0t, obeoun X, v leered from the at'pHp vOif-ostn^of td, x and A, X' is selected Iron· the gsmap•.eftststmgnf L S and Λ, X's,A< i ts'd frtfm the grs>op ς onAsmg v1' V< and R X-, h s ’Deled hot'·» the euoep eons’O'ng οί X and D. X< is ses>, >, fed fouti the csonp eot's-seng ol R >utd S. X. ss selected from the motsp consisting of 1 and V X is selected irom the group consXftng ol $ Y and X, Xs n·» selected irons ιΐυ.. etotep consfTint. of 11 anti G, .aid \> ss Aeeted from the gtoup eonsssfing of \ astd L.
2016244220 11 Oct 2016 •KH onsenst.-v
(.'Dili X A ) MX (Si Q ii> \O; 121 5, Mierem X n <t<Jce*.ed trout iiu group consisting of (ί ,tnd D X selected oom die provr consisting-ο D and X
GDR2 Vf IXCPNSGGΊΧΎ XQki O I (SEQ ID \< J ί22k uadcut λ o selected kom the group consisting of N and S,
CDR ( X XAiXX.iXsXAAdiXAsX .Χ,ΛΥΧι-GMDY iSEQ ID \G 12 b. M.etetn
X, is seleiece *ί,·*ϋ the group io/isisitegef D and c, X .select'd from fin; group eon<!sfmg of Q and ¢.=, X-, ts si.deetcd uotn fisc gump consisting oi \1 and 3'. X is seEcted finm the mump eonststtog of i and tE X = ts sekmcd from the go-up consisting of I and 5 . X-, ;s selected itom the pcoup eonsisiun; oi'M and A„ X - is p'csetn or ahs-, to. and a pres-.-nf, o; I , ΧΛ is present or absent. .mJ ii psesent. is K. X> ts setcGed Pont ike cmnp consisting <Ί Y acd i X > is seiccled beto f gietm cema-auiu o'1'etd 5\ X s se'eecd uni' ise so o ^nnsisure -' Γ end n \ is s,'ie=. ied bent ike gtonp consisting ofP and IE and X m present ot absent. and d present, s·Y.
HC2 Con a£ffi>.«S
CDR2 RIKSXiWOGTlWXsAFVKG (SEQ ID NO J 24). wherein X= Is selected from tn gietm eoess-dun; of K mid Γ. and X - is sole- md from ike pump consisting m Ϊ e>-i A ('DR ; X \ X MX-1Si 0 ID \0·I 25). mhe'em X ι,-> λ':ιί ied from the group consisting oi I and >, \; =s sJeGed horn the uouip consisting of S sold Λ, and Xi is selected Isom the group consisting of X aid S ( DR2 XdSX S\AA.xX<XV\nSYMsi,SlQ ID XO 12m. »|=. icm \, is sale, lea from toe group vou-astoig o?S and .A, X- is sck\f.;d from fh; group vonsDnog of s and G, Xi ΐ- selected ftotti tin. gtonp eonosium of E and G. X ι ts selected ftont ike gump consisting os S and G, Xs ;s selected from ike pump consisting of 5' ur=d R. and X,. is selected finnt the group et m s ΐ -a m u o f R and F.
( DRe X ,X ΧΛΛ-,Χ,Λ ID SXA.W A DYk A n\iD\ 0d Q ID XO 12 A uiuient ,X o s d.-ei. d beta t ,c g=et p emmi-aim: oft' .out D X 's -< .ceied i om fhc p'oap c-msu^ngoi G and Q. Xi :s sei<, >. ted bom tbs' pomp consisimg oi \ m=d R, X) is selected ttotn ike pomp
Y) eoosDttrie of x mid h, X- R selected Ifopt the pump consisting ni G .md V. X\, is selected from the mump consisting oi S ami ( ο X- pre-euf m absent, ind if picsem. is 0, \s is udeefed t-'Otn the gfoap consisting e-i I and X. and \Y ts selected front tkc- croup > otiststnig of $ and G
2016244220 11 Oct 2016 iH 4 CoU\>,'SiVUV
CDR i oXxDdit (Xi-.Q ID SOU28+ whcrohi Xt is selected Ir«m rise group con.vsstsng off and Y
C DR2 s ISX 1X.SX t\X \ \,D5\ ku Qo Q ID XD !»,, oskmei \ - -e-.ckd Peso 5 the group crntMidoig oi F jrd X , \ iv voR-oscd iron': die croup coumvoug ofI and H, X ? i.v .veketed iron! the groop conv;vtr;:g of S and ) , and Xf iv veiei led hotst she r soup couMkong ol
V and A .
( DR i \d?,\ SAA.VSXAsYVXA/A.tVVtiXA. VrSlQIDXn IP5), okmm A- h vdeekd from the group eon.vsvtsng <0 D and I, \> sv selected Pom inc group cou.vsvisne of
Η) I and K, X; sv veXvted ifom she group convivsisig of X and R. \5 P M’leen'd from the group eei'envisng oi ) .usd V X. so selected i'sesi'i the group eorr-'rs-trsrg of X and 1. X,. 0 veieeted iron's ho iposip KOS'^ot.np <d D οήΙ \R X ‘elect d feus d>. group coavsemo off ,-oD T, \„ vciocied nous the group certvisting oi A and I . X iv video* cd nous Use gsenp eun.vsvtsng <0 11 end Xf \ ., is present or shvens usd tf prewni s.v X , X . ;a ^oh-otol fmm rise troop const-mug ! 5 ok and 1 , \ \ v ,.(.e! ’an the gsuap 1 ou1- v,u g o* \1 a d ϊ -\d X '*> se ecu J i on *hi gkk p eiS’sesisng 0' \ and I)
ΠCA Cpf Sveness
GDR: λ ,\ \ΛΙ\4 Al 0 ID XD ik p oisorous X· 0 sclented hunt the mung ; osenvfng of X; :usd S, X,· G selected from the grono consh-tissp of A, V and f, X. us .selected fit P-η s fc ?e? vonvisiusg 01 0. \ . ud t1 ; td X ,-^cet.d : otr*h. s’joap conoer u oi \ and H.
t DR3 λΑ\Λ,ΥΑΛ((ΛΛΛΑ<< .Xr\>.\.A MDSFQ ID XD 1 kf>, sksesvin X; ss selected from the group xOtsviMsng <f if A usd X. X - sv v decree from the group utuviviing of k. S and A , is udecteu from rio. gsos.p coneMing of S, <»„ l· and Xf X>, -s prevent os aK.nt and p’ornsesri sv vJcekd tro*n irk green omvivisnu nt k asni I X sv p*es.nt or absent, and if psosetst, iv T, \, 0 veki ted from the group consG trsu; oi D and X. X- o;
-.ideekd frosts dtv group convsvtsno ol'G and 5. X. tv vckued front the group vostvseung ot I, if I. X usd ii, X.' iv vole- sed irons she vsvnp coavivisugin I usd k, Xtl iv voiee’ed η-,on she sroup unoavUng of D insd Y, X> w .vek\ ted Aom Use vrunr ^osjsjvtissp of Y and S, X- e- -Deeh'J frosts tlx group e-'O.vkrisse of 5. Λ and ) x X -; ;.v .veiciiod t'rotsi sise croup ^ostMMtssg of ?\ and D.
tsssd Xf, 0 veketed fiort: the group ronuevUsb- el P assd S f DRo X X ΧΛΛ \\X XvXiXs X \ Λ X Λ, X X <AtvX .S Dd Q ID XD 1 ' I), ef ivi'i in \ w sob , ted door tise esos-p ,.ors-s.vtrs.i.· o*'D, \ at.d I. .X' -v veieeted nonthe group cors^'ditsg oi R. D and X' n. voicered irons t,he gsoup consisting of I. R. I.. G end
2016244220 11 Oct 2016
K, X;. ts si-Iecied ίίΌΠϊ the gutup eonsisiiogiif G, u X, t and R, X- is selected icotn rhe gs oup cottsisinvc ni \ V and ,X, ?<. $s selected trosn th-„ gtoup consisting of x, G. X , Λ and L X- is selected font the gtinip consisting nl I, P. D, ,X and M, \s n; pt'cssie of absent, and if pn\->enf, is horn die ^;enp eonsisSine of X and X , X a present os J'scnt. and d present, is .selected trcun the group consisting of W, S and T. Xi, >-. selected front the group xonsisring of 5, t I u’ul (,. \(f i\ selected horn the rump ciuisisung of S. G, L >ntd 5 , X·; is ptcscufi os absent, use! if present, ts selected from the croup ct>usistntg of U md VS ·, sek\ ted non· she croup consisting of S' .usd I (, X·'s present of absent, and s’ present, is selected ftom th·, gtenp cor ma in. of X and IX \ ' -> .deehd 'tort' (;; ert\ p eonsistipj. of Y. k ,n d k \ is p% .sent
Η) «η- absent, end it'present, η· Y, X,- is present or absem, and if present, κ S', \t? is se(c>. ted front the group eonOstirsp of SI .utd I., and X,. is selected front the group consisting ol I) and Λ
HGIX Consensus
COR I iSFQ ID \O I U), u heteui XX is selected dost· the gtonp eo'-.tstntg of X, G, f λ > tod Λ. X- is svieekd Com the group consisting of X b ansi X, X, ts ! 5 selected Con: the gtoup ; ous-stnut ot XX. XX X and G. Xj ts selected fsont the co-tip consisting of M and k. tied V ts selected from the croup ..onststrng of S and H.
C(XR? XXX X ΧΛΛΛΥΧΛ,ΛΧΧιΛΛ,,Χ, Χ,Λ.Ό |Xi 0 ID XD'B5b vritetesn X, is selected dostt the gtonp consisting cd (k \\, Λ, X. >< mid i. X.· ts selected (font the gmup consisting of'K, X, X, XX and Is, \ fs selected from the group censtsung of S. P, G F
2Θ and X , X, ;s present or ab*. ut, and if preset?. o, selected front the gto-jp consisting of k, ( amt R X- is pies.-et '<' absent, vxl d'picsenh \s »elee>?d troir1 the group eonsoee of I and Y \, ts selected horn the -enmp ·. {insisting of Π, X, IL S end X , X- c-· -elret'..d from the gtonp consisting of tl and X Xs ts selected front the groen constating of G and $, V ts selected trotn tht g.oup consisting of I, C, P, I X, If and X', X-, -s set·, etc·! froo- the group eon'ustuig of I.
X, P. and P, X is selected bout tltc group const-ding of IX X, X and k, ,\r >s selected feeto the group consisting of Y and X X, is '-sleeted non- the gtoap consisting i?i'T, X and X , Y,} is sc'eet.d it out -'h. group eonsisttov of C and Ο, Xj · ts selected item the vjenp con ostmc of P, k and S, X{, is scks-'.si t'rotn tus- group xOnsisUnc of V and I-, utd \ is sclet fed from the gsoup Consisting <n k anti G
CGPX X;X \/XAXS\\ ΧΛΛ,. X· \.?X{ X -WGW Λ^Υ tSb\) ID XG ' >to, oiler·, tn X. cs sci·, cted lumt the group ions'suug o( D, ii, Ά and 1.. XX is selecied horn the group ..ouetsrhtgof R, G utd D- 5 !> selected from the group ..ouGsiutg o' L Μ, XX Ik I, G ai-cl k, X is scl>, i led fnun the tyonp consisting ¢-1 G. S, I', X, I ancl P., X i- selected i'toiu the group cratsisiutg m· Y, I, G, \ and X, ,\, selected front 'he moup consisting of V (, X , < i, \
2016244220 11 Oct 2016 and T, X - is selected from the group ·. (.mstsuog of 1, M. A. P and D. Ax is present or ul-sem, and it piesent is sel- sted from tac croup eottsjstnty o*S, L and Y, ,\ is puscnt 01 +%¾ mid ifprcsem, is selected firom toe group eonsisiint: of W, R, S and 3', X.,. A seter tod from the mo'W vOU'isin ~οΌ<! n,e.> \ o^cr.djoir'bufAi'Crtii'i'ODi.ciW ; i»md\, ? \, n pre-,cut or -tbsent, md if present is selected from the group gon-dstmg ο* F, Y and \\..
X,! -5 selected fron, the gioup consisting of Y, P, S and t I, X; 1 is tncsem m absent. and if present us selected from the croup -.00515000 of kl'-P o,d ii, X'o 15 scle-ted from fine crouo eon«κίιιΐ^ of λ , k and L X (. i5 'ptesem et absent. and d ptescnt, is 3 , X- <5 pieseni ot absent, and d present, is X' and X- , 55 seieued from die group consistingof M and I
H) fr: any ol the ai«n e-menuoned - omseusus sequence defined embodiments, die isoiamd wuigen~bmd.mg protein may he, thr example, an AVIMER puiy nemide, a .monoclbnaf antibody, a polyclonal antibody, a r.’tomburae annhods, λ b-im.ei <'e g did} human) -aeiKsiv a liumani/ed anodofo, a chimeric antibody, a muSo-speeiOv antibod}, or an antigen binding fragment thereof further. the antibody fragment of die isolmed antigen-binding proteins mm be i 5 <i Fab fragment. mid lab fragment, ,01 i\ah'b fiagenenb an f s fragment. a dntbods. or a smele chain antibody wolenule. For example, the isolated antigen binding pndein.tray he a human mppoeional apbbody, and way he, e,g,, an IgG I~, Ig<32-, IgGah or IgGddypo antibody, Further, the tsobted ectig.-n 'rnndme ptet.-ms mm, tv nentr.diztngantigen bindene protems, b ,n \ » h, ,bin e-e enoo ee 0 ->es si,-,-v p em nel ne L m ioa menu m mo a(e 1 nufrgon-bindipg protein may speeifrealiy 'bind to both human CRLR and human RAMbl and not spemfie.di} bind to \ \1 I, AM? or ,, human im\ im receptortc g, \\IY 11, m example, ’he isolated aniio-ii bu«tnnj psoiein max specifualK bind m human ( td?P R ο oh -, Km SI μΜ, <i00 nM, pi 0 nM, or <5 nM. e.g., na determined using a f At \\ binding as.-my and analyzed, for example. using methods described in Rathanasuami, < ten , oka A 7^/00/.-07// ZM yfrys/cu/ '·<./; Gmniumfr.otZi'if! 334 (2005) 100-1- 1013. hi an;, offthr sJmse-memioned consensus spqm m e defined embodiments 'he isca ited anigen-binding pmteui ma;. -;Ά'> io efr inhibit human CORP R. sehwoe to dj^ imm,m die All, \M3 ot Λλ’Ί 1 lees.pto-s,. a , 0eh «, seLeioU\ 0)00 of »OP i(f mor,\ ?50 n- rnoie, 'bO or mo»e, ’pb or moo , 1 ,ΡρΟ or trote, * '00 m mov, 5,00b or more or >03)00 or more, where fine degree of spleens e mhibiuou may be determined using any ?0 vuteble method, e g, t-ing a eAMp ,ι-,,-,ρ % d.vcnbed tn the I vmqf es her, m in .ui> of the abo\ e-menilom d, eom-i-usns sequence A fmed embodiments, the 00:,tied unWs p,-binding protein may have a Ki ofi£ 100 nM, <i0 nM, bi r»M, <0.5 nM or <0.1 rM in CORP binding competition assay, e.g., m a radiolabeled '^'i-CGRPbinding competition as-ey to nsanbiwicy horn ^e'ds es|'i'cs\j)'g hnmrai <\.RP R, ,- g, the ',sm\ des.'iibed w I \ m-pk ;< hetent
ZS >
2016244220 11 Oct 2016
Soma of the tsoktnd -intigen-bindiug proteins described eompris·,- a beds’- chum s cubic i.vtu'i (X ί ^qtatir^ Jut bus , t „ast 80' <. hM >, utn; 40' i-ei i!M > s.qu'.ute ,k',st,t\ with -nt ammo acid sequence seie>. led From the group i.onsisting of SFQ H) \0\ i '0-ΓΥ5, omm of Un isolated antigen-binding proteins described comprise a a Ju chain \artabk legion t Y ? s»,-tjueni.e that Km at least nO”-. 850-, and Oil'k, or -00- -mquvrnc identity v uh m amtno acid seemerec si k'cksi note the pomp consisting m Q R5 \Os { ons 4 Nome of t''-e isohtted anogeo binding. proteins described comprise a \ {! sequetne frai has at le ist *908501, '*001 oi 95 m scijuencv iile-uitx v- u.h ;'m ;unmo acid sequen, e seh-ei-, d from tm epotep eot-sisting ot Nt 0 ID \Gs 1<n I Ύ and a \ t tha' fas ;g leu--' 500-, n~ *., op-g,el ηργ, sequence t.ientils w ith an .onino acid sequent e selected from the group xonsisone of NfQ ID \i is, I -t 0 !5e hi some eu-,bodm-,e-ut% the molan-d νη^η-ιΐ'baiding- proteins eotnpuse ίΛ) a heavy chain variable region. (Y3.t comprising :·, s-..-tinen- e u t s-dected Hom rite group consisting, of SR) iP ’dis I '<N~'i~0, m to) a- defined bs (i 5 and 1 entaUiutg t-ti·. m naue tc g , foe, ten, fifteen or twenty) amino acid stibsottmons ie,g.. eoosenafi’-e ammo m-d substitutions),
5 deletions «Ί ni’-CTtiotis. f B) a \ t emnpiistng a sequence tin) seieenu from the gtonp ,00^--0110 ofN| QH) XOs le mm t-o0tsd bred n in ) ..ontaming om ot mo'eteg, fnc ten,, fifteen or twenty) amino acid stibsti tutions ( e.g ., conservative tttniho acid yubst|titiiotia)s deletions or inseriions, or t< 0$ \ , of(.\5 and a \ oftLfts In sottsr emt-r-iCliments, th„ isolated iintigen-bmdmg proteins comprise a heavy chain sarmb-c region ί Ynί comprising xt s..>(pt,tee
2(i scieued hunt the m wip consisting of SLQ IP \< )s ι Ύ- 17b and V et-mpi isittg a sequence selected tnim the eroup consisting oi SbQ ID Y0s 13'· 15c, in one ombodimem, the Isolated, itti dgeit-hin.dip.g protoin oompriyes a heavy chain.
\ artoble region t \ - ) compm-mg ,m men-1 acid s„-qu,-n^e selected from me croup -„on m-ong of k! SkQ II) NO. 158. iji) ,t sequence that is at least 9150. or 955., identical 10 the soqneuee deist e,l h\ 0t , td {ί,) ,, v\, eree as den tec, b\ t t’t tot kmv tu tm *o ;„η ίτ tm acid siiiwopmons te y touters,tP\c enmo a- id suhsbluticnst, d-'-kkions oi uve’-Pom- in ,-ηοΐη?-embodiment, the isolated ap.itgcn-htnding protein comprises a \ {- Lonipitmig' an amnio mod sequence selected liom ihe group consisting ol (i 1 Sf'Q if) Υίί 1 59 ·;ι· 5 ,i scuu-cn-. e that is ;et least 9ί5*Ν, os 05 -, identical be tin- s-,.-qn-cn>, e defita -,1 h\ (t 1. and f-ti) a sequence as deihteti t-\ it) eontfrinihg up to ten amino acid x^rsbstimitons (tag,,. eonserva.tive amino acid substimtionaX delebon- or niscii-ons In -,noth, 1 eptiioOinienk die n-oLik-d dnbgeu-bmdmu ptoiem eomp-'is,a \ ,eontp{:stug u tmmo mm s-Arumne ,Y. ued from rise e'oup eor-e-mig of ft) M'O H>
V) loO, 11( i a „eqnencc ih 0 is ul i, asi -5()0, -η 05 ', ul, nt-eal ’o tin' -~ηη<, uee dcimed o\ p t, uttd -tu i xi sequeinn as xiefinctl by t if toutajinng up tc ten amino acid substitutions ie,g..
2016244220 11 Oct 2016
-omsesouine sn-nv ted ieicmms o* insertion- In .medic’ *mlo>lms,H. the isolated autigcmbindinu ptotent composes a V } eomptissut. an an.mo aud sequence selected t'rem is:-. gtenp eonsssimg of g i SfQ ID X» 1 b’· I, f ο i t. sequence that is u -east 90''.. m A' > identieal to tin. sequence domed h\ g;. .md ίιυ» a -equenci. as defined b\ {j> contamnsg up to e ten . mme a„id seb-mtetio'u, <v a . eonser. .-me ammo aetd •Hib’diumonsb dUeiicm- oi n sest-ons, In unoth-e-'· embodiment the isolated .mt.ttett-bmdmg pmtem comp*mes a Yg. eompm-mg an mtmo aesd sequels, e selected fruits the group umssistrng of (is ShQ ID XO ;'b.\ fiiia sequence that is 0 I>, u-ι AX o: os,, hAmc u to the seqnenet· del med b\ < t·. and i siD a sequeneu as dvfiued lx (si emit.umug up to ten ammo acid sehsiniiismts te g\. cmxcrvume ammo urnd substitutions'», dNetsoos or :melton*· ht another qfnbodsment, the isolated anttgenimtdmg proteut compO-es a Yp eontpi-.sing an ammo aesn sequeim., seXxtcd front the group eonsssm-sc ot'b t Set) ID Xf t DO, idia .-e-qnene. that is.s? DasAiffr m Αχ identiea I to the simm nt e defined b\ is i and not a sequence as denned b\ it'» tentaunng up to ?.-u .morse acel substitutions te i>. eonser-atos„- mttno aem sufi.siimfiomo, deletions or insertions in anodier embodiment, the isolated antigen-bindfitg psomm eons psi «sec a Yt; comps ising an amino aesd sequence select ;d from die group eon-asune of (s > SbO ID XO IM p< f a sequence that ss at fea-t KhX oi lO ’ > Genin al m file sequence defined o> iD and {mf :. s q'-. ft e <f- defined b\ isi containing tsp to ten ammo acid substitutions ie,g„ con<er\at;se emum aetd substitutions), d Aeons es ui*. -'t’on'' In aoofbei >.-mbodune-n the tsoD, o wtsg> r-m.ds'ig poX'm - ompus'--.
a Χ- comprising -.nt ammo aC'.d -xquenee selected from the group eottsisttnn ol -:u SbO ID XO' 165. s in a sequence that => -it leesf or 9yX d-mfiiad to the sequence defined by s D and {ml a suqta'in-e a* d fined U\ o) eonta'uu'-e sip io ten ammo mud mbsnmsiens te g uousesn alive amino add sub-elintiottsb deletions ot insertions in another embodiment, the isolated antigen-binding psotem comprises a Y,{ comprising an ammo acid sequence si leeUd from the group consisting ol fi) SfiQ ID \O it ·« », {bin ,sCiptcm.c that :-- at feast 9i)’u. or AX idcnlst tl to the sequeme detun'd h\ of. and Dot a s'.-mi.-u- e us d-Tused by if > comuimst, up io ten ammo acid substitutions te g„ con-cn ab\c ammo ..esd 'Uihstitmions), deletion -. oi suseruoi s in «ηοί’Α -. mbodnncm, the isoiat-ed anue-.-o-h-ad-ug profem - omprbrs a Y{, umsposme an emuo >v. ul sequeu.e seleeitd ftum the gtonn eonMsmsg of pi Sb'Q ID Xt) lo7s ?d <n| a sequence that is .,1 l-e?sT 90' - >'<· <·*>% (Arnica} to tits' s.-t|u,'nfcc defined b> «ji. and tins a siapi-, ni e a*- defined A tst eont nismg no to ten ammo a. id substitutions p.. g, c«msei\ats\v n it' o v d subsist n es s\ .1 vtos>‘( ns f om ! * ot 'es uoios. n >e” . h. vo t u tr nom i'su<iuu profem <. onipt's-cs a Y{ comps :smg an ammo aesd s. quem.e selei ted from the group consisting ottsi fsf'.D ID XO !bf, tni a >i qtvei'c^ dial o at least t, oi AX identical to the
2016244220 11 Oct 2016 .wqucree defined b\ it) aM ty5) < sequoia e <0 tierned ='> tfh'*w* /ntn« up h> ten mnu·» a, id sub-on minus ie e , eon-e.rsetoc amnnt aetd substttnPotts). deletions or insertions. tn another embed sm-nt »he <sol.aed eineembmdme p»oietn c >mp» tses a A p teinpr»smg in aini'»o it id sequence sekued front the group consisting oG E> Si.Q ID NO. io’< in) u sequence that 0 a?
least 90% or 95% identical to the sequence defined by (if and (In) a sequence as defined by (i) umbnmng np to ten ammo acid snbstnntious te g , unisctsafi',e muioo ,v..id substnuttonsi, deletions or insertions tn .ughb-er embodiment, the knjurcd antigen butdtug pmo.-m comprises a \\. comprising an aiumo id sequence -eh-etcd fiotn the group eone-fme of fit SEQ ID NG, 1 tt. t u) u. sequence that 1 -> at least 9i}’,, et AM identical to du sequence defined b< tt t,
H) are tid 1 a sequence ns defined ty pt 10m mung up io ten amino »i> »d substitutions «e g , consenau'.'. mmue aeid substitutions! delei;on*e>t htseifions
In ,ute entbodinu'U die isobded s' t’.gen-bmd'ng nroteni .om-pos.'s a oglu i hair \uri>.ibk' tegfon ί\'t 1 comprising an ammo acid sequence selected fiom tiie g-onp consisting of t i 1SLQ 11 > SG: 13 ?, 1 ii) a sequence fhat is at least y or 95% identical io the sequence defined ly yr cid on t a sequence as denned b\ »it t oimnnmg tup to ten .rnmio ae»l substn-ations ie g. eouscr ,ιΐ% ammo mid substitutions). deienous ot insertion*. in another embodiment. die isoi uec e t’.uen-hmdmg piotetn composes a A ; e-'-mpnoUig an ammo acid sepust-.c^ seketed front the co-op „ousjs'.mg of 11? b.hU ID XG i %, it? .1 s„qu;ecc that t* at least op'·, i?5 05 '. 1 deutu al 'si the s.-eti* nt e d -fined ly fit, uni on % sequence as dcEu'd ly <j>
euiiutmng up to tut ammo acid <5ubsumrons te g, emtsemato e .eumo acid substitution* 1.
deletions or Inset nous, in unotbvr embodiment, the isolated anttgeti buidng pOtein computes a \ , comps isim. -,n ammo ce-,d μιΊΟΙ?· s.-let ted fi-'s-t tbs' teonp -. onsisimg td 0) St Q it ‘
NG: 139. id) a -nequeruv that »-> at least 90”„ or AG ideno. al ΐο the ssqnsUse defined ly t» t, and fiii! a sequenc-,. as defined ly in emnamme up to ten mono ,«ul substitutions ic.g , ere Isen, atom minuo ned substitutions i deletions ot insertions In .mofriei embodiment, the tsestt- d tntig·, u-hfndtng ρπΑηι comprises a \ . lOtnpnuntt an amuio acid ,>equene.- tecmd fiom the group eon-ustum of tt) SbQ 1G SO 1 -)fi. tit) u sequence that ;s m k'tni AG» 05 ov'„ identical ΐο the 'eunenee defined ty oi. and tm'» a sequence a.s defined by ίE« -oMaunng up to t.-ii >-,n-»uo aei.1 A'smnt 10=1-, {,< t-, ,-onsen ;du e atun'o n.td subsptui.onst. detciituts of insertions In another embodiment, the ise-hred sruigeu -binding protein comprises a %.
eotnp?isttiu ΐ',n ammo acid sequence selected itom the pioup consisting ot tit Spy ID \O. tdl, di» i seuticnee that is tt Icaot %r , <v %% tdeufie d to the sequence defined m tit. and <οΡ> a sequence as defined t, i in oniaunng tep to f. n ,-meuo ae».l siGsumito’·»-, io g , t utise» vaue amtuO mod substitutions), deletions 01 insertions In another embtMtmetib the isolated antigen2016244220 11 Oct 2016 bni.h'ig proum- -. emprises <j tomprsim: an ammo .-eid sequence selected note the gmup eoristrimc nl tri M G ID \o I®, f,q a ->- qnm-e., th.n :-- at least 4t}‘ t, ei identua; to the sequcise defined b> -;s i, and tint a .sequence as defined by (I ? containing up to ten unrino add subshnnion*»e.g, consercatn e ammo acd subsvttuitonsk deletions or insertions In another embodiment, the isolated trntgemhinding protein comprises a V{ comprising an ammo amd sequence si ieemd stiw Use gfoup consume oi t st Si G it) Yt) I-P pi},-, mipscn<„.' mat e- ui least θο·\, or ov , identical to the sequence defined m. ri) and (ml a scqi«,nec as defined b> u'> eot-bunnis.. up to ten umtno a.t tO substitutions fc e . eon-.,et',<iie,e ammo acid .mbshuifiens), deletions or mseruosts. tn another embodiment, the isolated diitigen-bmdmg protein comprises tit <i \ omprom mmo =-- d seqaeme - ’ eet , Pern fi >\'ottp so's st'ng of.;-) brQ ID YO 144, (ii ι a sequence that is at least or op·»,, Identical to the sequence defined by ri), and (iii) oequbiwe us defined by (i) containing up to ten ami® acid aafeafitutiona (e.gi S const I'mitse am-® 11 sub'-ritutioosb deletions m trsett-ms In ^η-un.'i embodiment, the {«Gated antigen hmdmg protein comprises a V- comprising an ammo acid sequence sekeied fiom {' : i-Oui - ousistmg o- r} SI sp ID YG ',-5, to}.-. s-.t-n η 1 e tian's at e.ssi °0’ > tv identical to the sequence defined by Ci). and tnh n sentience as defined by til conmininc up to ten do’·’!·’ a. id snhstuufions · q , eonset< .no.,- ammo acid substitutions), net {tons or insertions. In another embodiment, the isolated antigen-binding protent compress a X {
- ompi'sn.g an amne '·.· \l sequemc select· d fiom fh-- green consisting o’ tri Sb'Q ID \G '4t<
tn} a sCquetYY that t- at teas; 9fi”. ut identical to the sequence darinied n\ m, end tori a sequence as ee ®< p, 11 > com un-ng un to ten amuse amd oGstmifiono U g„ .onsets, nue ammo amd «sibritmt oust, deletions or ins-mi-ons. In nnmh-..r embodtmetit. the isolated antigenhinds® pretem comprises a X { comprising m ammo acid sequence sfieeted fom the uioup consisting obit} Sb.Q ID YD N. tri»} a s<.qnent.e thin ts at least or '-G'rii ihennea» to tin.
sequence defieed by tit, ,»ud tm} a v qnei;e„ us d-..fined h, t com omm.· up to ten .umne arid stibstButtons ie g . eonoenaioe -nmno u- id substitutionst, deletions of m«eriions in imoihet embodiment, the isolated antigen-binding proton comprises a Xj comprising un amino acid sequence selected ttom the comp etmststmg-n tft Si'Q ID SO Mb {hi .1 semtcti>,e dial << ai least op»’,, ,}j 05 *,. J/nt-cui S' the s> q®t->, e defile .1 by V s md rio) u sequence as gci'mcn G, i1) emit unntg up fu ten amino acid .substitutions fe.g., eimsereati'. e amino acid subsfimtions), deletion-» or mseruons. In ηιιοΝι,.· embodiment, the f«obted unseen-binding protein comprises;
a X vOmprisit'g to emtn<t >md sequence -ie<'kp irom group enosistutg nt ri} Si G ID \ί'« kN, i ο s a -e-piene-' thO ..s ut I. ast Gfb, -'f °5'. ulenticul to the --qm m .· defined by p t.
end inti a sequence as defined by t ύ eoifiamnig tip 10 kt> .mnno amd substitutions te e ,
2016244220 11 Oct 2016 ; ousesoasne :nmno ted somstisssOonsi. deieoons οι insertions In another embodiment, die trioiatodasrtigen'bindmg protesn comprises a \\ enmpnsisoc an amino aesfi aoquenee veieeted from Si:-..- group e>mss<»fm$; of ρ s Sf.Q ID VJ I pi\ no a oequence that is .rt least l>0‘\.«? <D'f., soesnsea! to ih<„ sequence tkfiued h\ (>λ and Onia sequence -.-.sdefined by Istcontasnnse up to s ten , anno aud vuomtunouv <e e . eonM/n /toe atnsno sent ^ubvtisaoonsl deletion·, or a vesuouv la ariothe*· s'trtbodsssf,m: the ssoRied ,.. m.gen-heid ag psntcm cuaq'a jsv\s <i Yj comprising an ητηηο acid sequoia e veioetod irons the group eouvivung of sis Sf Q ID XD ; ?!. <'ns a .sequence that is rt I, s·’ hf'k os ns*',, h-Rmic u so the sc. pie-tea .lesmed b\ < t·. and isn't 4i sequence as defused b\ (si emmursusg up to ten aretao acid sub stums mis te g„ οίκιχιιχ'
H) ammo avid subsf it at uisis I -b-iefions or ne-ertiem· In .moshes mnbori’sneni, she isolated anthxnnsndnig protein ct-mp^-ev a Yf ron-pim-m,. an annuo .a,id veoaeuee μ'ϊοοιο,Ι from ife moup consensu; of i. j SIX) ID Xrt I.Asgfia seqnene. th:a ivat leak 90’ < os ΑΆ identical to tbs' sequ'. m e defined b\ rt i, and tit-i a sequence as denned by <s'> lontaui-ag up to r,m .ornrse ecu! sub'dhueouv ic.g., consenato. v imino stem «iifivofiifionsu deletions or insertions la another
I 5 mnhodnneni, die isolated imugcn-biudmg piosi-m eonsposes a Yj composing ass ammo ucid sequence sheer ;d from the group eon-nmne of (s > SID ID Xt I I be. tjrt a sequence that ss at lea-t'RD., os l,s > , (densua! io die sequence define:! o> ; D and (m;\ m-. n< e a*, defined by i 5 condoning isp to ton ammo a<„m ms! sutirtsoso sc g . con mis.stive entnto acid substumson.se deletions or ΐηΜ,-rfions in any uf dm abose-snentionod VL mu! Yp sequence defined ensliodsnserstk the isolated tre'm^n bs ids vm psotem mso be, ’or /sample, ,t mo-tocOiud asmbotb, t nob Jona- arstihodm t teeoa4<in,isn amfisidy, a human te g , full) isum.ui) antshod.y. a iemammed mrtNuR a elmneoc antibody, u multi-specific antibody, or an antigen blading fragment thereof further, the mnboey fiasgmont of the isolated antigen-binding proteins nor. P<, ,-. h.fu baiytsen;. and. b.frf hasgmestt, au
Dab^ *i,mne; <n H a , men < u above, o* a s ng! chain s.,.si m',\ nckane loi eoamp.s, the Isot.rted in-been binding pnrtein mas be a hninari mono, tonal antibody, .me: fi,. ,·> g an k'D; , Igt Id , IcUe . <>t lelD'ispc antiherte ! nsdui, the isolated ..ntsceis hsndnse pseteu's sum ho neiitruI!Dug antigen landing protehis b afM η·, die Dose-s'.eudo' co V a ul \ { s, qu. n.e de-uued xusliodsuseuts. he ssokbed anfcigosi-htndsiig protein rwy specifically bind to both htrawt C.RLR and fettnwi B.AMP1 and not spe, ;fi. ..!!<. Ouid io \\I i, \M2 t>r a, hum,us ,im\hn n-eeplot ;e g, \MYI >, ms example, the isola d i.rsogen bie ts;. ptosem oim sixesj J ' bum » nus'aa . 11 <R? R ouh a K ' t.M <!00 nM,is) nM, or stM. e g , as detos'miii.„-i! u-smg a 1' \< 0 binding ssssas arsd analyzed, lot ssurnple. using snedsoos deses’s'oed m Rudsarsaswasns, e? ηό. ,r?/on/usf; o/
2016244220 11 Oct 2016
Rme-θ! 5-: omm.me mmsm 'ΧΜΡΟΟ,Μ 100 I - i 0I3 iu am m dm Jiao e-memin'ied \\ ami \ u sequence defined embodiments, the isolated anbgen-bindbg protein may selectively inhibit human ? GRP R, f.a ts-ve to die inenan ?he AMI, AMP of AMh i ree< pm s. e p , euh a selectivity rauo of 100 of men a. 2*0 or rwc, 500 or mote, Ό0 or mote. I .000 or mors, 2X00 or swe, .\H00 ? or mom or 10,000 -'.r more, ohcre me deg-'ee ot selective u-ihibimm may ne determined nsum am suiGhk method, e s-. using u <. AMP assay is descohed ut the I s.m-ples h> min In any of the above mentioned V ;md Y»{ *emse;a.e dm med >-mbo<hrnems. the isolated aimgcn bmdmg piotem may have a K- of -100 uM, * i0 uM, * I uM, -0 5 nM or 0 I n\-l m a CGRP bmdsnt. eompeiition assay, e.g,, in a radiolabeled binding corngeiition assay: to rnensbtanes f mm , c’b m prox.-nng human t 'GRP R, ? g , die issay des,; shed m Example * hot cm btOif.- ispeei, the ssolaxo amp-vm-bn-dma p-.oients comprise a h.eo, ch.ms s/quarue fh.it has at 1-. a*l SR1., X'R cr os seqnom e 'demos v nh m ammo a, id seqnen?
'itdeeh-d ooin the pjour consisting et SI P ID \Os ?°-41 Smne of the isolated .mimeahmdh-u proteins described comprise a bghi chun <ie<juen».^. dm ha,* m least >O'·.. £ye, 90’b. qt
1.5 05% sequence identity with ats ammo acid sequent? selected from the group lOUsisOng of Sl.'ig
NOsel2-2B. Some of the Isolated antigen-binding proteins comprise a heavy drain see'· 'm ? *bat i,<f* m ieast 50' >< s v\., ep'o, trr <\S', xeqncne. de'U'ty v Uh an cm 's' -, \1 ’.sipisitet selected front the group cousfstittg of Si.Q IP V Is; 29--41, and a light chain 'icquan.e hat h ο* at least 50', 55'P OOR. m 05 ' - se-pience identity u nit an amino acid sequence sctx'ued ftom the ctnnp tons-sung ot SLQ IPX? Is, 12-2^ la sonx' embodiment*. t!x' isolated atmgun binding proteins οοηιρη,-,ο iA) a he.oy chain comprising a sequence (i > selected from the eimip ronssstmg ofSFQ IP Mis 20—11, or (a s as dei'uted by t P> and em-iaining one m it'ore (e n , ore, mn, mteen ot tu mays amtno ae-d nibs: mittens u g , < ms,*cv mA- .unino aeid sub*otut'oasI, dGetfOus οι η;*- room. «B? a belli . ham . omptisum a *e.uten< e gn'« seOcled ism ) P'e ^.-oeo consisting <r, M <? IP \O* '2 22, m tu t -,s xefnud iv u'0 co'damme one m mor? te g, foe, ten. fhleen or tv entyl ammo .-a. id subsist adm-s (e e., eomerv alive amino acid oibslimnon-P. deletion-, os insertions, m ;C i a hem v eham of { \ > and a light eham of {IP, In ,*ome embodiments, the isolated antigen-binding prmrnns compose n heavy chain eompri-dns,’ a sequence selected srom the eac-jp consisting ot Sbp H> \Os 2ί>~41 and a Ιη.-ϋΐ ehum *0 comprising se^twoee xelectd froio Ott m'Oiip con*’s)mgof !3 IP \O* |’ m
In one embodimem, 0s? isoGmd ηηΐηρϋ-ΐηϋΐΐ-ϋη piotem ?oinprts?'x <Aj a heavy chant vomp isit'e m 4mmo ;d sequence *.>icen,d trem fh, gtoup eonsMme ofpj $bp IP \u ?9, «o'» >·, s<, gntut ,· that s* ,ii Ansi Ot}··,. ^) 05% identical io the s?qif,>n,e di f-ned i'y tsh and tmt a sequence as defined b\ <i> containing up to ten amino acid .sithsiftifiiomi tc g , conservative
2016244220 11 Oct 2016 iitnim» ,a td sybshiutionst, d a ,-uous ns ’itM-rhon*, md {Bi a Istfru eh un composing an ammo acsd seqtieitee seleeisil front the group eonststing of (i} SEQ ID NO. 12, (it) a sequence that b at least '-sfr'c or ,!5!,.i identical to the sequence defined by iifr and (lilt a sequeuce as (kilned by (I) conieming up to .fen- amino acid aubstlmEons (e.g,, conservafivc ami.no acid subsfrfrmons), deiefi'ons or insertions, in anotbei ombodament, the isobtu, ri atitmi'is-bmiimg protein comprtv. - t \) a heavs chain conmosmg an antmoaetd sequence seleked from the erotm ..onsiMmgvf (P SEQ IP \O.30, in) a sequence that is .it least1 *d;D οι tdeuntea! to the sequence debited by B), and But a sequence as deiinsd b\ os -coidammg up m ten ammo aetd substitutions ie,j, .
i‘d -.O's-eu tisxe arene „ Q st''cste’titiO''Xi lelelams o< mseovtx ami (Bi j. hptt cbaiu con'p'ismp au. annun ,icm -equette' selected from the gn«up consisting id Μ M u tD no | - .;ut a sequence that b ax leak .98% or 95% identical to the sequence defined by (t), and (lit) a 'leqnua. e as .defined by is) continuing, up to ten atnuio ai id suh'dtutuons b„.g, consenati',·? amino acid substimdons?. deletions or insertions.
1.5 bi another embodiment, the isolated amipcn-'blndirm protein t οιηρί'^, - i V> a heavy chair· en’rnnsmg .<u ammo acid scqs^enee selc ted from the erven ^on.-tstntg o? ufrsf Q IP NO 31 in; a sequence butt m m least ο*,Β, or bug. v the sequence debited by *tl a-'ut
Bio a sequence as debited by (tt eontantntg tip to ten ammo aetd substitutions (e.g..
• 0'isersatne amno tu \l st,tfOtnutt-msi dcieoons ,u mscrUens, a?ui (B) i hght chain eompi ismg att amnio ,scid -euuettce selected bon· the ctonp consisting of 0) \i () ID NO, N, in) a seoueree that is u least op' c or *k% identic d to the sequence detbted D t ii, ano *,hiI >i o up .-ms a as defined t'y ot e-'i't name np to ten «mum m id snmhtmmus >e g , - onset >.,<tiv amtno ?c;d -ubshtunonsh deletions or insertions, in unotbei embodiment, the iso'-an ri anttunu aw.,ute protein i ompi’s· - t \) a Iico s eb.aiu eoittnnsmg t-,n ammo acid ssqttsitce selected front the gtoim coiwstmg of til M.Q IP NO'?2, ;;fr> a sequence th a is m kaM og'1, or oy·’,. ukmteD to the sequence debited by *tl, ami tub a sequence -is delntcd b\ (it vonfrtntntg up to ten amino acid substittifrpns (e.g,.
-, ou.-eiotuw itnmo icnl \g'isligflto’isa rieieiamsm msems't'-, ami (B) x hc-ht chain composing at- ammo acid i-m use sekrted frotn the pump lonsistatg id fit \| tp IP NO t N ,-0 a
3*1 sequence that is u leas* *>9% or l'!?% identical to the sequence defined % iQ and ytnt a '«eipi'.mt e a*- defined r*y tit com umnu no to ten ainom u, ei substitutions g. g, eonscnuti',. amino mid subsbimiottsi. deletions or insertions.
In anothet embodiment, the iseimul ammeu-hmihtu· protein tomprts·. s ? \) j heavy chum composing em ammo aetd seqtt-.uce selected fiotn the gicmp consisting of a 11 Si Q IP oe ,Λ.ι·ρ
2016244220 11 Oct 2016 \Q v, (d) a simacm e foul a- w knsl 90'. ot -denm aim th,’ sequent e defined by ‘ft, and (ίϋ) a sequence ax defined by fit eontthmne up to ten antnto acid substitutions ie.g , eons, rxattxe amom <», id <mhs'imfiontd jak^-ons o~ insertions, at 1t !>i a light - ham - t>'i‘pssrie an amino acid sequence -<keted now tin. etoap consumseofifi SEQ IQ \Q,fi? {tit a sequence that is di least 90% fir 95% i dontifeal io foe sequence defined by (i), and (iii) a sequence as defimed b> u) containing up to ten mnwo acid substitution», te g.,. vw-x'i’v.ttxe anfino acid substitutions), deletions or Insertions,
In junk·! emhodiwen', the isolate»: antigen-binding pjoteuf composes ( \) a he«s\ chant comprising an ammo acid sequence selected from the group consisting of ti? SEQ ID
H) \Q ,?E (ii) a sequence that e- at least 9(}’. w ;*s%· identic^! to the sequence defined by (i). and «{·{) n s^quesne defined bv p} eontawinc up *e ton amnio .uesd -ubstitutOus te g,
CP'is nx Htxe amm-i «, et subs’!'nt ion?) delcoon- o insert-ws, n»-d t !>t a light bam > mup'Oman aonno acid sequence v.leeted. from the group consisting of (i i SEQ IQ \G 17, (ii) a •>equene„ tlt-rf :,- at least 90% o* 9}% identic,>1 to tits' sequence dciued bx to. and fid? a sequene-e as defined Ex 11'> < eufiunmg icp to ten mwne acQ substitution-, teg,, onset imi-e ammo ten! substitutions, de’etions or msertums fit another enfo-mtunew,, the isolated antigen-binding pros tn eenpr-oes t \) a he«s\ chain comprising an ammo and sequence selected from the group consisting ot fi? SEQ ID \Q;3fo {ti) a sequence that is at least 9011 -, or 95Q tdcmt- al to the sequence defined by ti J. and (iii) a sequence as defines! by fit containing up to ten amnio acid substitutions (e.g., eonsenetix e amino acQ substitutions deletions or insertions; ;md i Bi a light chain, comprising an aonno «.td sequence selected now the gtoup e-tusMouj oftf i SEQ 1!) % i t\ (ot a .sequence that Is ;?τ least 90% fit idemie,n to foe sequence defined by ti?. and fid? a sequencx' as defimed fix 1i) containing up to ten wt-wo acid substitutions (e v., i osmerx utis e aonno aetd substitutions), delations or fosettionx.
Io another enfood:mew. the isolate»! antigen-bunting piovin compiles (At a heaxx chant comprising tm urn mo acid sequence selected from the group consist mg o! fi? SEQ) ID \O ?e. (II) a sequent e that k m Ernst 9()% or 95% identical to die sequence defined by (I i and tin) a sequ»'’i,e ., s defire ! bv , t ooutun tn χ up ό txt ammo aent s.ibsot'.guns o, g , ept',>vr\alive ammo aefo sub^imtionQ deletions or insertions, ;?nd i Kt t light xhato comprising an aonno a id sequence -keeled ;row fite gtoup consisting? of g i SEQ iQ V 1 Q\ (ut a sequence font is at least 90% o? 95% idem tea! io the sequence defined bx td, mid .(in) a. sOxtuenee as .kfinedEx 11) tot i,t-nmg up to t. u »m mo .ix't.l substitutions te o ,,oif'-oxom· annuo acid substitutions), 'deletions or mxerfions,
2016244220 11 Oct 2016 hs another embodiment the isvfat- d anngett-buuhng proNan compose- $ Ό a he.e, \ e! urn emttn- ts-ttg ,nt annuo acid ssqiajtt.e sel· ocd tie-u the mot p «.oti -istn’gof t b M Q ID NO ttt'» a sequence tin tt ts ;U least lhp>„ or 9--1.. flounc'd to the sequence delated by (tb and tub a xequenes as deism, cl b\ Qt vOtdanttng up m ten utmno actd suI-st. notions tern , i,on->en attic amtno a·, id sob-eh m inns), ddcoons or insertions md ribs a light eh.ttn comprising an antit.o aetti s,-iptct4.e seNtled font the t-ioup vot-sisi.ng ol tb hi t? ID NO, 20, oba seu'uenee ibut is $t ;e,:-e m>% or 9?'\, identical to the sequence denned bp tb and tpti t n -ftpivtit e a*- dcftn.-d n\ is) com omne no to ten ammo u. id suh-mtutsous g e,, cons.-nato,. ammo aetd vubsftrution.s'> dciettou'- or insertions.
it) l·· another embodiment, th ’ isoum o unffgen-btntitus. protein tempt's-.1 t -V a he eg shut on ),is ng ,u ·. n tsoaesi -e.g ute ul..v tin n t κ met n „o sasiir^o* t '' Μ O D NO 3' itt * a,sequence that ts >n !„.,-a ov’, ot 9χ-\ oi nutesd to the seqtteue ’ defined b> <tI ami <iii) a sequence as defined by {tit i..oiUants.ny up to ten attune acid suh-stHuttons (e u .. conservative amino uOd substitutions t, deletions or insertions and (B) o light chain comprising
1.5 un amino acid sequettee selected ftom the group consisting of b) St.i) ID NO 21, rib u sentience that is t* leti-a ’·><)-·,- or t}?0n identical tit the sequence defined b\ t tb and inti a seen, ri? defined ts) e-mtmnng no to ten «re no acd simsmntfon·* t. p., xonse^.nn ammo retd -'ttbstirnfionsb dciettou-ot insertions, hi another embodiment the isolati d >tntit;en-I»nd<og protein compos»,--1 -b) a he,e, t ehuto composing .nt ttmun, aetd ssqu-.ure sel- acti fo-tn the utot.p ^ou-tstutg of tri Μ O ID \0'36, mid sequence mit is „ hast oy ’, or 9» , <d„-m.e:-I ti- the sequence detin,J by <ri md 11:t) a sequence 'is deih-e.l b\ (it .oubutung up to ten attnno -,ctd substitutions te e .
„οηsen attic s-mmo u-- id sitb-uimtionsh deletions or Insertions, and t B) a light chain comprising at- amino «eld -».qtistici- selected ftont the c-toup cooststittg oi ri) tii.Q ID NO,22, itt) a sequence that ts at least 'Ht'bi or (denttea! to Ihe sequence debited b\ (ib and t tit) u sent·1 oi, e a- debited ·ρ, t s) e-mt otong im to ten «none m. id substitution·» -, g , consci- ate, antnto aetd -ubstirntiesns), deletion- or insertions.
In aeoihe? embodiment, the isolated antigen-bustilng protein compose1 t -V a he.og.
-. hat''1 etui-pi η-mg tm sut-nso acid sequence selected titan the croup .O’asfstnu· of (i) SI Q ID
Nt)-3,- !ti$,t sequence that Is ,a ti-a-o 00’.<or 9s-1.. 5Jenhe.·14o the sequencedetined by ftt md Itu) a sequence as defined eg to .otthminu· up, m ten amnto a>, td substhubons (e c . vo'^enatise mmo subohtintO'ish deletions ·'·* insertions md (Eh - tight ek,un eompnsna at amua, .ano ~ qn> nee sen t fed fuun the on,up iot sist.ngoi hi 4 Q ID NO 2b rt)a sequence Ihat is al tiu-d 9tb',- oru<)., id-..uncut to the sequence denned by t Π. and t tit) u
2016244220 11 Oct 2016 sequence ts definad by <J> t'Otuaintng up to fen utnno ae\! wb-nbunons (e g . -on*~;.-rx'ni\e awao acid substitutions), deletions oj nisei items.
In unoftwr eu-hod-metr the isolated anttgen-hindtng pro·-.-hi eonipooes (Λ) a herox chaw vomprismg an urnino uud sequencs' selected from the group consisting w nj Ship q}
NO:5b, tu'> π satjumvc that G at least VO’,> ot VGA· tdenwai ro the sequence defined by tit, and < ίn'> u sequewe us defined bv -is contuunng up to tsii annuo acid snbsunwuns te.g , cnns-u'xaitxe ammo acd -whewnt ion-A deletions' or insertions, and i Kt a light vhatn eotnprGmg an utrnno aetd sequence -Gecred srow fise group consisting o{\s t ShQ IP \< ),25, |-s) a sequence that κat least 9t)-,. ><s- ny1., identical to the sequeiix-C defined b\ tit, und nut a sequene · is nefin at by «A tewum-ng on to fen menu w \1 sobstnuuo w <e e -on* su>e amino acid .substitutions), deb-ttons or insertions, bt eno-her ctnUodunco',. the isolated utntgen-dundtng pros in eontpmros t \) a h-e-ox xham -otnpitsuhj mt tnnmoui'td sequence seteevd oom bi-· group consisting <n tA Sidy fit \f) 53, tut a s,uite;we that I*- -b least WJA, or vyy identical to th,- sequence Uefined b> o' h end < nt) a sequen- e u*< defined by r-1 coWuitnng up to t>, t. annuo acid -uhstitottotn-' te g , eo’tset'xatrsx tmmv <-c-j -u rommo-A del-won-*or insertions, and tKt t light vhaut totnprwme an utrnno ot senueoee -, looted imm fiv group eonoewtg of-j t Si Q fi) \O ?4, <ul a ’,>,tpKtu.e that i--o, least 90-,-. t\$ identical to Ute sequence denned w nt, tnidtwt a .sequence is defined by (it containing up to ten amino aetd substitutions (e g., conservative ammo .tod substitutions), deletions oj nisei news, bt another embodiment the is-.'lated antigen binding pro* ein compm-es (A.) -t heaxy chan; ,otnpttsiu-f m ammo mud scqncnc- sele-Aod trout th-· group consisting os td Sldg ip \O:5<(, tilt a sequence that I* at least ”0% pi 0e‘\- tdemixal te the sequence defined by <K, swd <nt) u sequeo-e «*< defined by - it etiniutmng up so wo annuo acid Mthxrrtsiiton* (e.g, cottscf xatix'- -aumo ae>d suhstimtioosj deletions ot insertions. and t,Ki a light chant compitsroe an utntno u id sequence s-Ceeied trout the group consistingol'tt t fif'Q IP \{ .),25, {at a -«.qttenee hint n- at least 90-.. <<; oyy identical to W<, sequence defined by tit, and tid 5 a vsoquene ’ as eefinwi by yAtomam-ngno to fen -euroo ,n \| sobstnuiions te e -on*.; ro ntxe atmno acid substitutions), deletions ot ηκοιΐιοικ,
In another embodiment- the isolated antigen-binding protein comprises fAG a heavy chant composing an ammo acid sequence selected Oom the group consisting of tit SEQ fid
NOQO, {fit a sequence that is at least 90% 95% tdemftai to the sequence defines! by ti h and «iu> u sequc’i-e a*< defused by >o consumm·-, up to t-1- arnttn» -seal -nbsuwtiou- u g , eottserxatix'. ,ati-uo aeul suh-mtufiou'd deletions ot insertions, -tr-d tRt a ItJtt chant comprising
2016244220 11 Oct 2016 at «ΊίΐΊΗΐΚ .(ii' c se 11 le Iv ism Jv c o ip losmoan y idg j M tp if) \O A, ; ,1 ti sequence that is leu-d fHs% <,= uyq, jtK'ijucui tn the *equettei, detnied b\ syfi. and (.nfi a sequence a* defined h\ is) eontnnsng up in ten «msno a, id *ubv,ni ns so: :,* ·,. e., Ciinsei^cuv-amhao uetd sm but s rn nous k deletion* or ttt^eroosts,
In mod-set entboointenh the i*ei.ikd autieen-binding protein eomprtse< i A? a beam
-. bam comp: ssutg, an u't'Hso aesd scqiausee seketeri frosts the gsvssep i ois*s*s me of id SI Q ID NO 1I, ni s a scdue’iee thus Is ,u lea*t 9o’„ or 9qN. idesmed us she sequence denned by p s snd isu) a sequence >.·„χ >lelhsed by {n ,ontamsiig up to ten jsiiiiso a> id sub*tstutvm\ (e sy . eon-set vat tv e a nt mo acid seo-nstumms), deletions s.-r maul ion a. ..-.n-d iBsa heist elsmu comprising ci’s mimo aesd mu η· e senes te-.I -nmi the croup eon-voiing gt tsl SFsl II) NO-?'7 -sss a sequence that is „e ka-d 90% or 94% sdeistteai to the setjuestec defined by t 11. and s sis) a seen in e us defined % ist e-.'sunssmg up to ten «m n-ι and snhsmsilsos.s < g, xsssssewuto amino ssend 'snbststunos'.s), dele-ion* or uiseruons.
In aWher entbodimenf the isolated antigen-binding protein comprises (A) a heavy
1.5 .chain compfising an amino acid acqncnce.selected from. the group consisting of (i) SEQ IB NO; If jsint sequence that is at Lu-a <\ΐ:ι·< or 04% sd/niieal m the sequence defined by (i's usd sds) si *eqsienee sm defined by (it eontaisisru,· up so less asmsso .acid sub*issuiussss se.ie, con*-.!vatsve. mute a-ud sub'.titutn-sts), deletions >e m-sud-nM. and sBs a heist eitstsn comprising an amum aesd aesnuai, e seh-<. te-d fiom she group consisting t>f Sil tsFQ 111 N0'?>M -ol a sequence shat is m ka.-a Jhs% os '’mb, snout scut to she sequence defined b\ syfi. assd > ns) a seunenee a* defined by ti) eon* ustmg up *o ten amuse suhsitinitotv·, A g„ -„onsefxau\e ams-io aeui «sibstitntsosss'i, deiefiots'tos msereons
In ip> e? she ,sbo\ .- mentioned hubs and he tv> - ham sequence desisted unbodnnems.
*1 i sol.Ued >... trge’i-l 'mbm notes', t' s. comps - she *m< 'fie 11 i^s\ ,esd os ef , etuns' sequence, but wstls a dsffiaent -somd peptide os with ue Ovisui peptide its ,-ns\ of the abovemenfioiied I split and heavy eh.sus s-aiuo·:-, e det Is :-..-d esni'-oduu- ss'-s, fist' cohued usPuets-bu’idmg protem may he. tor example.;; monoclonal sustiB.sdy a poh clonal antibody, a reeosrtbstAot jftii'ob, i bum,iii le g , tssR Immas.} eesAnA, -s msmanf/en mums.,.!? a chnnen- ant'Csils, < ms J a-specs A. .mhhody„ omm antigen biisdssiu fragment theseof I nstlscs. Ik ,-eUsbodv hmysssentof ?>) the coleiC'd antigen hmdme ororems m.e, be a lush nngnt.rn and f ?b’ t’.ignsvm, an hab’) fsagm-. nt. ass I c fsagso-. id, a JiaF-mE, os a suigk- i Isam esinhodv mok-esda Ϊ ot csausple, the ssvko d , nngen binding psosesi' ns n he a bent ss* utostoclots i asuthodv, m d m, \ be, ° e, <ss. ΐι,ΰ , iy(let lb, o. Ie< 14~t\p, as.tih-idv f ns si-, i, the col Ued coins n t'lsab’ty ppn- a-s max he siessnahenty asitsgesi ksudsssg proteins
2016244220 11 Oct 2016 hi an> m Ov cbcoe-fnennoned hght ami heavy eham sequence defmen embodiments, the i/oluted antigen-binding protein mas speentcatls hum m both human (RI Rand human RAMP! and not spe-..i Ikaliy hmd io AM I, AM? nr a human ami hn re·, eptnr ί e g., A M3 i), for example, the Related antigen binding protent rna> -ipccuftealls hum to human CORP R o uh u e Ko ' e\i, ' JM nM, 10 uM or e ΎΙ e a , <-s de-.umned menu >· I 3si S bmmne tssm md at-aKeed, lot eemspue. u-mp memo is etes,ttbed m Ramarusy-atm m t/ &,<>, tp -,00 j^&ieiOT& GmkkmmArMiA .334 (2005) 1004-1013, In atty of the aboveementiobed light ano heats ,ba-n s-ctuiem c -ielhi d emt'omm.mt-. the i-soiat-,3 .intmen-lmidme psotetn mas -.decks el-> tihibP hut tan C t IK 1' R, nJ ease to the human the AML \M2 ο \'si3 (ee, ptom, ', g worn a .select;\ nA takoof ;00 m tiw, MO m mate, eOOormoru *”Wm mom, hOOo o<
trims, 2,500 or tnoie, h,000 or more or 10/300 or more, sshue the degics oi zdeefiss inhibition may he detenhied tsdiig asy sthOtble method, c,g<¥ uMtiga eAMP assay as described id die Examples herein. In an> of the abose-rnensloncd light and hetos- chain sequence-defined embodiments, the isolated antigembinding protein may bas e « R',i of y l00 nM. <10 n\1, M n\h ri0,5 uM ot' y-0 I «Μ in a f GRP binding, eompeHtion am-as, e.g, in a tudmlabeled '' l~i GRP binding -<.<unnethion mmy to membranes from veils expressing hum,mi ('GRP R, e.g , the tsoo dest t ecu m I „irmk - ’ tern in a kn'tbcs u-gesk .wo piowLct me isolated t\>e\'e a„id nolynuel.chides dad encode any of the GGRP R mhgcn-bmdmg pfotesti-s -utum ·Μ.-\Ό chose In one embodiment 0-e isolated polynuelci'ttde compose,- a sequence -deeted trotn th; gtoup consisting 01 >1 Q ID KQs-l·'?, I R\ I'm I '0 ID1 181. Iff, IS? 1D<, 18'. lb*. I so pit, 192, P« PM pas, I Op, 107, 2150, 201,202. 20 204, 205, 200. 207, 208, 20< and 2!0 In uttmimt embodiment, the wo!ated po'snneieonde comprises t .eqnenes, seRs ted mmi the ermm < o'e-isi mg οΜΜ-γΐ ID \Ds 2?9-25s iwanoihei embodiment, tb- ,sokn 3 noKten lemide xonm· ises a sequent e capable of hybridizing under-iruigent hsbikneation conditions with c sequence sekcled from ihe croup i oust om>g of RF D IF) M)a 32-1-358 h, a?iomo embo-hmem, Oh- .so: it d pots tike lemfiR-comprises λ''.quenuu Huu t- about 80'' 1 he’1-,‘MY 0 <JM <os moi utende,-/ to a sequence ‘ek'ett d from tn,- gromo consoling of si Q O') \1> Y* 1-2 D- In some u stunt os, the i-mutod nucleic aeM molecules ate op-,, raids-huked to ,-,, O’Utol sequence. in related emlvMsmarm;, fit,.’ isobovd poo nucleotides am incorporated mio ,ut expression vector,
Mso included ate cel; hues Wm-dormed wsth esptes-ion \,ctW\ eotuinfsnig isolated pe.snuelesmde- , s dwcriKd >d'n-,e in a r.ltt.’d aspect, .0,0 pootded are w.m msion seeiom and host cells nansfbinied or transfected unit the esnmssion secksisdfai vompo/t. dis'
2016244220 11 Oct 2016 jfoemcnritmed isitlateti no·. tom arid mold uses tliat encode i'GRP R asmgen-bmdmg pnuems described abox e
In another aspect, also provided is -, method ;u prepao'iu.· die ant seers-binding protects that includes the step of preparing the antsgee binding psotetu from a host ceil that secretes the antigen-binding protein, in some embodimen s, the antigen binding protein is generated using an tmmunouen comprising soluble CGRP seeepiot. in some embodiments, such soluble CORP receptor is obtained by eo-expressing and purifying an N-terminal cximeeihtlisr domain (ECDt ol human CP. I R anti an I C Ό of iuinaus KAtoPi, e g. m i < D ct human CRLR cusnpn.susg SI..Q ID \O b u,d a i! ( Pe»f R Wild uomposmg bi Q =P NO- f, tor cxaume, as deseohed sr, i samples t ana hen-m in x a .utodter aspect, a phattaaetntiCdl eomjtosittoo is provided composing at lead ot, of the anhgun-binding protons otmnns' ί/ed abox e and -·, pharsnai. estsieiuiy acceptable m, spient in one otnbodime-ts, the pisaimaeeuite d eontposumn may compose an additional active agent thm ts ->ekcied from tin.- group coo^Fftinu of a radioisotope, radionucbde, a toxin, or a
1.5 themjicutie and a ehito tosberape· itsc group..
In one ,η-peei, toe coined ant,gen brndmc protein w cllcetiv e io sn’idni visodiah-tion and οι dei re tse neurogenic mtfimm.mou n hen odt-mtisiewd io a p nsesu In one embed·?'· rto the isolated antigen umdine pten, m ts efisGtve to seduce the fteenetsev and or se\ etro' of h„ad,i,bes I'm ex nnp'> , ungnm-e i cab tehes Γοι e\ -.mole the ,mligen bmdmg mote-n may- t'e
2(t nseo is an 'tent; to .us'teu* ot n -ui. me, ane ct ,t> a η on'·'. lactic be itm„nt to ptotont os tostoee dse frequenev s nd m -o, ,env of symptoms. pa rt-, nieriv p.nn symptoms, a-,sOe-neo vxnh a migraine attack f liber top.-ets umber pro\ sde methods tor treating or prex ennug s condition essvx sited o uh t 'GRP R tn a pattetn, comprising 'administering Io a psihe;;? an eficetixe amount of a? least one isolated ,mttii„r>-hmdnig ptoteut summ nseed above in ssste embodsmenh the condition κ a he>via, he, tor example,., migraine be idu, he oi ciueto, upad.i- bo m anotb. r txn. -n pam, - g , .· chtonic pant, nt anutbes emhootmeoi it ts d>,ibetes me!bins to,pc II), m another ernbodtsu.-nt it ts htftnui'n.sttou. pa-lit ukriy lu-iuOgcne ιηΙΙηι-κυαίιηη; nt another embodiment 4 is a eardioxaseubir di-aifder. ns nooihef embodiment it ts a hemodynamic detanyemen? .tssoi sated noth e-udotoxemus and seprity In another embodiment it ix. vasodiaktion.
in imo'ihe· aspect, also psovir cd w a method of inhibiting binding oi'CGRP to human
CORP R, e.g,, the exbwellnlar ports-m o* f 'GRP R, in a patient coniprtsiag admhhstesdng an efTeedvs amount of at least one aniigeo-biods'ng protein provided heroin and/or summarised above.
U
2016244220 11 Oct 2016
I'hesc .wd other -expects wfb he Jex, rfoed in greamr dc'eoi hewm Faeh of the .expects provided: can encompass various embodimenta provided hemim It is therefore anticipated that e -,-1 of fh embod unvote m\ oO mg one elens. ns o; · onitom turns m ,-:00-, sU< ns n ’ -neiud\i us meh expect described, and ad such eomoutniionx oi the above aspects and embodiments arc expressly considered. Ohm tei'ures obieeis and advantages of fix (mention .ire appwrem $n she detailed dexenptuto that loitow.x.
BRIEF DESCRIPTION GF THE DRAWINGS
Fig. 1 xhow-ao -digusucfst e? RAMP-1 sequences foam huina-'·,. \ uomoigu- monkey and rat,
10: fog ? shows g: ahgomerU su CR1 R <-eqnence-< t'rem husnatg eynesnolgex memkey and rat,
F;-gs 3 A and SB show phyl-^genetically-based s·, o-ience alignments of light cham GDRs from th'„ indteaten und-CGRP teeepios antibody clones has mg kappa light ehastex, and vertam eowexpondma consensus xcduemes
Kg, 4 shows phyfogenefeanyda&sed sequence alignments of light chain. CDfi.x itas the indicated ano f 1SRP -e.eptoi .tnnbod' clones nm, mg I imbda light chains, anti o-rtdin co? responding consensus ovqnonces toes ? A, 5B 5G, 5D and 5b show phyhsgenetseaih -based sequence alignments oi' hx’uv, elsum tf DRs ikon th-e indicated anti-A GRP re- eptor antibody , tones. and certain cosrreapotidmg eonsert&us ssqne.8 ces.
Etg ?i- xhowv, consensus sequenc/x of exemplary ano-CGRR receptor antibody heavy char i ' K,s disclosed herein ; w. tits 5 plet'd d.q$ tnuw two experiment? show tug percent mbib-ttou fo SabcDd hg,g.d binding to t'GRR R bv BK2 anti-A GRP R t’vhndomi oipemfoafox foninioadx· and »'N negytk e control stipernaumts (squares v
F;g-< '’V-Dshow ew'-npiax ,A\1R tx-e, 1C?0 J,nu from e ’Us csp-essim hf'GRR .receptor ii in. 7ARhAM’ (b'tg 7B;, h WI2 (log. TO and human amybn receptors (E-g, ~(>j for three indicated anii-CGRE R m-Anx
K> ίχ shows nil example of 'l-GtlRP hmdmg dtoa such us may be used to tiet.urmne 30 the Ri of nsAbs to l-uot.in ('GRR receptor
Fig- 0 VD show fhacore coinpotiOon dtoa lot selected atmbodtes tii-cioxed hetetn
Fig. 10 shows a b ACS Rd dgtcrnnu.mon of mAh 12GR, = w ΐ I shows ,-,η abgnm>, to of < yiinmolgns, Inm-an. human eh-ws ra-<, 1 d, and I'hcxnx
RA.MP.1 sequences.
2016244220 11 Oct 2016
Res i 2 A-B show an alignment ol'humnn, cynomoigm-, rhesus, rat human drueem and consensus CRLR sequences;.
Figs i? : O' snow repres» , TAt n da' ;. <n riittej.’tU ehmtene CGRP reeeptofs binding, to anti-CGRP R antibodies.,
Re I 1 -hev χ peptide map- decked i*<w \xp\ dm/shoo- ted i.»RP R aien.· «eni'imatosnau· \) and h«s\ dmextom o! <. eonnoi sample , om oon.g t 'GRP P monoeduud annbnds 1 ?Gb ututt'i.ii'n B'<
tog 1 χ -hows Asp\ digestions of CGRP P nt the presence of different concentrations of t % IRP R nents uh, tug antibody.
'' g lOshe'ox λ'Μ'\ duteseunxol < tip P P ι i the p exeneeeRb ietent e«leentnnton
CGRP R ncutreh/nog mthbodv, 4V.4,
I'm 1 ~ sfiow- mt nnnobtx'Ct hem: cry -', numg unemuy of» cits -spre-mn χ at mux reeeptp; compoucmx with ammod', MIR
DPTAit.PD DESCRIPTION
1.5 The section: headings used het ein cue for orgamzu-ionat purposes only and ate not to he construed m- Imtbmc the subicet matter described l 'niesx others f-e detined >u t»nn, -eiennfie ηη»Ι teehnkal setmx us- d m t onn».x non v. .th the ptcsent apphc?tji«n xhail have the ioeanntgx that are e<>ntntonl> understood bu fno-eof mdutuy -kb; in the art further, unlexs mhctxM-e requited b> contest, xmgulur ietmx xhult nxtude plcuahts.s and plural tertn- .-hah tneludc the -angular
Gencmlh. nomcml nuom u.-ed in e>>nneetton n itb and Rehriques of, eeh and Itx-ue eutt'ce, moks m a Rohm'', re inmok>g\, nueiposn-'gx, gg uctu ·- and p.okm ami nt.ekne ..cul vhem.istty and hyRidBaOoo described herein not those 'acP known cud eeroninnk used in the art. I he tnethodx »md techniques oi the present application ar»: generally pe· lor med according to eoro enoonai methods well known nt the art and as described in sarums generul and more so»-eilk reference- that ateeu».-d ami -.Psenxxed thmutdtout the rnv-enf spot oksnion usde-s other wi-e indicated 5»v t.g , Mutbrool »v ,d , Molecules ( lonetg Λ ϊ abotatory Manual. kd /d < ok! Sptine Harbor 1 aheram χ Pies'-, i elxi Spring Hmbm, \ 4 MOOf) \nxub>;f ,7 ( furent Psot'-cois m Moieeui e Biologo, Green». Puhbxtmm Ax«t»sues t HE}, uud Hafoxv ami
I nne Mthbodies: A Labor,dors Mamed Colei Sprint* Harbor Liberators Press, Void Spring Harbor. \ 4 t rtJ1'!0}, which am lixoipooUed fie,».in in mf/reuiv I'n/ytnatre tern. Rot's md purification technique- are performed according to nmuuUxturer’s xpe», ifie.dton<, as commonly accomplished nr the art m ax bcx. tibe»i lu tern i fo eonnuologg used m ιοηη» rt.on w uh. aid the Ul<o.utot\ piOecdmesand L-ekmquesot, anakfoal ebernrxtrv. x'-othaPe oremne chemtstrs.
2016244220 11 Oct 2016 and medicinal a nd pharmacem leal cdemistry described herein arc these wed known and commonly used in the are Standard teehmques can fee used for chemical syethese», chemical analxres, nhanndceuiical prep.oanoti, fmmnfenton. and deux cry, and tree me? e* patients.
It A redd be trndet-m-od that tins nreeneori are I united w the partictuarmethodmet. >.
protocols, and reagents, etc,, dvscrilwd herein and n-> meh may v-try I he terminology used hereon ;s 1m the purpov. ot desei ;bl tty pytltenltit embodon. nt-oiiN, and -s not mtc-tric-.l to btnP the ---op. rerihe present mxetiitnn x'lmb is defined s-me'y by the -Grew
Other than nt the opereuing examples, m χχ-hefe ofnewxws indicated, al! nutnbefs expressing miamlmm of ingredients or reaction conditions used herein stiotiid be intdeismod as modified in all instances by the icon ''abort; ’’ The term ' abom” xxnt n used nt rem>‘-t non with percentages means ±1%.
Μ&ΐίΜ fhe term “pol·,nucleotide ' ot ''nacree acid'' reeiudes both stogie-stranded at.-l doWdcsfiundc-d tnictcotfiL· pofe mens I tie nucleotide’-· . otnptts$ng the poly utideotide can fee
IS rmoneelcettdes or de-wy rtremoree-wde- or a modified form of etthc'' txpc of trend .-obdc $ red fodiin.atm-'s reel',!? ea-<. s\o fefirutso's sa,' re- b'ot'aret if, me mosaic ,k treats, - f -''s, modifte-tnotw meh ,re 2',5 -dideovreibow, and intermn kottde linkage modifications such as pho-p' modt'o ee ph,re xnottneimoat-, 'ft-repP m-'seleome., pi osplto'o-h -ehutoate pho'iphotoantiod'noatc, phoA aw utadate and phospla reoureedaic .30 The tern; “ofeosntueleottde'’ mentis a poly nut lentide emuprls'rea 300 or fewer nucleotide, p; mme embodiments, obremicGoitdes are- io to oh bases nt length. In et iter -, infeoditrents, mtgotsi'deonde1 are 13, if !!, IS, to. 1 re, reh m-?d to-id miGentide-in length t dt-;otsti>. k'otjihs may b-„ -angle sounded or double sa nuk'd, i re, tor ns., n,i the construction o*'a mutant i.--nc Obgcnnvlceesd--- rnay be sens;.- or atm-cu.-e oltgorenJeottdes \n ohgonih'k'mf.ic cm; utelud-. a label, welndre.g -, lad-Abeb a fitiorese-. m hd-O. a iiaprem m w a man - I re * d. csfio is- xs t,t uonoekotdes re χ be nsvj k> c\ nip i, ,o »N k p>- wets, eigmp.v pronets or ny bi id- '«non pretbe-,
An “t-aikued tt-tciere acul mmeude' means u B\ \ m RN \ ot re tanme mRNA, eO'NN, or -y ntltcisc orig-n or some combination theteot xxntelt is not asset sated 'xuh all or a portion Ά pels oneicottd; nt Audi trie isolated nolvnueleottde ss found nt oatuse w - baked to a polvnw, lenndo re< which it ts not linked in nature, for purpose.-; of this disclosure, it should t'c uud-tMuod that “a 'iucGiC acre moici tde ιοιηρπΜΚ a preticnkn rue'- nmN se-jnenc- doenet --reompas.- nxutei chromosomes red ned nucleic aen.1 moicethe- ''comprising' specified nucleic acid sequences may ntehnk*. in addition to the specified sequences, coding .sequences
2016244220 11 Oct 2016 for up io hm m e\ on up to tva'ti-i other protoms or porumis thereof, or tna> iiKiude operabh hi?s„d tcgniutoss sequences that control e'press-on oi the eod=ne tcgion oi tl·; routed hudest add sequences, and or ary m, hide xeetot seqneneeCmcss specified othetwisc, the left hand end of any Mite k· sounded poivnudeotidc ? sequence discussed heron n- the ?' end, fiw left hand direction cd double -Handed pmvnueleolide sequence- is «eleoed to as the '< dire, tn<n fhe dm ci.on of 5' to ” addition of n iseent P.\ t tmnsenms \s referred kt as the h, inscription direction, sequence regions on die Π\ \ '-fraud h,o> nig the same -eip-.m,e as the R\.\ turns, npl foul are τ k> the 5' end of die PAA tcunsctipt ujc wfio.ed to as upstream sequences, sequence ?eg=ons on the D\A siia-.J home the - nr-e sequence as the P\'\ troi-enpt that ,ue V to foe Vend of tn- R\A lian-eopt art reSctred 10as \lvxji stream -eqncnea-
The term eontrs?: se-on.-n· e refers to s poly nut iswf'de sequence that e.m affect the expioss'on and ntoees-mp of coding sequences <o 0 io, h n is heat, d The wihne ot such control sequences mu -, depend upon the host opg intsnn hi peritcubr embodiments, e-mmw
1.5 seqnesie-es hit poiki-uyotes may include it promoter. a rd'-osooi'd binding site, and a tianss-riptioii termiratton sequence b-.-i ewmiple, control sequences for ettk u votes may include promoters comprising one or a phiraihy of recognition sues tor tranxeriptfon faetom, transcription etthortecr -cqucnecs, and tran-eription termination sequence Control sequences5' can include kia-der siain·;.-·-.es and or fusion partner v-q-i'entes
The tcirrs eetor means any molecule or cnti - 0 nucleic uetd, ptttsmtd.
bacteriophage or virus) used to transfer protd»boding information into a host, coll
I he toon ’espres-fou \ eetot” or expies-een eo-'isom i.-tios m <i sc. tot tn -,t is odHabie let nonsfornatton ot a nosr ceil ano com.-in- muiek two sc«tu.necs du-t duwr mJ or -..ontrul ij?t eoniunebon w Ub the host cell} Csptes-ion ot one m more hekuoivijous <„otht;e tegunts operatively I inked thereto. An expression construct may include, but =- not htnited to, —e,, < i\ es the affe> = of eemrol trjHseidption, irtm-dtmun, and, ii unions are present, affect PAA. spnetne ofa coding tegton opemhb tniked thesetiAs used herein, operably linked'' rneare· thai the eomponenix to which die term bappbed ute ί'ι a 'AmooVtnpfont afowv- mem to eaty, ote ?' ei inhowm umebous unde?
suitable conditions For example, a control sequence in ,·> vector that =- ’’operably linked” to a protein coding sequence is hunted thereto so that expicssion of the prolent coding sequence is achieved under conditions eompidmic with the transcriptional aetis ity ofthe control sequemeex.
The term ' ho-= eelf' means a gd 1 dun ha-; bee?t trati.sfbi nied. or is capable of being tmnsrorrned, 0 uh u -.itidC'C acid sequence and thereby cxpies-es a gene o? intct.-ei I he Serin
3b
2016244220 11 Oct 2016 hu halos the ptog my e·' the parent cell, whether or not Tbe p'Ogeny ss identical so morphology or tn genet'C make-up to the ssogun-d parent cdk so lone the gone of imetest ss psesent rheto'-n· U- msdtttcon' means the t- mMerot genes Horn one ba.t -otun to <methe? usually by bacteriophage ' 1 mnsduction also refers to the acqmssiion ami transfer of p uAaryone vebuiar seqnemes by repbeaoon ddcc'lu setrovni-cs ’ L fe m' tta 'si i t op' ; wets t > .iptahe o*'Rucmr m cow tso'.s |)\ \ lw a ee L an< a edl has beeneirawfected” when the exogenous DNA has been: mtrodneed hwde the cell. inenfPs'uto Λ un.isbw of trans*cotton ti. htnques ate wed Known tn the „n t and me disclosed beretn, hoe, <,g . Chahant <. > al, ! R~3, t ύ-igogr 32:-156: Sambmok et a/, 2*Μi. Mokxulaa
Cloning; A, LahotWny Maneal, vnyw; Davis: gr M., I.936. Sos to Afei&oiA / n AffilbcgRw
Atu/,>g', hlsm set, Chti rial, DM, Gcoo B PC Snclt technnines can bcuscdto nstrodaCv. one os more exogenous DV\ moieties Into ssihable host eelk
Ute icon 't-anstbrtnatson” refets to a change m a cell's genette eharaetettsties, and a cell ban been transformed when ii ban been modified to comum new DNA or RN A, Cor
1.5 example,: a cell is tmnnfertned where .it is genedeally modified fmm its native stare by mfiodosutg r.ve eet'eti., nt nert.tl we mtnsf;e'e<nt, noesdneoun, or ethos NJuuutsw. I chewing tr.msfeedon or trnwdtsiOmn the transforming DN A may recomomc wnb that of the cell by physically· integrating tnto a chnunosome of the cell, or may be maintained transiently as an P's'Uoa' 1 e item ou'Otst beny x’d e,ei ot r a? -epm ,-, mcepencent!? as ,, p'as? no \ celt ts eons'detee it- kaxC 1«, ar- staop, mmsimmed ski' the uatisfottrnm. DN \ is tc phe ned with the division of the cell, t he icons ' pulypcp-ide'' ot psotest'’' me uw d mn u isungeahly Μ n tn to teles *o a polymer of amino mud residues. I he terms also apply m ammo acid polymers tn which emo or nuex' amnio aesu tcsnhuw is an analog m ostmeue of ,5 >. tm> spending ram ub omtmrsw' amino acid, as well aato naturally occurring amino acid poly mem. The terms oats also erteomp -,ss tmmo acid po’ytueis th>n b ive been snodoted, e g , ny the addition of i nhohydmie re-isdue-s to form ghcoprutmns, m phosphors luted Polypeptides and protents cats be posdneed by a namrahy-oecnsrhig and non-recombinant cell, ot it ss produced by a genciicaliyoiig.lncered os recombinant cell, and comprise molecules having the antino acid torp.icnce of-be n m\ pmtesn, or molecules has ine deletions from <sddumns io, and or O.tbstmtfion-> of one or snore amino acids of the nath -,. sequence, The terms 'polypeptide'' and protein'' specifically vtteompas.-» antigen binding proteins, e.g,, CORP R antigen-binding protects, CORP R binding proteins, .mtihodiu'., oi sequence that Isas e deletions bom, additions to, and ot «tihstdtdtotss of one ot more ammo aettNof ,-.n anttgrtt-l'inding psowiw I he term 'poRpeptsde Imgment'
2016244220 11 Oct 2016 ' feu to n mny peptide i'mit has ,ut ammo-tern seal f \,un. . , at bow'-tern usd f. Gun and/or an internal deiebors. as compared -with the .fall· length, protein, .bitch fragments- may also conbiin modified ammo acids compared with the fuddengih protein. bi certain embodiments. tragmems are about fir e to 500 amino acids long. lor example, Iragntents may
Pc at least s, o, g, 10. I b 20,50. fr h)0. 110, ld0, 200, 250, 5()0, 350, R)0, or -GQ amino acids fom, I sj,d nob pent.>1? tmemew.s u.Gik1c nnwinfutes i. t|i\ ten, 'met-ί uagmc'Cs ol antibodies, including binding domains. In the ease ol a (GRP R -binding antibody, useful haon-ents tin lade mn ,ne mu homed to a ( DK rceion, a ' .liiab-e ifemai.u oi a he e«y o: twin chant, j pottton mart .tmihods chain ot pea u- \ unable ooiumn including two (ORv and the like The'X'GRP recs-ptor''. or ''(.'GRP R'g understood to t emprise RAMP; and C.Rl.R i he tetir· “isolated p,ou.in tc e . isoGLd .mimes, bntdntg pixtemb isolated polypeptide or ''isolated antibody” means that, a subject ptmein, polypeptide os antibody (I t is bee oi at lesst -mm other paoien-s w sib wIn. h U voted notmaby he fomat. (2t o. essenhalb free ol other protems from the ,mm·.- source, e.g., mom the .mme specie-., (3) is expressed by e cell .from a different species, .(4) has been. separated, from, at feast about 50 percent, of polynucleotides. lipids, carbohydrates, or other materials, wbfr which it is aesoeiaied: m neture, s' '> is ops'taEb, associated thy ,o\«lew ot noneosaL-ia mfei«etiont vnh a ρο-y peptide v oh v inch tt ts not associated m nature, m' go not occur m natitic I > pieath. an ' is,dated protein, isolated poly pepmb os Ί5θΙ<οο·ί aniibody ' - oosomtes ,m bak ab-out ?% leao about lO-.,, at least about 25%, or at least about 50% of a given sample. Genomic 1>\ A.
eI5\ \. mR\ \ ot oi'het RA oiGymhetiCoitgip.ot any eemhwmton thereof m.y encode.,'.,eh an isolated pson.m Picfemhly, the isolated pioicm polypept·.!' ot antibody is substantially free from other proteins or other polypeptides or other contaminants that arc found in its natural environment that would mierfete v tilt its iberapesme, dUguostic, pmphy Incite. iesea-cit
2.5 or other use.
\ Ά aoant' of a nob, poowfr to e , m antigen bmd'ng pOicm, of an antibody >
comprises an amino acid sequence wherein one or .more amino acid residues are inserted into., • Hee-tl from -m,t ot suhoiuited into the ammo .« id seoue'W rel stn? G anothe1 pop- pcptnie sequence. Valiants mchute fusion pro tents ' d υ\ no ’ ol, ro'vpeet.d ss , po speptt;»' o < m ar men nt <w „ ptm. η ο» .monody) that has Oven chemically nimbi led m -omc tnaanei tb-miict font, insertion, detenon, oi snbsttRuion v id,cuts, cy. -m eooiugation to another ehenned motor,
-W
2016244220 11 Oct 2016
The term naturally otci *nng as m-ed thromdiom the spceRte.-UiOu in ιοηι-οι mm with binli-gudt mautMts such as nob t\nodes, nueieis' aesds. ho-τ echs, and the die. retem to muieriaG which are Ibnnd in nature.
An ''anoueu binding pOfrtn ' a-' used hetetn tneans a ptoietn that spccdkalo binds a 5 specified target antigen, .such as CORP R, partietuarb. pmn r'e, =, g„ human f 'GRP R \ (' GRP
R antigen binding proiem ,-q'e<. oRjIty binds itts- human < (TIP reteptoi
An audg-.n binding pre-min -, ud tn speeifte.tiiv bmd n.- tareei when the dmsosi nton eoiro.HU t R.d is * 10'' Μ I he anidrods spect f, ad\ lands tits' tai get arty-. n s', Uh Gm h aftutdx ' s' hen the K ts t s 10 ' M In one embedtrnem, the .mtibod'es aid brod tn GuRR R, ip tn b'-uian t t-RP R \s Uh ,$ R. As lo , ή .moth e embodim-rot ?< autibod ., - w-P h nd w-di a R A IP . sn another embodnueut the atti»bodjes wdl bmd w uh a & > A 10 \ tn -eimhcr eiiibedurtx’tit tits' uttfbvib-'s w ill hmd uh t kp Αχ ί 0 \ in another embodiment tbs' antibodies s', dt bmd s', uh -, R 5 - s\ id , tn mmhet embodiment tR antmod^s wd: bmd w-h- si ha>I x ; it ’: in another embodiment rite anutAies will bmd with a hro A-x to !'i m another
1.5 embodiment the antibodies ndi bmd onb a K;;< e t,s 10
An amsbody, unity., n binding fragment thereof or tmiigen bmJmg protein selectively
U'htbpG a -mcedo u, cram », bttfso to othm r -- eptots w hen the R At 0{ .jnttbodx, .nmgen btndmg nagotstti thewr-1 or ηηιη.ί.η biUsdne tvotem nt an inhibition assav ofthe specific receptor u· tn least eO-ioU lower than rise R 4p ;ii as imubiimn assay m another tv n-ren.c” teeeptoi, 1 hs' seieetw u\ tarn» is the K '5ft of the reterenec- tec eptot do ids d ty K Ά ot' th*, speettk tee.mtot An antibods, antigen biroire fragment thereof or tnng.-n binding protein sGecnw-R ufiotuts <R. human < tsRP teeeproi -fthe B'50 ofthe antibods. anty-xti binding fragment thereof ot antigen hrodmu protein in a eAMP ass,tv, e e , i he e \MP inhibition assay a1- described ,n I * ample 4 heiens, at least .Arnold iowet than the R A m pud sunn· antibody antigen bntdtug fragment thereof or antigen btrnhng protein tt> an in''nbroon assay of the human \\t i, AM.'or ,ut ,im\ lm re.eplor te g , AM\ :) PR o.y pfnondmmuig marnnk’ if die IC50 u’a -cede a, t, ί > jRP R mitd'oea m a e\Mp<, ->\a\ ot tR'GRP R s „ a , Ki-sestt 0 ί »R mid Rt t.M, and th,- tt 5b of th,- same unitbod} m « - AMP <osas t«t the h \\i R h AM? or tinman \M\ I iccepfot is lOPPnMot t'.oie P-at amtbo.b, -adecMeR »>dnbus itit· ?'< GRP seeqUot ?0 \n antieen b.ndmg orotetn mat sCeettteR inh'lnm ., speed·. ro».\Ptor i.- also tmdeioiood to be a tientrab/ith' s-amg.-u bunting -not., m o nh te--pe<. t to that tee·, one ' Guigen hmOutg rveiotf' means a protein. <>r a ροΗοπ of a protein, dttu stxetl'Rads binds a specified antigen. ; or es.atnple. that po.rdon of an antigen hindu-i.· protein that eorstams the amino acid residues that internet with an antigen and center on the antigen binding protein
2016244220 11 Oct 2016 s{\ sr», ciίλ'ΐty au-l atbmty Yr ihe U'Wg.-n t\ tet'erred io as 'awi-wo Dmhng reg.uat,'' An antigen binding region typically includes one or more ''complementary binding regions tCDRs).
{ eii'iin ardfgun eindirg r yso; <> akom, hie-e one o- moo tr in.cwos L '5 emeu-, X '\'DR ' n an ammo acid sequence that cotdt ihutca to antigen bindum spccifmuy and dfsmtv, r< 'bi',tme'·>Λ ' regions e m ud m tn tmtummg th.- pieper con in» mahon o’th,. ( DKs »o pmmote binding between the aufigen binding -'..soon and an antigen.
In certain aspects- recombinant -tnogen binding protein-, that bind f GRR R protein, or htiroa' CGRP R. arc proylded. tn this context. a 'recombinant poncin'' is a protein made n-ong .vcni' ι ·’' edit .p,<~' <. , htongb luv^ioso ot meeithu >’w v-.,,. a„id a-d„ wi md it) hen, oi Method1 and techniques 10» the production of o- omV'mmt twh ms me \sei* known m the art.
Tin' term v embody' teters to an iwa,i nninnnogiobishn cd any emiyne. ot ,et antigen bnuimv ifagm..nt met-. oi that e.et s-on-p.-te n ith W-, uttatatitibod, tor specific bn.1dn.1g to th-,. target antigen, and inektdes. for instance, chimeric, immaumed. tally human, and hispeelfie at tibod'Cs V. antibub' .w stab is , so iteso»„u cimyeu b.nd eg ρτοη·' M, .mat i arm body generally will comprise at lecst tree full-length heavy chains and two Rh I-length light chains, but in some lustaucca may incl ude fewer chains such as emlbodies naturally occurring in ca.rnd.id--' which rnas comprise only homy chains, Antibodies may be derived solely from a o-npfte source, nr may u;·- -'ehnnert»',' that «* di'lm no portions of the antibody nay he doused it-nn two .hif.xent .wtihoetcs as de-ci tl·. d nnihet 'oe-'ov- rite amigot, hindiog ptoL-ms, antibodies, or binding fragments ntay be produced in hybndonxts. by t'ccombinant DNA technup,- s, ot by enzymatic w chemical cleavage of mta, t auliboehcs I nless oth.-rwiss' indie-tke, the term ''anttbodri' mGudes, in addition to .whbedies comprising wo fidi length heavy chains and two full-'' ngtti hyhi ehams, densutsvs, su'iatfts. lim-W'-nt*·. ,nd mutations thereof, examples of w hich arc described betow,
Thelen-: hdn chum'' niciudes a tpheength itgbt chain arul fragments tb-..reof h-tv dig wittc-ent \unable ivemn sequence to outAt btndinc spveineity mil-length light Giant includes ,-t variable region iinmaiti, V., and a convcno tegum doniam, G; Fh>.- > at Dole region domain of the light eh un ts nt rite amlno-ten mnus of tbs' polypeptide. Light chains include
Lapp t chains and lambda shams lbs' tc-m 'hs'siyy chauf’ includes fidi-dengdi heavy chain and fragments rhcreoF having sufficient variable region sequence io. confer binding spocibcity, A ftri-b length heavy <. I aw un hides a y utiable legion dom -on X . and rice, cnnWini ivyiot» -io-n ,ms, <M5, C ,2. mid (ijd I he Yn domum is at the arnmo-tet mums ul the polypeptide, and the domains are at
2016244220 11 Oct 2016 dm carboesi-mrinunm mth the C»? being closest to she uslwybes'msnus -m the pob.peptide Heavy νίηπΏ'. may be of any i'W\ p<.. meindme IgG (including k<J i, lyGd, IgGe and IgCG soirtypA, IgA tindndmg ;g \ I and IgA'’ Ay' -s, igM and Igl he term signal sequence”, leudi.t sequence' ot 'signal peptide teters to a short <3p A amnio acids long) p.-pride , ham th n dm,ets h · transport of a pretem Xigm-i txpttdes may also be called targeting signals, signal sequences, transit peptides, or localization, signals,
Rome signal peptides are cleaved trims the protest! h> signal peptidase after she proteins arc is unspoiled, -meh that the t’h'iogi·. alk ac0\e hum of the protem te g , <m antsgen binding protein us described herein) is the clem cd. shiner form. Accordingly, terms such as 'antibody eO-upi'i-ang a heavy elnuu ”, ''antibod) composing λ IseM chnsn, ”, etc , nhere the antibody is eharacterized as htu s< t hem s and ot hetu eham u sth a particular identified sequence, arc andeisioifd *e meitsde it <. dies ha-, mg dm spa, on 'deioifted fc 'em n Vs, embodies Ku mg the specific idenvfsed sequen.es ev. ept d-at the signal -runon-. e-< ate repiac-, d to OoiefetU signal sequences, as well as antibodies hnvsug the identified sequences, minus any signal
1.5 -sequences
I he term anricen binding fmgmem' lor fimpiy ”fnigmeni'“t of an antibody or imrnimogbhsiM chain (heavy or light chain}, as used herein, comprises a portion: (regardless of how that portion is obtained or suithestzedt of an untibod'. that lack- at least -osue of the ammo u-ids pies· t** m a bib-length ebam t'stt whu h is capable of sp.-t itiemty Hndmc to <sn
2(f ummer xu<.t> « no tet.m i„'m >,« J\ jync n to o t tey be d si-„v to dm tarn't antigen and can. compete - wi<h other antigen binding proteins, including intact antibodies, for -,Ί,ί. it,e bt 'dt 'v to a j' ms ep ’m· I ι>τ.ό \i? s\>' a hay us. m v. t sckn at least -me f DR present in the .full- length light or heavy chain, and in -ome embodiments o ill comprise a single Ucm y chasn ami ot baht ebum o*· portion thereof 1b- >-c biologically autoc S'mgmcms omy be
2e rsoGa„ed 'v r,combat tot D\ \ techniques, o: ;-u\ b„ psoe.ccd l<> . cunix >n , be-mval cleavage of antigen binding proteins, including intact antibodies. Imnmnohagie.-db tunerioqa! tmntnnoelobtshst Augments tnehnk, but ase tsof bmikd to, t-al-, i-'ah', t-fabd , I-', donums antibodies and ri-igle-cbaisi antibodies, and may be derived from a-n. mamm.Unm so.h.w sin ludu-g but nut burned to tnmun, mouse, tat, camelsd or nibbit it c- {.oistempkted 1 -isthe:
?>) that a fbmtton ri portion ot {be antigen binding protems disclosed Aem, :h* Aeropie, one or mot..' CDIfo, could he covalently bound m a -eemtd pioiem ot to a -amd5 molecule m esc ne a iherapeuuv agent disemed to t parttertbm target m the bod', noAsMtm brAmel»mm diemp/ntte psopcstst.·, or luoiii: a p-olo-tged --einsu hali-isii.
2016244220 11 Oct 2016
An I no ftagtnem'' is compr-wd 0 one Yoe oit tin and (he C- 1 <md \art-tbi· reemns of one beaky dune ι he h.aky cYmi ofa fee mob vale eatmot term a dtsuiride bond w th another boasy chain molecule
An 'Ye'’ region contains two beak \ ehmu fragments comprising the (Yl and V i?2 5 domains of an antibody. Ϊ he tw 0 hew, y chain I ragrrtenY are held together by mo or more hsnhblc bonds anti by hy ΥορΡοΥχ miotau.ons of d,- ί 4 dom nn·\n c<-e frngme'd - options one kt>h' ri w.n me a pmpon of one h > w\ chain ih 0 donums rise Y>( donum and tY. i':(i donum and aRo the union between the (it i and Cp2 doi u to s>.eh ι > mt rk’ca 1 e, nHscc ho d ear v fotcaer Ywr p c oko hea'i canso*
H) t\\n hat? Ymmenw io form an t'Yb’)> mobs pk' \n '5 pm)- Itcmnust eotke.ns two tight ehams t-n,I two bc<o\ dun's eenu mm. a portion ofihe constant region Ροΐν < p die f Y 1 tnd Cn? domains, sm h that nt tnierot«nn disulfide hone: 0 homed between the oso 11--.:0} elums \ 1 't ah'?.- ftagtnent thus is composed of two V.ih freemews die t are hold together b\ a disulfide bond between the iw 0 ;v,o -, ehmr-s
The 'Ύ Tcgfon c-wtps ses t\>. xas 1 Yle tegmns oom both the heax \ -,od tight thauis.
but lacks ihe constant regions,.
'Yingle-chain antibodies'' arc Fv mole-, tiles in \\hteh the heavy and light -, iiain variable regions have been connected bs a ftextl-ie hnkpr to fottn xt stngk poivpopr.de chain, which ferns -in vmg ’'i-h-o.hng te-,ροη \ini;k' -,hupi e-tibook's are dis; ip-sod m det id nt hneniuttonn't Patent Application Publication No. “O 55 Oto-b·5 and {’tided bnoes patent No 1,9 to/YN :md No b,Y,ft 20?, tlu dis-josmes pf which are incorporated by. retercnee
Λ Ylo-mam antiho-ls’' is an untminoiogtenib- Fnneticmal nuriiinmgdobnlnf fragment eooiairtirig only tite variable region of a 'heavy chain or ihe variable region of a light chain, bi some n*tinn os, two ta mote \ oopops are ctw den Gy lomed with a p-, pride timet rp pe a,- ti msa et. d.oT.ue anrihods 1' e *wo \ 1 '» gams ι-t ,- 'nsalent dt-'ti. to at tioods n e> tinges 'he Mine br d i f Te rent anti gens \ bo :d;m tndtgen Inndmo protein' or Ysakm atitibodv ' ei-tnpt'i-es two antigen i'm-ht.g sues Υ seme itUdiu es, the two ti nd ng s tiw h,t\O 'ho s,nn anno n sp a tii„m. s Bnu-et, ,mt pen I w.hng p-ote as m-l I -a\ * amtim-im*. ppr Y 'nspe, Y , (i, a-;?,/
A Yeeltispeclfic antigen: binding protein’' of 'xneltispeeifie antibody’’ is. one that targets more titan one antigen et epitope.
\ 'bistxenb..'' 'died speetn/'or biiim-umiiah' mrigen bmdmg ptotem or antibody abkbrid antigen binding protein or antibody, respeerixoiy, basing two ροΎνιιι antigen binding s,us 3)spevrie wtrinen I eklm. Ptutep'.s at J ,n nn-kris's at r a sooitos »>: nm i,sp„eriw auri^er
2016244220 11 Oct 2016 binding protein or mu hi spec site antibody ami may be product d bv .·, mttek of methods including, but not bruited to tnstou of hcbttdotnas o; linking ol fab’ bagnKuu ng, Stingsivilat atid Laehmstiti, 199(1, OM Xbyr fin&titnei 79:315-321; KoHeltiyO mb, 199201 j 4s ' η P-150 3 be mo hntdno. -tics of a bopecdK antu/cti hind.ng ptotytn ot e arm mJ\ -t tb bine ti1 too diOtev ep'.t mes, s nt, n may se-’d. on tb, same or dtlfcmm ptotetn targets.
The derm “neutral tzing antigen binding prototb” orOetifcdmngantibody”refers io an ant m t, binding pioiesn ot ennbod). « esrvep\ ely, that btnOs to e 1st.and, pie\.η- Intidetug of ttie h-L'.nd io o- hndtug pannet ano mtertupt- Ibe biological response tlv.t udierv-ise n-ottid ts-utb it) twt the hganti b u-.bug to iu I tndmg partite1” hs tso’xstng th- binding m.Bpe· oiem of m ttutt gen binding protei n, e.,§;, an antibody or tmniunolngleal ly functional and gen binding fragment thereof) an antibody Or ftagmeat will stibstandnily inhibit binding of a ligand to ip binding putim t o hen an - o ess td amus'd-. tenuse- foe tut min» td busdusg pattne' bound to the ligand by- et Last ehout 29%, 30“.·. -19%, 5O'b>, OOP, ?'0%. SOP., b5%>, 9(1%. 95%. 4/-%
P oo'> ,,){ ntott {ts n i«sms.>; th <it , ?·;-< cor eu hove b.ne.ttg w-sa·, I b'*k case ο4't PGRP R binding protein, snob a neutralizing molecule will dimmish the ability of CGRP R io bind.
{ GRP.
the term eoi-npcGP when tt-ed tn the eont<.\t of antigen bnnime proteins that treo fund the „iio fegatnt on a Gtgci .mtigeu, nt an· tompeti'nm beiveen ant-g ’u bmdmg p oteusx ts d'Jesmtti'.d b\ an assay m n, Deb the anthers binding ptotetn ρ g , antibody or hrnmtttoksgPalo. iorsmtona! antigen binding Pigment thereof? under test presents or inhibits sp.ei.tlk' binding of u sele-euce antigen binding pttuetn *>\g . a bea-airi. om reletettec nntlboiiyl to a common antigen to ?., ('GP P R or an antigen binding fragment thereof) Λ to of a min’dpr te lompC'-Ptie b·tid>tig as- q s <„<,ts be toed ot exu'up'e soh.l phase Ί-.. 11 to t- dm m otdivirmnuneassas tΚ1Λ\ solid phu-s'Ottee4 of mibrcct eue-tne tinmuns\tsM\ Π ΙΛι. sandwich eooipef'm-r jar t- > 4 N-y-p ?,,9, ίΟΝ», H<5» /, ·?- / ·?-','??% o 2 l?Ps lg sid'd phase direct biotins', trim 11Λ is·.. cec Kirkland >.e {</„ |9sb, M,pG'.ti'd -b.PRH sobd pm*- doom hibe'ea assay, sohj phase ,b’> t f label' d samOs i> a assay G e, < o Ha ton anti Latte, lobS, BoG·?/·'<·>, J G/i-o<P>n <'old Sin lug H nbpj press), st<hd phase dreP Gyp p: \ mine 1 ?e h e %-><·? .. y \b‘rel umP '9hS, Η·Α, tiyom -/ ?e 'e?x stfhd phase dtneet biotin-ay uho I I \ me t g, ( Itenttg. e/'.-.d , iO>»{g t ·<;<' j..7o 540-552), and direct labeled. RIA (Moldenhaner er nf, 1990, Seun/f <X bwuwf 32.:77-52). Such an u-sa-. niuy insulye the use ol puntied antigen hound to a solid -untie, o*· cells beatmg either»'!
th'*se, an tmlabelied test tnuiucn binding nrots'in and a labeled rePrenee antigen htndtog
2016244220 11 Oct 2016 pm *’1» ί ompee^'xe tnbfo'lton 'nay π„'Ρ-,;ι’ >d 1 y dot. ?’!)'n ?g fi< an.onr* ο·': ,·Ί bo mJ the solid surface ot cells m th; piCsenee of ον? test atwgen buichne protent Antigen binding proteins fo.-w-fte-l b> compel t -m assay t> map ting ntogen holdout proteins! mehi-lo anog-. r binding proteins bsttcung ro the same epitope as the relerenec trnngen binding ptotetn,- and antigen binding ptotems binding, to: an adjacent epitope suffieiendy proximal fo foe epitope houwi by the fctc-vm, e antigen bw-tnig protein bn stetatc hmdiauce to ολίρ ΐ Isiudly, ofo {! a competing antigen binding protein: is present: in excess, it will inhibit : specific binding of a releienex antigen binding protein to a etnutuou antigen by o least 40%, 3% ., -?(i%, ss‘% >:fo%, 653·», 70% or 75%. In some instance, btndotg i- inhibited be a* Re n So%, -\f<%, ’fo ’.», %%, or
97% or mote. Competitive inhibition may <?Ao be mea.si-n d by atitnobibdug a ?>. -brewe antigen wodwg ponem to a -nbstiate, e g , a sen-os idnp espinone awwcn ott the -ubstiate vie binding fo foe reference aniibody, and assaying whether a diffitrent anttgen binding protein <a 4 ompciuig antigen bitubtn.' rrotem'> can uklttionaih bmd to the antigen An example of the hour eompvt'.me binding -ssay .'innlovsa Gwcoc analysts t td is fomcrfoed nt 1 sample herein.
The term antigenor ''immunogen' refers to a molecule or a portion of amoleefoe e„p foie -a g '«ο bound by >; -lectixe bat'd up agent, s'·- b is set anw en bmd'ng p'-oten ( including, e.g., an antibody or jmrriunoiogieai funelionat antigen binding fragment thereof!, and additionally capable of being u,Sed In an animal to produce ans<bods>„-s capable of binding to that antigen. An antigen may possess one or more epitopes that: are capable of intcraeffog with dttVewni binding pnn,dm, ey, we bod io the icon 'epOopc s- th. [wstiun of a moleenh* that n bonne ny a.u antn on binding protein (lor example, an antibody?. The term includes wiy dvtemnnmt capable of spemtkully binding to ui awu - n bwdwg piotem, sued as a»? wtobtaiv or to a '1 -ci 11 leeeptm V? -, pitope can be contiguous or non-eontignous (e,g,, (t) fo a singiewhfon poly peptide, atnino acid residues dt.it ue no? cwnfoowis to eno mom-, r m the polypeptide sequen.ebm hia? o uhm m contest of the molecule are bound by the antigen binding protetu, ot οι) in - muitimwie receptor, e.g., CGRP R, comprising two or mom individual components, e g R-Albt and CRLR, amino acid sesidius prewnit on two os more of the in-to ab-ial components, but that tviihtn the context ol the muhsmeric receptor are bound by the unmet· bntdut.g protein) In eeoam cnibodnuows. rpuopes w -e, be non-etic w dun they compii-w a fwee dimensional structure that Is simil-u to an epnnpe Used to generate the antigen binding protein yet comprise ti-tr-e ii- ouA some ol the ammo at id ?es'dncs toi.wl , that epitope a- ol to gsWxtuie the at tigerbjftdntg pioiem Most often, ep? topes- re-ode on proiems, but nt some instances wav reside on
2016244220 11 Oct 2016 otb'-r kinds of meh t uk's, <-nch as nw leu ;·,> u1*< f pttopx' delsmuroanis way in- hide t henu· ally aGtxe sunaee gio->pwe- of' molecules suds η> imroo acid-, sneat xid: eltatus phospit-'rx I to sulfonyl groups, and. nuy haxe specific three tlitnensioual sh net. urn! ehnnugerGlie*;, and/or specific chaoce t. he; act.u {sties, Gctsccalix, antibodies sp/ctbr tot a pastiudas t,ug„t .robgcit ? \xsM preferentiaily reeugwr-γ an epitope oo die meet mitgen ir a eomp!e\ mtsinrc of proteins are, o' 't'.u or oh<- -des
I he tern· 'bdenbod' refers io a i-elaitunsfup hetxxeen the sequences of two or mitre po:x peptide molecules ot too ot wim $iu- ten at t,1 itteicenk s. as deieinnred bv alromne and comparing th- sequences Ikucent uknmy' weans ihe pet cent of identical residues between the erwo acid1· o5 nut leondcs tn the compared mohs uk's nnn ts . ak ul.ii.-d based or w>,> st/e o·' the swad. 4ot dtu ) tole-ales ben -computed I ot these vukn utu-'ts, cap*· tn a ig; '.rents < p my) must h, idd-'essxdbx a purnookr ntarhemaiual model or computer ptopr an p> < , m Git ondftn) Method^ that e.-at he used to , uPtOute the trienoo of iG, -digued rue* te a. ids ot polxpeptides include those described tn Coen 71/0/.-07% .PG.Yx. s'/cn iY-o/ogt’, <1 esk, A. M , ed i,
1.5 I'iXS, \'cw 5 ork (tsdbid 5 aiixeistty fifes*- Bioeon:putnse luioioiaiics ano Gknonu biotceis (Smith. k>. W„ ed. u I dot, Neve d ork; Academic Press; Computer Artaly si-- et Sequence Data, Part k ftruffn A M and G-ffifm. II G ed*< ; pG-i x\ k'isey : biot.ats Pu w, x-w I k'fuje G., 19X7. Sequence .Analysis tn Molecular Biology. New York: Aeaeiettne Press, Sequence K tao s's P' itv iGr χχοχ,Μ atdGe--fe x 1 ed* >, ’99! Y w Soil M Bto--mu P ws, and Canilo -7 % P-Rd, AVJ l/o G'yeY.x/ YG/Λ 4SjtG3 hi oalculudt „ p. cent identity, th/ sequences hero,a competed are aligned tn a way that gtses otc 1 ages'- ta-n , ts-twcee die seea-ees Pa em-ipu'-c' pugg eu ese-l to J.-tetf uee percent identity ts the GCG program package χχInch includes GAP tDexeretrs vGnY b/h i, \>r / J-1 i >G χ ί 2 G7, Genetics { ompuk'f Group, 1 wxeistiy id Wts, on-ro. M-adson. VYh pits' computer -ugordhm G \P ts u-ed to align the two pnlxpepttdes ot poiytiuckx'fnies rot
Much tits' petcent s-wustne sdenitfx ts to he determined Γη·, seqoeui.es are then·ί! foropimsul «bitching of their respective ttmioo acid or nucleotide (the “watched spank as determined by the ,ih:on{bm) ί gap opeun.g penalty {xGn* % ts eak':d.«-\i as ?s {be axetege dn-genak xx haient {'ne ' axe-rage -Ρ-ιροη-ΐΓ ts the axefsige oMhc Otagon-n sp'ote eompanson maittx Pena ?d used, the Ύη,,οοη.Ί'' is the acoro o rtttmbe’. otgned to e tch perfect ammo acd tn o, h b\ die petlu tear -. eiiiparuaut tn-nnsi and a, gap extension penalty txUnch ts u*nahy 1 Id 1 iw>, * {he g.en opening penalty}, as xx-ell as a comparison ntatr-.x such as PAM 250 ttr 3L0SPM «2 are used fix eomu''u'ta>u sxUh the ah osol-os hi sSti-no enibodt-nems, a oatniatii eompnu ,sxm m„*trt G-t, l7-tG οΛ st oG'9 r, IG.o ,e G.W w M-iNx , - mW on e< Go 2 a P xC h« h,l’\A120
2016244220 11 Oct 2016
- ompat'son m Memko·'!', ,j,’ IRC Ρ/,ρ \<m a a.' < /',$ » So 10 B G·Rtio fRBI OSl Μ '‘·2 eompartsou mains? is aRo u*cd b\ the* .ilgmitlim
Re commended paimnctcrs iqr determining per? ent identify for polypcnn-l ’so·' nudeomk sequences using the GAP proemm -.no the ioiloonte'
Algorithm Xeedxnnm mo/ U>>' And -ΒΉΤίΑ
Comparison 'tktttix Ri PM \i r<2 horn ikntlodl ,n(;, lm?R m? or Gap Penalty: 13 thm '-Gth no pemdiy for end gaps}
Gap I '..uglli Penally · 4 I hreshoid of Similarity: 0
H) i'erl lid ahgnm,-m m nemos lor aligning eno ammo acid oequcne-. '* may resuh m matching υί only a short region of Ute wo sequences, and this small aligned legion may have vmy h-gh sequeno, ideums >,\cn 'hough ther. u> no s'emtk mt reiaPontimp b io enPr-twc fmi-1 nPk sequences Λ>. i osdmn iy, rise sc5 ι te I alignment metiiotl A1 \P peon; mu can I»' adjypfcd o' «ο dc^red m refill m an alignment that spans at least 50 nontiguous amino acids of
1.5 i i r«target polypeptide,
A* used herein. sub-mmt.aik pure' means dr t 4u„- described *reeies of molecule is me predotninafii spe>. ies present, dint is. on a mylar pits'* ti is more nbiuidant than any other rndss ideal -.pcctcs m the smne mixture, tn certain embodiments, a scbsiantiulB pate rnoteenie i* e '(.imposition v, h' mm Pie elycR spi\ : ->* eompos· * <p least yp», ίί5Π 4, oiokn basis'» of di ma. iomoleeuiar spec.es present In other embodiments, a sub^mmiB pure compo*si50o mil compose at least 1¾ x?%, 4tv ,.. <>?-,., or PR << ot ail rnaer 'moiecular species present m me composition In odiet embodiments, the objeu speeds is nunfted io essential homogeneity nne’C mnt «meat ng messes *,mro’ »\Ά*ι'd n *' s utws ιό'* b\ com cm oral deteeuon methods and thus the composition consists id a \ingk- detetdahk ni isromoieenhn speeies;
The lent: fm-atlng'' refetx to any indicia cP success so the me.mnent or amelioration ot an injury, pathology or condition, haduding any objective or .wbfective parameter anch. as: abatent* up n-mission, dmt-mxhutg of symptom,* ο<- making the mjm'y, pathology or i omnium mote tokrabie Its Pie p-meuu sloe, mg in ihe rale of de;tenettPtou or decline, making the final poi nt of d egeneration leas debilitati ng: Improving a. patient a physical tir mental weitifeelng.
The Iteatmenl or mnchotut'on of symptoms >, an he based on olne·. use or sithjeetise perarneG-r*. meladutg the result-» ot a physical c.santinaoot', ncurcpxseiuatrte ex mis- and ot a s\ ( mtt'i, „ ^a'aa.iie’ Io „\amph' c Pout me hoos pte*$ t ue he » usut.csslt! . e-ai nusp-ae.e headaches cube! proplr. lacnc/Jiv ot ,»-> an aside Pcatm-id, deetc wry lit- hcqucncx
4b
2016244220 11 Oct 2016 ui'migmme headaches. deco-using theseceniy oGnigmit-e headache.-, and or anchor tf-ng -. symptom .ixxv:ust;a e, uh nngw»nc txadaehes \n elR·· H\c amount'' is general·; -n amount sntYte»·..n- io redtue she severity and or frcquoucv oi'.symptmn.s, aksrnrsntc the ssinpionos and et' umktlvuin cause, present the ot.cdrxnce o*'symptom·, and or thou underiy mg, ause. ao-j or smpro. e or remediate the d enuqe that oomis bom ot \s assocum .1 noth nugmtre headache Its some embosh munis, the edectoe amount »o a therapetmeaiU vt'Dem, ,· uxouoi of a prophybgite.dU etYeeo',.: amount Λ 'the· co one eR ofl· t Poe anu-eM'' ts ,m amount sutYu -„nt to t.-me-.R a oi.seu.se state t, p rmgmnte hetuhtche} or symmoms. parisenUriy a state or symptotos associated wtih the disease .erne. or other's »se pxxem h-adeo febo J or r,-\, ;\e the progression o- the disease state o* any outer unde oral de symptom associated vGth the ds.-eux ut rate oto ohatsoevet Λ ''p’ophyiaefu'aily eU'cettse amount is an -nnoimi of a pharmaemattcal composition that, when adomn.su, oat to a suhteef, oth base the intended p-opt'. Rone effect, ·, g, picveumsg ot d-i y mg thv onsu tor xocem'reneej of nugranx head who, or reducing the likehhood. o' the
H ons.-.to too, eur.i. ee. s o'·' turn'.me hcuma be o t ng a te' ead uhe symptoms l'e I d therapeutic or prophyUetii. efieci does not necessarily occur by administration of one dose, and ma; ο» t nr only afiet adtnmtstr toon oG» χ>π,.Ν oGtos·. <· Thn.s< t -hempenm ally ot ptpphc'iuciicehiy etYecove anttrnnt mac he admnth'temd m one «r snore admimsfratiostri.
“ Vmno acid'' sm. hides its normal meaning m the an ϊ lie twenty n.uurdtly-occurring ammo aetd·. and fitsτ abhrecuitton-, follow comeniumaj usag; .xe, Itrnnuttoh-gy·,Y Smiths s;s, 2nd bd'tiom if o Gohth and P P, Green edsj, Sutaiter Wox ties sunderkuxk Mas< '<r , xu po at ett. e tl· te.ex x> ο» , t pi Xtcisoiso ir sr D-ammo a test of'the twenty souvent'-erttd amino acid·,, unnatural antmo· <teids such ns «••jt-dtsubsntuted amino -u. ids. X-alkyl ammo aetds, and other uiiconseniimiat amino acids may aiso he suitable components rnr pgl\ peptides and are nxiuded tti the phrase annuo aetd. Examples of unconventional ammo acids meiudc' 4-hydro\vprpiin·.'. . -eathoxy glutamate sA.X.N·· ifimUhy hsstne. <. 'X-ucetcIRMix, G-phosphOsermc. -aeeiy iscrine. X-fe-tn'tyht'iCthtontne, dtneihy ihtsbdme, >-hydro\y Ιν,-,ίπο. >~A-mmhyd;ugtnme. nud other similar ammo acids and nmno acids O.g, d-hyd'-osApirrhu.·). In its. poly peputR notation us,.d herem. ilu. ieb-hnttd direction the amino xnum d direction and the right -hand direction Is the carboxyl-terminal dueenott, ot a, cordum e v. tut xm.kiid usage no! eouxeutton
Antigen-binding portents th 0 hold < GRP R, protein. including hutu,m t GRP R thi t 1RP R) uetsmi see me' ,.Ld hcic n 1 he . nt.yen huid m. melems ptos med m.
2016244220 11 Oct 2016 pnlypepfides inh) which one or mdw? complementary determining: regions (CDRs), ns described herein. arc embedded and/or joined. hi some antigen binding protents, the CDR- are embedded mm a ' fo.oicvvoi G temon, which orients die < DRpst such that rite proye1 antigen bmdmg piopcrttes td the CPRt-t ts achieved. In cettend. antigen binding protents diet no;
provided can intcrlcrc n Ith. Mode rudttve or modulate tbs' internet:©» between CGRP and ( GRP k.
Cenam antigen bmdmg proteins described herein .>rv amibod'-es or are derivedfrom animori;·, *·> hi, count embodiments, rite poly pepinf. site, tnre td the anOeen brnding ptoteuis t* νΑ f >vt ojtd.Ji e I mo η n „e ft< motovlt t f v, „s nspCv ' <. t nt booths
H) munhori’es gsovnam .uUtbed’es, ,>y nine,u embodo's (xoo.cwn-. < tmetred to hem-u <·\ ” etubotb, nomeuM'?, Gmneoc annbo»iie-. humanized wtUtbodu's, onmatt antibodies antihods lustons * son:·,.time4 referred to herein a-< Gmiboriy iO5nugates'\ and Ifapnietus dteient The vadOitS .structures ate further described herein below the antigen brdb'u proteins provided herein base been demon·>mated to bind to ('GRP
1.5 k, o pasticahn human CGP.P R \s jesetuvu fmriict e Ge e'aotp es b 'ow, e.».m antigen binding proteins xere t/sied and found nt bind to epitopes dtOerertt trom those t-.-imd by a number of other mhfcodlos directed spinst one or the other of fhb ebritponents of CGRP R.
Phe antigen bmdmg proteins that ate pro\tried compete w?,k e.GRP and dterebv prevent < 'GRP bent bmdmg *' us j< eptot a umsequen, e nm arm · r bmdmg pio,<ns uutv'd’d hewn at-' capable nJ itd'nbitmg· ('GRP R .write ttv in partiutiai, antigen binding pmtems bmdmg to the.-e ep.topes eun h tve on.- or moi.- of dm fodow inc act-vines, mbib-trng, -> /or .,/-./ mdueooti of CGRP R signal irsnsducEon pathways, inhibiting. vuxodiMatlon, causing vnsoeonsirfetton, decreasing mPa mutation, ,- g , netu'ogente tnll.nnma.oon, ,md other physiological el feels todnot.! by t. GRP R upon < GP.P binding h„ atPteer 'indine pt ot„ m- dim ne dmtrios, .1t eicm, n.oe a v 5lj- t, o, utumes Sow,, of lit'/ arnigsu binding proteins, for instance, arc useful in speeds binding assays affinity put me mon of ( GRP l\. e, 1 .ck.ni u hi v JRR R o. its bvetid - <wd n sc e.tn. u nssev s to identify' ofner antagonists of CGRP R aeliv riy. Some of die ttntigcu-bbtding proteins are useful for inhibiting binding of ('GRP to (GRP R
The anfige-n- binding proteins eun be used in a v anew of trenmiem appl oat ions, as e\pl -atved heien, I 01 example, e<, riant fGRP R anifgeu-bsnrino ptotcilts ur us>, nd tm ire nine conditions n->sowakd w ith GGPP R medinted signaling, seen n,- redits ion, ailev fating, or tt.-alnit the frequenty ,·.»{ or -.eve’dy e, mtgwutc h.xntacnc, eu-nnn , adcxiatuig or heatntg duster headache, reducing, ailev n-gtag, or ire.dtng enroute pmn. alic-v tatnw or to, atntg
SO
2016244220 11 Oct 2016 diabetes medtoG (type· J])s seducing» alieGaiing, or WeM-ing. esfoioYgseubr disorderes and. eeae ur, t let tat.ne, ot ueating 'temovo uvree oetaug-.t, erw oxeuau d wf end-no xctc a and, sepsis in >.; patient. Other uses for the anti-mn bmdmg pi'oieiuo include, for example, diagnosis o* t1 IRE R as-oeiDcd ti >;„>·.·- m eordujnnx e,<1 <? ,011, a -.sx.o χ ίο dc’crrr ire fee -rexenec or absence 0'«· vRR R, Some of fix antigen binding proteins described her.,m are useful in framing oonxettueneiw sy mploms, anti ta the pathology >im«. utetii st iih «. < il\P R a. tix ify These inelnde$ but tire not 'limited io, various typos of migraine headaches.
id'j.E.B...R.iGsl.TG.
t he antigen binding proteins tiisefoxed herein fond to CGRP R. nt particular human 10 CoRP R CGRP R is a nmlthnef that >tit hides both CFG R <nsd R ΑΜΡί The nnei< raids' sequence of human CRLR in provided herein ax: SEQ ID 'NGT, The amino acid sequence of htnna-'i CR( R is pros uh d he-'c-u as SI Q ID Mb? flic no-. Cm.do sequent 0 oi human RAMP I 1- piovided herein as SLQ ID M4 > Phe annuo a. id se jeenc of hem m RAMP! is pi - mdheicf ehVQDNOt Ito 4 Gc*' u di p o+en χ <'ese’i w , e! i id me
1.5 extraoe hut ar portion of CGRP R, Which comprises the eycaneihtiar portions of CRLR anti RA\i'0i An .'\empia*y /stra-Mlui u domain ('Ή P''C«* human CR1 R '-encoded m P.„ nut leotide semic-nee pres-.-toed is Sf Q ID NO 5, and ίι-,χ the arsine .λ- td seoaotne pre-onrex! 0 SI 0 ID Nt M< 1 'as s.qut’ue etomdex .1 s.et.a. oeomk. ,..;i e.sensp.a.,·, tram,. >m.nus th.
.-gmfi peond-’’ ί PI P 11 D has the amm-’ <, > ί x-’quen» c p esemeti <-χ M Q ID Μb Id An ewioplatn 1 (.'Dot human RAMP; u; encoded oy the nuekovdo,··><., qn«.iiu picxcnteti as $i-,Q ID NO ' and im- the amino tom sequence pr.-sented as SFQ ID NO a ih*-> sequence meind/s a signal peptsd-., an exemplary m/ttuie «minus me -agnat peped.o R MIPl I CD has the amm-’ acid ->e-qnene..' presented a« SEQ ID Nt,t I i As described bdew, (.'GRR R prmwns may also include itia.manUx As used hetem, tin. terms a«e used mieteh-ntgeabiy to mean a reeepiot, m ptoitcuhit. unless otherwise speeded, a human mccpto? that lands speeifiealti. u» < MRP
The tent; t GRP R .dsn m„ hides pesMt msDifonaa rnudtift mono of fine CGRP R ammo acid ^gtixnsa, for commC, possible Moused gl eeosx Gum sites fihn-. the «mug. n btndine ροη.-ηη may i’lidiiwii a, getter nod non' pom, ms gly , osy lale-d <u mr ot more e4'the positions.
\ ··> a« wiy ofixeto'lrxe -ending ng-.nt- useful lot regnbUing G-,. achx tty of CGRP R am provided, fhese agenu include, for instance. antigen bintime protents thut contain an antigen mi dme do u.ui'« \e . srnvle 1 ham antibodies, ,h»n«m aultbodtes. 'mmuroedhoxOtf-, tnd polypeptides with, an antigen binding region) and speeifteally bind to CGRP R, in particular
2016244220 11 Oct 2016 hsun ·,« 1 GRP R >omc ot the ,gv»G lot ., sample are ih: fid m mbd-ttmg toe bmdusg ,4' CGRP to CGRP R. and can thus be used to mhthn, «nericre with or modulate one or mote aenvtues as->pet,iiee wuh ί GRP R signaling
In general, the antigen tontout, proteins that ate prox ided ivnieatlv comprise one or p more ( URs j-> d.-sertxd herem u g .. I, ?, 5. b a or ol hi some instances, the antigen otodirw pjotem complexes po a polypeptide spoenue and (ho one ot mote CDRs that ate warted U4o and o joined to the polyp.-ptole struetore I he pol\ «eptide structure can t.4,.- a x unep, of dtlfetet.it fmnis Pot example. 4. e..m be. ei compose. the fr.oneo ork of a uatutallx ocemting antmod·,, oi f.agtnei'U or sariant thereon rr mac Pe completely synthetic nt nature i samples itoxarsoip polyp- pinto xtnictow4' am fm'tn., r 4ysi nhee mrion
In cerium embodnnents, the polvpeptsde strnetute ο» the antigen landing protents :- an antibody or G derived feto an antibody, «winding, but not limited to, nwttoetotob antibodies, btspertlk untsboibe--·. mitoboritos, domain 'ahtibodir*. synthetic antibodies ;sometimes referred ίο he?em as ''iwhbodx rmnwiseCto chimeric ants bodies hnrnanized itnrihxiiey antibody
1.5 Ifisto» toomemmes mh-tu .1 to rs \mtd oris iotswg.«esl atto potmms-'i h ugt e»G o*'cai h.
respeetn eb in seme ;n-ri,«wcs. the ato.gen hmtong proletn w an nnmuttologfe ti fragment of m <ii4tood\ V 4 , a 1' t!\ a I λΡ , a h(ah 1 or a I s 1 The s a nous Ottwnnes are furdwa descstoed and ,'ktmed heist»,
Cott.on of the' antigen hmdmg piowm.·, a*» provided harem epe> ific-dly h.n.i to hunuot ((IR P Is hi a specific -. mboibment, the antigen binding proient spsCitiealty binds to human s1SRP R ponem comprising human ( R.LR having the imino said .sequence of Sty) ID YO.2 and human R WI PI has mg toe annuo at id seemer-ee of Slid if* \i5 4 in emhvriiroertC « here ihe antigen binding ptotew is ust,b lor towapeuRe tppi >„et:ons. at- antig·, n binding ptoteut e m inhibit, mtorfetc xs uh or motototto one or mine btoRtgieal aMtsdies oft {IRR R. in (hts cu-e, mt anot.-. it binding protem binds spt.mticnity ami or sitosiusitsailx inhibits «mriing of human CliEP Is to CGRPxvhen art e<eess of :n4-body reduces the quantity of hum.,» < Gisi’ Is G-und to CGRP, or ι-n’ hx ;,· least ubout 20%, 50-, 40%, 5(ι* <, i-O'', 70!'<·. x0%, 05 % ’!0% 95%, toy·,. ,·>; ηχοίν ifor example hy meusiintig P-iadhig m an ’u wro.· eompet-tw, binding assay }.
Rome ot toe atxrigen hindine proteins that me provided base the -tmetme tx pi-raity uxsocistod with oatitridly ooctirrmb tmfibodtox. The sintetors! 'units of these tathihadtes typti adx compos,' one oi mme ietiamets, ea,'? < on.pnseri ot too ntoom al t onpiets ot gob pegs ,L cyans· ttowgl son e spe. s. ·, o* ot immtrs a·;» rroduee iwisbodte. hax i >e tv,x u
2016244220 11 Oct 2016
Angie box y chain bi a typical antibody. each pair or couniei includes om- fris-length Might' chain (fo certain embodiment about 25 kDa) and one foiWength “heavy* chain (in certain embediroesifo aboui 50-M) bDab Each mdiv sdna; nnuiunogiobiiiin eh bn is xuiuposed of -.evetai ' smmnnodohulin domain-'', each censistmg oi remghlv A to 110 annn« ,u ids and expressing a chameforistie folding pattern, These domains are the basic units of which atmhody pel-peptides are composed, Ute aiinnu-leimiwu portion m cadi chan· tynmuliy mehidvx a ' arable domain that is responsible for antigen recognition. The carboxyeerminai portion isnsoic conscivexi evoinooifinils than th» other en.lot rise emott and :- lefet-'cn mas tlie ''constant tegfosf' or fo' region i lurnan light chains genemily are classified as kappa and
H) frn'bda fight. harw, ,nι>I each eT' these eec'aius o*ie vatnibie desna n and one -, oust on domam I teas s chairs ate t, pieadc c asstitfo o mm deha. cui tri u aloha, oi cpMtee chan· ·>, atm C esc define me antibody x woly pc is igM, IgD, IgG. h k und igk-expeeuv A ig.G has \cveial .-ubtypes, mekidmg. but nm Inimed to, kj.G 1, igG2. hjG Y and igG4 tg\1 χη'οΐνρ» s mJnvk' fg.M ano foMc I gA subtypes mchfoc In AI end ieA2. hi human- the kA and igD iv'Typc.15 eonfimt four heavy chains ami tour I gin e'-ants; the IgG and kb isetypa- eont-un two heavy chains and two light chains; and the IcM nmfvpe connhc- five heavy chants and fixe Ifok chains. The heavy chain C region typically comprises one or more domafos that, may he responsible foi efieemi function i h< number oi heavy chain constant ivgion dornants w di >1 ’pond er hie iso'ype k,G heavy cfonns. S'»' , sample, e.;.i h eon'* on Hue· i « ’gtou donnons
2(t knoxvt as k ,i, <2 2 ,mxl k Λ I fie anmoTex that aic now ided -ar 'tav' arts ot tucx„ tsotspes it id subtypes lr certain embodiments, the CORP It antibody is of die IgG 1 igG2, or IgG-i subtype, io foil fougtb ifofo and. heavy eham-, the van ibic me; wm-t.mt regions are joined by a ' Γ legion ,;if al'On· tv else oi finite .mt.no a, ids, w nh the heaxy ch-un J’-o including α Ί>“ iCgn-n xft about ten mom amnartieids foe. e e,. rendamem.d immunology, 2nd ed th 7 ibml, \V , ed i i -fo'! Yen York' Raven Press thereby mem penned by reference m us entirety for all purposes}, I he variable tegmns of each hehfhenvy chain pair typuabv form the amigeo I'bi'h’ig shx'
Gne exampfe <if ,ui hfiG heavy ,ou-taut d«rn-ntol mcvcntpiaiy kt IRE R nmnoeiouat antibody has the ammo >,-id sequence:
ySiKGPSVhPI. MVSkSTSi'S'i \ \i tiki YkDYfPbPYTYSWSSG \! Tfofx IlffP
AYLQSSGL YSbSSvA I YESSM'OTOTYTCM DHRPSN 1KVDR iAbRKkTA'hi'PprpAP
PY \GPbv I 1 1 EPKPKHi i Miokl PI Y'ft A Y\ t)\ SHI DRIA fT'kAA YiXA I ΥΗΥΛΚ fk
PRttkQENS ITP, YYSV L'IA Y HOD A L NGKEYkCR VSNRG i,P API Ifo 1 ISK'i kt folRR 13>Q\
2016244220 11 Oct 2016 \ Π PPsRTbM ΓΚΝΟΥSI TCI \ KCTYPED] u i'A ί S\BQPfW\ κττρρχπ !WFX,sm > SKLi YUkbRWQQGNYI S(>Y\ii JkAi.i IMG FOkSi.Si.KRGk (the last mWue*of ihe *. qu ·· . e shown as RfQ If) \G.29i.
(hn. exMispk oi a kappa light Constant domain of an exemplary (.'GBP R monoclonal p errmody h is dt.· ammo ic'd s/ou mee
R i'\ YYRSYl U'RRSDl Qi RSGIYSYYt I I NNI'Vppj \K\ QV< K\ i'>N \l QSGNSq bW liQDNkPWWi xSlLG bkHk\ \ KTVIHQGi WR\ RG1C che
Iasi 107 ie.*id-.u.s olthe *enueuec shewn as Si'Q II) NO Id)
Yi rtah'e ice;«!!s of innv mK'ghmahn chan x ..cneulo .-siebr, f,». same οόι,'.Ι ip -md · o up of p u kd s, ' t or-ww >. IT amewo s i, g on1 i > Ki )e m d b\ fo” e hspetxariuhk ιοριοηχ. mom idien called 'Yompknucuiaoiv deternhumy regions'' or (13P,s. The CBR.S from (he two chains of each heavy ehsinfoghi chain pair mentioned· above typically aie aligned by the framewesk legion* to sosm a xhnemse iha? bind* *pc,ificu.sk wen a sneedw epitope on she nonet p.okw w. „>, <3 d<'R Ri F root N teuton, I so ( nxnvu ί rnmnuiv·· oectirtfog light and heavy: chain variable regions; both. typically conform. With the: foliowing orderos these elements- F R k v '1)R I, F R 2, <'1 )R2. FRY v '1 IR? and FR ; \ numbering ,*vMem has been devised for assigning o embers fo amino acids that occupy positions In each ofthese domains. I his numbering sy Mem is defined m Rabat Sequences of Proteins of hniuunofogiea! Interest {IfoD and 1991.19111, fkihesda, MDro; Chodua & I Cst, 19X7,./. Ifo/ #/>>/. lofi-901
91 ~; <‘hotlttu or a/., 19X9. Yowro ,M2.R?f -bX.Y the venous heavy «-bum and hgm eham variable regions provided herein are depleted in Table 3. Each of these variable regions may be attached to foe above heavy and light chain -on-must regions m form a eemplec .uvibodv he svy and light chain, rexpeem, jy Pnrthvi', •z&eh o; {he so generated Coavy and hgln -..hum sequences may he combined to form a (.simple·, aimhodv snucmm I; should be umV.istood rh«n tit; heaw chain and bebt eh.dn nubia region', piovded berem e.m else be «mubed ίο οιΙ\ - oum nu domains liming differed' sequences than the exemplary sequences listed above.
Spe> use e',unpies of wmiu of din full length hgbl are hem y - hams of dm ano'boib ·* foul am psovided and then eouesnonding amino acid xeetuencox am xuminiuf/cd m I'aiis.-s 2 \ and IB. Tabic 2A shows exemplary light chain sequences, and Whin 2B shows exemplary heavy eham sequences.
2016244220 11 Oct 2016
Table 2Λ ~ Cswmpian Antibody Light Chain Λοηπο Add Sequences
SEQ ID | Design ebon | Contained In Ci one | Sequence |
12 | LI | 01 Ell LC | «BRVpAQLLGLLLLWLRGARCGWLTGPl· $V\; APGQKWISC SGSSSNiGNNYVSWYQGLPGTAPKLLiYDNNKRPSGiPDPFSGS KSG‘iSATtGn-aQTGDE.ADYYCGPA'D$RLSAWiGGGTKLTVl GOPKAHPWTLFPPSSEELQAHKAKVCLISDFVPGAvTyAWKAD GSPVKAGV&HKPSKQSNNKYAASSyiSi.TPEQWKSHRSYSGQ VTHEGSTVEKTVAPTECS |
13 | L2 | 01H7LG | MDMRVPAQLLGLLLLWLRGARCQSVLTQPPSASG7PGQRVTISC SGSSSHiGSRYWWYQQLPGAAPRLLIFRSNQRPSGVPDRFSGS KSGTSASLAISGLRSEDEADYYCAAWDDSLSGWGGGTKLTVL GGPKANP7VTL FPP5SEELQAHKATLVCIISDF YRGAYTVAvVKAD GSPVKAGVETTKPSKQSNNKYAASSYLSLTPEOWKSHRSYSGO VTHEGSTVEKTVAPTECS |
14 | 13 | 0267 LC | MDMRVPAQLLGLLLL WIRGARCD1GMTQSPSSL SASVGDRV7 IT CPASGGiRNDLGWFGGKPGKAPKRLiYAASSLQSGVPSRFSGS GSGTEFTLTISSLQPEDlATYYClQYNiYPWTFGQGTKVEiXRTVA APGVFIFPPSOEOL KSGTASVVGLL NNFYPREAKVGWKVDNALG SGNSQESYTEQDGKDSTYSLSSTLTLSKADYEKLiKVYACEVTLIQ GLSSPVTKSFNRGEC |
Ί IS:......... | L4 | 03BBLC | MDMRVPAOLLGtLLLWLRGAReSSELTQORWSVALGQTVKITC™' QGDSLPSFYASWYQQKPGQAPVLVFYGKHRRPSGiPDRPSGSS SGNTASLTiTCiAQAPiiEADYYCNSROSSVYHLVLGGGTKLTVLG QRiCANPTVTLFRPSSEEL/GANKATLVCLSDEYPGAVrVAWKADG SRVKAGVEnKPSKGSRNKYMSSYLSLTPEQWKSHRSYSCQV THEGSTVEKTVAPTECS |
w | LS | 03CSLC | MDMRVFAGLLGLLLLWLRGARCDIILAGTPLSLSVTPGGPASISG KSSQSLl.HSAGKTYi YWYLQKPGQPPOi 1.1 YE VSNR1SGVPCRI· SGSGSGTDFTLKISRVEAEDVGiYYCMGSFPLRLTPGGGTKVEiK RWAAPSVFiPPPSOEQLKSGTASVVaLNMFYPREAKWKVD NALQSGHSQESVTEODSKDSTYSISSTLTLSXAQYEKHKVYACE Vi HQGLSSPVTKSF NRGL C |
17 | LS | 04B4LC | MDMRVRAQLLGLLLLWLRGARCGGYLTGPPSVSAAPGGKVnSG |
S3
2016244220 11 Oct 2016
SGSSSNJGRNYVSWYGGLPGTAPKLUYONNKRPSGiPDRFSGS KSGTSTTLGLrGLQTGDE.AOYYCGIWOSf'iLSAVVF'GGGTKlJVL GQPKAHPTVTLFP?SSE£.LQANKATLVCliSDFYPGAV'TVAWKAD GSPVKAGVEnKPSKQSNNKYAASSYLSITPEQWKSHRSYSCQ VTHEGSTVEKTVAPTECS | |||
IS | LZ | 04H6LC | MbMRVPAQLLGatLWlRGARCDIVMTQSPLStPVTPeePASISC'' RSSQStLHSFGYNYlDWYLQKPGGSPQLLiYLGSNRASGVPDRF SGSGSGfiOFGLKBPAEAEQVGVYYGMQALQlPFTFGPGTKvDS KRTVAAPSVF9FPPSDEQLKSGWYVGLLHNFYPREAKVGWKV ONALQSGNSOESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYAC EVTHQGLSSPVTKSFNRGEC |
19 | 18 | «EC | MDMRVPAQLLGLLLLWLRGARCOliLTGTPLSLSVYPGGPASiSC KSSQsSLLHSDGKTYLYWYLQKPGQPPQLLIYEVSNRFSGEPDKF SGSGSGTORLKISRVEAEDVGTYYCMQSFPLPLTPGGGTKVEIK RTVMRSVPIFPPs$DEGLKSGTASWCLLNNFYPREAKVQWKVD RALGSGPSQESWEGOSKDSTYSLSSTLTL3KADYEKROYACE VTRQGLSSPVTKSFHRGEC |
20 | 1..9 | 09D4LC | MDMRVPAQLLGLLLtWLRGARCQSVLIQPPSVSAAPGQKVTISC SGSSSNiGRNYVSWYQGFPGTAPKLLiYDNNKRPSGIRDRFSGS KSG'TSATtGn'aQTGD&A(5YYGGIW0$HLSAWiGGGTKLTVl GQPKAF4PTVILFPPSS£ELQARKATLVCLiSDFYPGAV7VAWK.AD GSPVKAGVETTKPSKOSNNKYAASSYLStTPEQWKSHRSYSGQ VIFiEGSTYEKWAPTECS |
21 | 110 | 09F5 LC :................................i | MDMRVPAGLLGtLLLVVLPGARCQSVLTGSPSASGTPGQRVYiSC SGSSSN iGSNYVY WYQOLPGAAPKLIILRMHGRPSGVPDRESGS KSGTSASLTISGLRSEDEADY'YCAAVVODSLSGWyRGGGTKUVL GQPKANHVTLFPPSSEE LQANKAF LVCBSOFYPGAVIVAWKAD WVKAGVEnKPSKQSHNKYAASSYLSLTPEQWKSHRSYSCq VTHIGS1VEKTVARECS ........................................................;;.........;...........;...;........................55......;;.......;.......55. |
22 | tn | 10BLC: | MDMRVPAGLLGlLLLWtRGAPCGSVlJQPPSASGTPGQRYTtSC SGSSSNiGSNTVNvWQGLPGIAPKLliYTHNQRPSGVPDRFSGS KSGTSASLAiSGLQSEDFAORYCAARDESLNGVVFGGGTKLTVL GQPXAHPTVTLFPPSSEELQANKAT L VCLiSDEYPGAV TVAVVKAD GSPVKAGVETTKPSKQSNN.KYAASSYLStTPEQWKSHRSYSCOi |
2016244220 11 Oct 2016
VTHEGSTVEKTVAPTEC8 | |||
23 | L12 | 11011 HL. t i n e LC | mdmrvfagllgllllwlrgarcggvltgppsasgypgqrvtisc SGSGSNiGSNYYWYGQLPGAAFKLiJFRHRGRFSGVPORFSGS KxSGTSASLAISGLRSEDEAPYyCAAWDDSLSGWVFGGGTKLTVL GQPKANPTV'RPPPS8EELQANKAR.YCLLSOEYPGAVTVAWKAO GSPVKAGVEnkP$KQ$NNKYMSSYLSlTPEQWKSHRSYW: VTHEGSTVEOVAFTEGS |
24 | in | 12E8 LC | MDMRVPAGLLGLLLLWLRGARCOITLIQTPLSLSVSPGGPASiSG KxfeSCSLLHSDGPRYLYVVyLQKRGQPPQLUYB/SNRPSGLRDRF SGSGSGTOFTLkiSRYEAEDVGlYYCAIQSFPLFLTFGGGTKVEiK RTVMrWiFRPSCEOLKSGTASWCLLNNF^RREAKVOWKVO HALQ.SGRSQESWEQDSKOSTYSLSSIIILGKAOYFRHKVYACE yiHGGLSSPVTKSFNRGEC |
25 | L14 | iSGfeHL | MDMRVPAaLLGLLLLWLRGARCQSVLT(iPPSVSAAPGGKVRSC SGSSSNiGNNYVSWYQGLRGTAPRLGYDNNKRPSGiPDPFSGS KSGTSATLGni3L.GrGDEA0YYCGTWD$RLSAWFGGGTRi;P/t GQPKANPRRLFPFSSEELQANKATLVCLiSDFYFGAVIVAWBO GSFVRAGYErTKPSKGSRRKYAAGSYLSLTPEGWKSHRSYGGQ VTHEGSTVEKTVAPTECS |
26 | Life | 13H.2LC | MDMRVPAQLLGLLLLWLRGARCDIGMTGSPSSLSASVGDRVTIT CRASQGIRKDLGWYGOKPGKAPRRLIYGASSLGSGVPSRFSGS G$GTEFTLTISSLQPEOFATYYCLGYNSFPWTFGOGTOEiKRTV AAPSVFiFPPSDEQLKSGTASWCLLNNFYPREAKVQWKVONAL G'SGRSGESyTEGDSKDS3A'SLSSTLTLSKADYPKHKVYACEVTH GGLSSPVTRSFHRGEG |
27 | Life | 32H7 LC | METPAQLLFLt 1. LWLPOTTGEiVL Ϊ QSPGR SL SPGERATLSCRA SQSVSSGYLWQQKPGQAPRLLIYGASSPATGiPDRFSGSGSG TOFTLTISRtEPEDFAVYYCQQYGNSLCRFGQGTKLEiKRTVAAP SyPrPRRSDEOLKSGTASVVCLLNNPYRREAKVGyVKVONALOSG NSQESYTEQ0SKDSTYSL5SRRSKADYEKHKVYACEYTKQ6L SSPVTKSFNRGEC |
23 | LI? | 32H7CSLC | METPAQLLaLLLWLPPKGEiVLTOSPGTlSLSPGERATLSCRA. SQSVSSGYLTWYQQKFGGAPFL L iYGASSRATGIPORFSGSGSG TOFTLTlSRLEFEDFAWYCGGYGNSLSRFGGGTKLEsKRVVAAP |
2016244220 11 Oct 2016
SVFIPPPSDEGLKSGTASyvCLlNNFYPREAKVQW^/DNALOSG NSQFSVTEQOSKDSTYSLSSKKSKAOYEXHKVYACEVTHQGL SSPVTKSFNRGEC |
Table 2B Exemplary AoObndy Heavy Chafe Arfeno Add Sequences
»10 MO: | Design alw | Confessed hi Clone | Sequence |
29 | Hl | 01 Eli HC 04E4 HC 0904 HC | MOMR^AQaeaUWUWCQV^tWSGGGWQPGRSLRU CAASGFTFSSFGMHYG/ROAPGKGLEVVVA.ViSFOGSIRYSVDSVK GRF‘nSROHSKN'n.FLQMN$LMDTAVYYCARDRLNYYDSSGY YHYKYYGMAVWGQGTTVTVSSASTKGPSVFPLAPCSRSTSEST AALGClVKOYFPFTY/TVSWRSGAtTSGVHTFPAVlOSSGLYSLS SM7TVPSSHFGTOTYTCNVOHKPSNTKVDKTVERKCCVECPPCP APPVAGPSVPLPPPKPKOTLMISRTPgincVVyOVSHPDPeVGFN WYVDGVEVHNAKTKPREEQFNSTFRWSVLTWHODWLNGKEY KGKySNKGLPAPIEKHSKTKGQPREPQVYTLPPSREEMTKNQyS nClVKGFYPSDIAVEvVESMGQPENNYKHPPMlDSDGSFFLYS KLTYOKSRWQQGOFSCSVMHPAtHMHYTCKSLSLSRGK |
30 | H2 | 01H? HC | MCMRVPAQtLGLtLLWLRGARCEVCtVESGGGLVRPGGSLRLG GMSGFTFxSNAWMSW^QAPGKGLE^VGRiKSTTDGGTTOYAA PVKGRFT1SRDOSKNTIYLOMNGLKTEOTAVYYGTTDRTGYSI8W SSYYYYYGMDVWGQGTWVSxSASTKGPSVPPtAPCSRSTSES TAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAyLQSSGLYGL SSWTVPSSMFGTQTYTGHVOHMPSMTKVDKiVERKCCVECPPC PAPPYAGPSVFLFPPKPKDTtyBRTPEWCWVDVSHEOPEVQF NVWOGVEVHRMIKRREE^HSTFRWSVLWVHODWLNfc. YKCKVSNKGLPAPIEKTISKTKGGPREPOWLPPSREEMTKNQV SiTCLVKGFYPSDIAVEWESMGGPEHMYKHPPMLDSOGSFFLY SKtTVDKSRWQQGNVFSGSVMHEAlHHHYTQKSLSLSPGK |
31 | H3 | 02BHC | MOMRVPAOtLGLLLLWtRGARCEVOtLESGGGLVQPGESLRtS CAASGFTFSSYAMSWVRGAPGKGLEYvVSAISGSGGRTYYADSV KGRRiSRONSKNTLYLQMNSLRA.£OTAWYCAKOQREyGPYSS GWYDYYYGMi5VWGQGnVTVSSAOT KGPSYFPLAPCSRS TSE S taalgclvroyppepvtvswnsgaltsgvhtppavlqssglysl |
S3
2016244220 11 Oct 2016
SSVVTVPSSNEGTGTYTCNVDHRPSNTKVDKTVERKGCVECPPC PAPPyAGPSVFLFPPKPKDTLMISRIPEVTCWVDVSHEOPEVQF HWYVOGyEVHHARTKPREEQFHSTFRWSVLTWHQDWLHGKE: YKCKVSNKGLPAPIEKTISKTKGQPREPQVYTtPPSREEMIKNQV SLTGLVKGRIASOJAVEWESNaQPENHYKTTPPytDxCDSSFPLY SKtTVDKSRWQQGNVFSCSVMHEAlHNHVlQKStStSPGK | |||
32 | B4 | «HC | yOMFWACMGLLliMRGARCGyOLVQSGAEVKKPGAGyKVS GKASGYTFTGYYyHvWRGAPGQGlEvWGWINPNSGGTHYAGK FQGRVTMTRDTSISTAYMELSRLRSDQTAYYFCAROQMShMtRG VFPPYyYGyD¥WGQGnVW3SASTRGPx$VEPLARCSRSTSEST AAEGGLVKDYFPEFVTVSWHSGALTSGVHTFRAVLQSSGLYStS SVVTYRSSNFGI'GTY'TCNVDHKPSHTKVOKWERKCCVECPPCP APPVAGPSYFLFPPKPKDTlMiSPTPEVTCWVDVSHEDPEVQFN WYVDGVEVHHAKTKPREEQFNSTFRVVSVLTVVHGOP/LHGKEY KCKVSNKGlPAPIEKTISKTKGQPREPQVnLPPSREEMTKNOVS LTCLVKGEYPSDIAVEWESNGQPEHNYKTTPPMLDSDGSFFLYS KLT^KSRWOQGN^SCSVMHeALHNHYraKSLSLSPGK |
33 | Ηδ | 03C3 HC 05F5 HC 12E3HC | MDMRVPAGLLGLLLLWLRGARCGVGLYESGGGWGPGRSLRtS CAASGFTFSSYGMHWYRQAPGKGLEWVAVISYDGSKESYAOSV KGRFTiSROISKNTLYLQyNSLRAEDMVv'YECARERKRVTMSTL'Y WFYYGMDVWGGG’iTVIVSSASTK.^sVFPLAPCSRSTSESTAA LGCLyKDYFPEPVTv’SWNSGALTSGVHTFPAVLQSSGLYSLSSV W5SSHFGTQTYTCNVOHKPSNrKVi5KIVERKCCVF:CPPCPAP PVAGPSVPLPPPKPKOTLMiSPTPEVlCVVVDVSHEDF'EVQERRY YVDGVEVHNAKTKPREEOFNSTFRVVSVLTVYHQiMlNGKFYK CKVSNKGLPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSt TCiVKGFYPSOIAVEWESNGQPERNYKT'i PPMI. DSDGSFF1. YSK LWDKSRYYQQGNVPSCSVMHEALHNHYTGKSISLSPGK |
34 | Ηδ | Q4H6 HC | yDMRVPAQLLGLtLLVVLRGARCEVQLVESGGGLVKPGPSLRLS CTASGFTFGOYAMWRGAPGKGLEWlGFIRSRAYGGTPFYAAS VKGRFTkSRODSKTiAYLGyNSLKTEDTAYYFCARGPGiAARWDY' WGQGTLVTVSSASTKGPSyPPLAPCSRSTSESTAALGCLVKDYF PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSV'/rvPSSNFG IQTYTCNVOHKPSNTKVDKTVERKCCVECPPCPAPPyAGPSVFL |
2016244220 11 Oct 2016
FPPKPKDTLyiSRTFEVTCWYDVSHEDPFVQFNWYVDGVPVHN AKTKPREEQFNSTFPVVSMTWHQOWtNGKEYKCKVSNKGlPA PIEKTiSKTKGOPREPGVYriPPSREEMTKJlGVSLTCLVKGFYPS OiA VE WOSNGQPENNYR'n PPMLOSDGSFF L YSKLTVOKSRWG QSWFSCSYMHEALHHHYTQKSLSLxOFGK | |||
35 | H7 | 09P5HC | yDyRVPAQLLGLLLLWLRGARCPYOLYESGGGLVKPGGSLRLS CAASGFTFGNAWMSvWRQAPGKGlEWyGRiKSKTOGGTTOYTA PVKGRniSRDDxSKNTLYLQMNSLK^DTAVYYGTTPRTGYStpW SSYYYYYGMDVVYGGGirYTVSSAS'TKGPSVFPlAPCSRSTSES TAMGCLVKDYFPEPVTVSWHSGALTSGVHTFPAVLGSSWSL. SSWTVPSSNFGIQTYTCNVDHKPSNTKVDKP7ERKCCVECPPC PAPPVAGPSVFLPPPKPKDTlMISRTPEVTCVVVDVSHBPEVQF NWYVOGVEVHEIAECrKPRlHEGENSTFRYVSvYJVYbtODWLNGKE YKCKVSNKGLPAPIEKTISKTKGGPREPQVYTLPPSREEMTKNOV 'SLYCLVKGFYPSDiAVEWESNGOPENNYKTTPPMlDSOGSPPLY SKLTVDKSRWQGGHVFSCSWHEALHHRYTGKSLBOSPGX |
36 | HO | 1004 KC | y(}yRVPAGLLGLLiLWLRGARCGVGi.VG0GAPVKKPGA3VKVS CKASGYYFTDYYyYWVRGAPGQGLRWyGWiSPHSGGIHYAGK FQGHVTMTFiDISiSTAYMELSRI.RSI)OTAVYYCVRGGYSGYAGL YSHYYGyDVWGGGTIVTVSS.ASTKGPSVFPLAPCSPSTSESTA ALGCLVKOYFPEPVIVSWNSGALTSGVHIFPAVtQSSGLYSLSS VVTVPSSNPGTGrYTCNVDHKPSNTKVOKTVERKCCV£CPPCPA PPVAGPSVRPPPKPKOIlMiSRTPEViCWVOVSHEDPEVQFN WVDGVEVRNAKTKPFEEGFNSTFFVVSVLTWHGDWLNGKEY KCKVSNKGLPAPiEKTISK7KGQPREPQVYILPPSREEMTKNOVS LIGLVKGFYPSDfAVEWPSNGQPPNNYKTTPPyLDSDGSFPLYS KL;ryi>RSRWi>OGNVi'$CSV-yHEYv:.HNHYTGKSLSfBPGK |
37 | H9 | 11011 HC | MDM.RVPAQUGUttWLRGARC£VaVE.SGGGLVKP(^SLRl8 CAASGFTFGHAWMSWYRGAPGKGLEWGRiKSKTDGGHDYA APVKGRFTiSREIDSKNTLYLQMNSLKTEOrAVYFCnORTGYSIS WSSYYYYYGMOVWGQGTT/PvSSASTKGPSWPLAPCSRSTSE STAALGCLVKDYFPEPVTVSWNSGAlTSGVHTFPAVtQSSGLYS LSSVVTVPxSSNFGTGTYTCNVDHKPSNTKVOKTVERKCCVFCPP CPAPPVAGPSVFIPPPKFKOTIMISRTPE'/TCWVOVSHEDPEVQ |
2016244220 11 Oct 2016
FRWYVDGVEVHNAKTKPREEGFNSTPRWSVLTWHGDWLHGK EYKCKVSNKGLPAPieKTISKTKGQPR&PQVYTLPPSREEMIKNQ VSLTGlv'KGFYPSDIAVEWSSNGQPENNYKrTPPMLOSDGSFFL VSKl IVDKSRWQQGHVFSCSVMHfc ALHNHY TQKSISLSPGK | |||
38 | H10 | 11H8HC | MOyRVPAGtLGLLLLWLRGARCEVQLVFGGGGLVKPGGSLRLS CA^SGFTFGNAWMSWVROAPGKGLEWVGRiKSKTFjGGTTOYA APVKGRFIlSRDDSKNTLYlQMNSLKTEOTAVYYCTTDR-TGYSiS WSSYYYYYGMDVWGQGTTVTVxSSASTKGPSVFPLAPCSRSKSE STAAtGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVIQSSGLYS LSSVVWPSSNFGTQTYTCNVDHKPSNTKVOKTVERKCCVECPP CPAPPVAGPSVFLFPPKPK0'U33iSPTPEVTCVVV0VSHEDPEYQ FrAWD0VEVHHAK7KPR£EQFNSrFRWSVLTVVHGOWLNGK |
EYKCKYSbmGtPAPlEKTiSRJKGQPFtEPG^TLRPSREEMTRNQ VSLTCLVKGFYPSD!AVEWE8NGQPENNYKTTPPMLDS.DGSPFL YSKLTVOKSRWQQGNVFSCSVMHEALHNKYTQKSLSLSPGK | |||
3δ | Hit | 12G8HC | MDfimVPAQLLGLLLLWLPGARCGVQLVESGGGVVQRGRSLRLS ' CAASGFTFSSFGMHWVRQAPGKGLE'AA/AViSFDGSIKYSVOSVK GRFTISRDNSKNTLFLGMNSLRAEDTAYYYCARDRLNYYOSSGY YHYKYYGtAVWGOGnVIVSSASTKGPSVEPLAPCSRSTSES'TA ALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLGSSGLYSLSS WlWSSHPGrQIYTCNyDHKPSNTKVQKlVERKCCVECPPCPA PPVAGPSYFLFPPKPKDTLMISPTPE^GWVDVSHEDPEVGFN WYYDGYE VHNAK'T KPRE EOFNSTFR WSVLIVVHQD WL NGKEY KCKVSHKGLPAPIEKTISKTKGGPREPQVYTLPPSREEMTKNQVS LTCLVKGFYPSDIAVEWE$NGQPFNNYKTTPPMIJ3SO63FFLY$ KLTVGKSRWQGGNVFSCSVMHEALHNHYTQKSLSLSPGK |
40 | HI 2 | 13H2HC | MOMRVPAGLLGLLLLWLRGARCEVQtVESGGGLVKPGGSLRLS CAASGYTF3TYSMNVWRGAPGKGLEWVGSISSSSGYRYYADSV KGRR1SRDNAKNSLYLQMSSLRAE0IAOTCAREGVSGSSPYSI SWYDYYYGMDVY^GQGTWiVSSASTKGPSVFPLAPCSRSTSES TAALGCLVK.OYEPEPVTVSWNSGALTSGYHTFRAVLQSSGLYSL SSVVTyRSSNFGTGTYTCNVOHKPSNIKVDKTVERKCCVECPPC PAPPVAGPSVELFPPKPKDTLMISRTPEYTCVVVDVSHEDPEVQF NWYVOGbEVblNAK'TKPPJ£FQFNSTPRyVS\0.TVVHGOWLNGKE |
6!
2016244220 11 Oct 2016
YKCKYSNKGLF.APIEKIiSKTKGQPREPQWTLFPSRFEMTKNQV SVTGlVKGFYFSDlAVeWNWENNYKTTPPUDSD^FFLY SKLTVDKGRWQGGbfdFSGRVMHEALHRHYTGKSLSLSPGK | |||
41 | ΗΪ3 | 32H? HG | MOMRVRAGLLGLLILWLRGARCGVOLVFSGGGWOPGRSLRLS CAASGFIF’SSVGMH WVRQAPGKGLEWVAVIWVDGSNKYYAOS VKGRFHSRDKSKNTLVLGMNSLRA&DTAVWCARAGGIAAAGLY YYYGM0W*iGQ6TrYTVSSASIKGP$VFPlAPCSR$ISE$TAAL iSGLvKOYFPEPVTVSWNSGAtTSGVHTFPAVLQSSGLYSLSSVV rdPSSNFGTQTYTCNVOHKPSNTKVDKrYERKCCVECPPCPAPP VAGPSy^LFPPKPRDTLMISRTPEyTCVWDVB.HEDPE.VQFHm VDGyEYHHARlKPREFQFHSTFRWSVLTVYHGOWLNGixEYKC ^SNKGLPAPIEFTiSKTKGQPREPQ.VYTLFPSRFEMTKNGVSL'I CLVK^YPSOIAVEW'ESHGOPEHNYKTTPR^tDSOGSFFLYSKt WDKSRWGGGNVFSCSvhMHEALHNHYrQKSLSLSPGK |
(he fb'-a ?? amino ae«ds of etch of the hghi chair- sequences ΐο i -ble 2 Λ. except h'di' tn-d >21 P ( S. ο a \-rr<>«i sequence hi the i ao.· of $2H7 are PH ? 'S, the s>gmd sequence is 20 air-ino uuids Ssrmhmv, die test 22 ammo ac-.ds of meh »>l the hem v eham ->< .junto m e 1 abb Ή is a signal s-’tjiieuce fh ? - it nui peptides m*q. bo eh.mg,.'! m sign d peptide* hax mg diffmem sequences. e g„ for nt<ne optimal expression in s orient bom ceils it w ill be tbeietore be understood thai the tnxcntio't also m Judes antibodies ha* mg the light md οι heavy chain sequences a* specified m hikes 2Λ and 2K, ho wnh <bfhoust signal ssqnemrs
Again each of the e.xemptare heavy ->oams iHl, H2. He etc > listed in Bible 2B can lie combined νχΐ?Ιί any ot ihe exemphuy light chums slmoo in Tabic 2Λ io ibrtn ats antibody Examplesuf *ueh vombmumms include HI compiled onh mq. of ΐ i iborngh I 112 unidmied with air, of 1 « ftnxmgh 1 H > combm-,d oilh -ay ol ί I thiongb 1 P, ,md soon in some instances, the antibodies nxiud; at hast one beam eivmt and one hem chant from those listed m fable,* ,md ?R hi miiiu- msian-'o-, the mblssb--s comprise two duTeo-m heass ebano* and oxo dilletent bght chums listed tu lakes 2Λ .md 2R, in other instances, the antibodies contain too identical mpt chain* imd tue «dontic.d he.oq. chains A.* <m exaucple. at-antibody m nnmnnoiogteuliy btnctiowd ieanuiii mm mclntiv too til heavy Jiumsand oxo LI hghi «.bants. or tv.o H? heax\ eh.un* and oxo 1 2 light «.hams, m io·? lid heaxy ebrnns and too 1 * halt!. ..hams ..md othet stnuiat -..mnkuulmns ot p -m* id bghi chains anti pans of heav e char > a* '«sled .n ! bias ? k <md 2B
2016244220 11 Oct 2016 am g- 'ibmdmg psoieus-. Y.w cieprovved <-tc v em-nts ot antihodvs mimed Y combination of the heavy and light chains .shown in Tables 2A and 2B and comprise 'fight and ot heavy chains that each hnv ·... ,n. least “')?,», 7s'',,, 50%, 8v0., 900., Ύ0, 070, yr '*90. idesnstv to the amino acid sequences ot these chums. In some instances, such antda-rik-, include ai least one hem. y ·„ham and om. light ch.un. wherons tn other irwianves Ye v arum bums contain too identical light ehaut ,md two kenne d heavy chums VanuhkDs^^
XRo pros id-, d me a-'.beew I-tikhug ptolems that com on an antibody heavy knam v vubk tcgjnn selected item tits' group eovo-oug of \ n k X ,2, \ ?, 0 X -A. YnA \ -ti, X t, 0
Η) V-ih. X'00 V;-.lif Yj:11, Y-.-J ?, .aid Υ;? I 0 nm1 or .m .moti-siy light chain sarsabie region sek'eted from the croup vousistitu ot X I, X? 2, X 3. Y 4, XX 5, X : e, Yi 0 X' 5, X : 0 Yi Kt,
Y, i 0 V. 0?< X; I 0 X. 14, Y| I ΐ Vj to, .uid X j I, os shown in Table 3 below, :ni-d imnmnologieahv Amotione! tragmvWs, onto abv. s, matsum a?-d var-abRet these tight ctunn and heavy chain variable regions,
1.5 Sequence ehgtntsc'tis of ?h vunons he e,v n.-d ht nt en ,iu -,an' tile s-yuows, respectively. are provided ;n figs ι λ and IB.
Antigen Yu.hug protects of b ty pe - an gene1 dk iv designated by the fonnuiu X j \ X V,” whstc ”s corresponds to the ournhet ot heuw chant vanahk seasons -.ci-d '0''
-. onvspond4- to she numbei ofthe light -, ham variable reg-ouv lahlo 3: Exemplary X q and XT Chain Ymhte Yen! Noqnences
Contained in Clone | Designation | SEQ© HQ. | Amino Acid Sequence |
1F11 | '0.1 | 137 | □oVUQPPSYSPAPGGKVTISCSGSSSNIGNNYYSWYQOLP GTAPKLLIYDNNKRPSGIPORFSGSKSGTSATLGITGIQIGOE APVVGGTWOSRLSAWFGGGIXUVI. |
IH? | V I £. | 138 | QSYLTQPPSASGTPWWTISCSGSSSNIGSHYYYWYQGLP fMAPKaiFRSHQRPSGYPORFSGSKSGTSASLAISGLRSEQ E^VYCMWDOSLSGWVFGGGTKLTVL |
21.7 | 0.3 | 139 | DiQMTQSPSSI.SASYGQRVTI T CPASOGiPNDi.GWFQGKPG KAPKRtlYAASSLQSGVPSRFSGSGSGTEFTLTISSLQPBDLA Ί'γΥΕίΟΥΝτ/ΡΑΐΡοαοτκνεικ |
O V
2016244220 11 Oct 2016
Contained In Clone | Designation | NO, | Amino Acid Sequence |
386 | Vl4 | MO | SStLTGDFTVSVALGQ'TVKITCQGOSLRSFYASWYGQKPGG AFVLVFYGKRNPPSG4PDRFSGSSSGNTASLTITGAOA6DEA DYYCNSRDSSVYHLVLGGGTKllVL |
3CS | VlS | Ml | DiilAQTRLSlSVTFGQPASISCKSSGSlLHSAGRTYLYWYLQ KPGGPPQ1. L i YE VSNR6SGVPDRF SGSGSGTDF 1Ί..Κ iSRVEA EDVGIYYCMOSFPLPLTFGGGTKVEIK |
<4 | o | 142 | GSVtTGPPSV8AAPGQKV7ISCSGSSSNIG.NNYVSWYGGiF GIApKLLiYDNNKRPSGiPORFSGSKSGISHLGITGLaiGOE ADYYCG7WDSRLSAVVFGGGTKL7Y1 |
4HS | %? | M3 | DiVMTQSPLSLPVTPGEPASISCRSSGSlLHSFGYNYLDWYL GKPGOSPQl.LiYi.GSHRASGVPDRFSGSGSG'r(}F'riKiSfb/i:; AEDVGVYYCMQAlQTPFTFGPGTKVDiK |
5F6 | :SW; | 144 | DiSL7OTFLSLSV7PGQFASiSCXS8GSLLHSDGK7YLYV7YLQ KPGQPPGI.LIYEV$NRPSGEPDRFSGSGSGlDRLKiSPVEA EDVGTYYGyGSPPLPLTFGGGTKVEIR |
904 | VlB | MS | QSVLTQPPSVSAAPGQKVTiSCSGSSSNIGNNYVSWYGGPP GTAFKILJYDNNKFPSGIFORFSGSKSGTSATL GHGLQ7G0E ADYYGGTWDSRLSAMVFGGGTKL TVL |
O | v,w | 146 | OSVUOSPSASGTPGQRVTiSCSGSSSNiGSNWYvVYQQLP GAAPKLLiLRNNGRPSGVPDRFSGSKSGTSASLTlSGLRSED EAOYYCAAWDDSLSGWVFGGGTKLTVI. |
1064 | wii | MY | QSVLTQPPSASG'iPGGRVDSCSGSSSNIGSNIVNWYGGLP GTAFKtLIYTNNGFPSGVPOFFSGSKSGTSASLAISGLGSED E ADFYCAARDE SLNGWFGGG'T KLTVL |
11 Dll MHO | WI24 | 146 | GSVi. TOPPSASGTPGQRVI iSCSGSSSNiGSNYVYWYQQLP -GAAPKLLIFRNNGRPSGVFDRFSGSKSGTSAStAiSGLRSED FADYYCAAVVDDSLSGWVFGGGIKLTVl |
2016244220 11 Oct 2016
Contained In Cteno | Designation | S8Q10 NO, | Amino Add Sequence |
TO | vds | 149 | ΐ5ΓΤΠθΤΡί818Υ8ΡΘαΡΑ5180Β808ΐΧΗΒ0ΟΚΝ¥Πνννί QKPGfd^FOLLJYEVSNRFSGLPDRFSGSGSGTOFTLKtSRVE AFDYGlYYCMGSFPLFlTFGGGTKVFiK |
12G3 | Vtl4 | 150 | QSVLTGPPSVSAAPGQKVTiSCSGSSSNiGHNYVSWYOGLR GTAPKii M'NMKRPSGl'PORPSGSKSGTaATtGnGlQTGOE: ADYYOeT'ADSRLSAWFGGGTKlWL |
13H2 | VdS | 151 | DIQMTOPSSLSASVGORVTITGRASQGiRKOLGWYQQKPG KAPKf?LIYGASStQSGYPSiiF8GSG.SG1‘FP11..‘riSSi.()PE[}FA TYYCLOYNSFPWTFGGGTKVEIK |
32H7 | 7d6 | 152 | EmQSRGTLSLSPGERATtSCRASQSySSGYLWGQKP GGAPRLi.IYGAS$RAiGiPDRFSGSGSGTDFTLTISRi.EPcDf: AVYYCQGYGNSLCRFGGGTKLEIK |
32H? CO | VdT | 153 | EIVLTGSPGTLSLSPGERATLSCRASQSVSSGYITWYQQKP GQAPRLUYGASSRATGIPORFSGSGSGTDFTLTISRLEPEDF AVYYeGOYGNSLSRFGGGTKLEiK |
S2HS | 7S.W | 154 | D;VMYGSPDSLAVSLG£RAT1NCXSSGSILDSSNNDNYLAWY OQKPGQPPKLt lYWASTRESGVPDRFSGSGSGTDF TtTISSl QAEDVAVYYCQGYYNTPFTFGPGTKYDiK |
3385 | Vd9 | 155 | DIQMTQSPSSLSASVOTWCRASQGiRNEJLGWYGGKPG KAPKRLIYVASSLQSGyPSRFSGSGSGTEFTLTiSSLQPEDFA TYYCl.GYNTYPL.'iT:Gi5GTKYFdK |
33B4 | J jWx | : 15S | EIVMTGSPAHSVSPGERATLSCRMQSVRSNLAWYQQKPG QAPRLLiHDASPRTAGlPARFSGSGSGTEFTLTiNSlQSEDFA YYYGGGYNYW'i P1TFGQGϊRLE IK |
3483 | ναι | 157 | GSV1. TOPPSMSAAPGOKVTiSCSGSSSNIGNNYVSY/YQQLP GTAPKlLlYDNNKRPSGiPDRFSGSKSGTSATLGiTGLQTGDE ANYCCGPAGIGLSYWVFGGG'TKLTVL |
2016244220 11 Oct 2016
Contained In Clone | Designation | SEQ ID NO, | Amino Acid Sequence |
4E4 904 11611 | Vh1 | 158 | GVQLVESGGGVVQPGRSlRtSCAASGF'iFSSFGMHWVRGA PGKGLEVWAViSPDGSIKYSVOSVXGRPTiSRONSKNTtFlQ MNSIRAED'TAVYYCARDRLNYYDSSGYYRYKYYGMAVVVGG GTTVTVSS |
1H7 | Vh2 | 1S9 | EVOLVE SGGGLVKPGG&RLSCAASGFT ESNAWMSWVRQA PGKGLEWVGRIKST7DGGTTDYAAPVKGRFT!SRDOSKNTLY LQMNSLKTEi5TAVYYCTTDRTGYSiSWSSYYYYYGMn'AVG □GTTVTVSS |
2E7 | Vw | 180 | EVQLLESGGGLVGPGESLRLSCAASGFTP3SYAMSWVRGA PGKGLEWVSAISGSGGRTYYADSVKGRFTiSRDNSKNTLYL QMNSLRAEDTAVYYCAKDQREVGPYSSGWYOYYYGMQW GQGT1VTVSS |
Vh4 | 181 | GVQtVGSGAEVKKPGASVKVSCKASGl ’ RGYYMKWVRQA PGQGLEWMGWINPNSGGTNYAQKPQGRVTMTRDTSiSTAY melsrlrsdotavyfcardgmshmlrgvfppyyygmdvwg GGTTVTVSS | |
3C8 12E8 5F5 | W5 | O | QVQLVESGGGVVQPGRSL.RLSCAA8GFTFSSYGMHWVRQA pGXGtEWVAVISYDGSHESYAOSVKGRFWROISKNTLYEQ MNSLRAPDTAVYFCARERKRVTMSTLYYYPYYGMOWGQG TTVTVSS |
4HS | VwS | 163: | evqlvesggglvrpgrslrlsctasgptpgdyamswfrqa PGKGi. EWIGF1RSPAYGG TPE YAASVKGRE TISRDDSKTIAYL GMNSlKTEDTAVYFCARGRGLAARVVDYWGOGTLVTVSS |
SF5 | W | 164 | EVGLVESGGGlVKPGGStRLSCAASGPTFSNAWMSWVRGA PGkGtFWVGRiKSKTOGGTOYTAPVKGRFTISRDDSKNHY LQMNSLKAEDTAyYYCTTDRTGYSISWSSYYYYYGMDVWG QGTTVTVSS |
Ac
2016244220 11 Oct 2016
Contained In Owe | Designation | NO, | Amino Acid Sequencs |
10E4 | V,:8 | 165 | QVQtVQSGAEVKKPGASVKVSCKASGYTFTOYYMYWVROA PGGGLEWMGWtSPNSGGTNYAGKFQGRVTMTRDTSiSTAY MElSRLRSDDTAVYYCVRGGYSGYAGLYSHYYGMDVWGQ GTTVTVSS |
ii Dii | Vh9 | 166 | E VOL VE SGGGL VKPGGSLRLSCAASGR f: GN AWMS WVRGA PGKGLEWVGRIKSKTDGGTTDYAAPVKGRETiSRDDSKNTLY LQMNSLKTEDTAVYFCTTD.RTOYSISWSSWYVYGMOVWG GGTTvTVSS |
11® | VMO | 167 | EVQLVESGG®VKRGGSLRLSCAASGRFGNAWMSWVRGA PGKGI.I· WVGRIKSKTOGG TTD YAAPVKGRT TISRDDSKNT LY LQMNSLKTEDTAVYYGKDRTCYSISWSSYOYYGMDVWG QGTTVTVSS |
12® | 70 | 168 | GVQlVESGGGVVQPGRSIRLSCAASGRPSSPGMHWVRQA PGKGlEvWAViSPDGSIKYSVDSVXGRFTISRDNSKNTLFtG MNSLR.AEDTAVYYCARDRINYYDSSGYYHYKYYGIAV'vVGQ GTTVTVSS |
13112 | Vh12 | 169 | EVOLVESGGGLYKPGGSlRLSGAASOTFSTYSMNWVRQA PGKGtEWVSSsSSSSSYRYYADSVKGRRISRDNAKNSlYtG MSSLRAEDTAVYYCAREGVSGSSPYSISWYDYYYGMDVWG QGTTVTVSS |
32H7 | VMS | 170 | QVQLVSSGGGWGPGRSLRLSCAASGFTFSSYGMHWVRQA PGKG1.EWVAVIWYDGSNKYYADSVKGRFIISRDKSKNTI.YLO MNSlRAEDTAVYYCARAGGIAAAGLYYYYGMDVWGQGTTV tvss |
32H8 | VO | 171 | QVOi. VGSGAEVKKRGASVKVSCkASGYTFTAYYt K WVRGA PGOGLEWMGWiNPHSGGTNYAGKFGGRVTMTRDTSISTAY ME L SRI. RSDOTAVEYC ARGRQWI. GED YWGOGTI. VTVSS |
2016244220 11 Oct 2016
33EE <54 SC'S
Vh17 ί 79 : ί A.
173
GVQtQQWGAGLbKPGETLSLSCAYYGGSFGGYYWSVYiRGP
PGKGLEWIGEIIMHSGGTKYHRSLKSRYTISVDTSRNGPSLKL
SSVTAADTAVYFGARGOWGFFOYWGQGTtYWSS
GVGLVQSGAEYKKSGASVKVSCKASGYTFTGYYMHWVRQA
PGQGtEVVMGYvfMPNSGGTNYVQKFQGRVTMTRDiSISTAY
MELSRLPSDOTAm'GARHEYSSAWPLGYWGQGTLYWSS
GiTLKESGPTLVKPTQTLILTGTFSGFSLS'FSGX'GVAYiiRGPF
GKA-t£:WlALjYWWBKRY$PSfKSfn,Ti'iKLriSRNGVVLRMT
14MDFLD7ATYFCAHRFGGWFDRWGGGTLXTYSS
Fsu h of tb he o y ( haw \<n mRIc regions, f.oie-1 in Fable 3 iwiy o comi’m. 3 wnh wo, of ,be gl\ u>iaji v fi'a'Me ,e>x -» mown n \de > to an »wi»'„en mn ιιμ«,·νΐι f saifsrR'sv sb o'nb'na, Uns s', into X ; 1 emoi s e v, s h wo ot X · X fo Y{ * X > X >
Vi6, \R fo XR3, Xyfo \R 1.0, Vs II. XR i2, AR 13, YR 14, VJ5. A'Jfoor VRJ7; VH2 combined with -or. of V i. X 2, V. 3, V ΐ XR 5, XXί-, X - / V,h. X fo X ίϋ V, I R XR 1 ? V. I R X > 1 1,
X 15, X 16, οι V, 17, X >, * -. embused w uh any of V. R X 2, X t R V, 4, X > fo X t X . 7, X, S,
X fo YR 10, X'[ 1 R XR 12 XR ifo X 11 I, X’· ifo X · 16, or XX I fo and so on hi some -iisi.rtiei s, the amn.-w boidm-' pfotem ineh«i>, - at Exist one heavy chaw s wiable region and or one he in chan; \,n sable region Roni tboac Si-ted m fable * hi some nisi υιόν-, ihc aisiigen fondmg review inehide,- a? Seas? two dd'E-rom heavy , h mt variable ;„eio, > are o, Fein chan saoal 'e s».e'ott\ p o.m tbo-c a-ud os ! able ? V, C'.aj tgk of su„h aantigen bisidmg protein comprise- fa)one Xfod, and (b) oneofVif?, Vi;3, XR3. XR3,. YfoO, YRS7, X aX, X scX XX: fob XX 1 fo \\ 12, o: X .>1 > Anodic: e-ampk· composes fon one XR;2, and ibson.· ofX'nRX 3.. XX.. 1 X n> X : ο, Χ'ϋ X X - X, Vufo X ; 10, X iJ R X'n IA or X - 13 Again another example composes foo one XR;3, and lb? one oi v t, 1, XR:2. Xfofo XRt.fo X - b, Xfofo X’nfo XRtfo VgKR Vid I, XfolS, or Vp 13, Ge, Again another example of -such an antigen binding protein -ompfises ias one V ‘, md t h? one of XX 2, X-X, 3, XR 4, V·. 5, XR 6, V; 7, XR 3, YR fo XX 10, YR : ί,
V-12 X . RR X - Ifo V- I h, X t lo, or X : 17, v, rr \ , |u y, %!, <si XX 21, Agwu anoine? „\umpk of stub ssi .mopeo brndmi; nreiem , oremise^ la's one X < ?, and tb* one <tt X ; R X , R X' 1.. X ; 5,
VfoR Vifo. YRJfo Vgfo VjylG, Vj,l L, Vi,12? VQfo VtM Vt.!55 VtM Vj-F V, IF,XRJfo VR20, or XA.21, Again another example of aoeb an nnbgob binding protein eornprss·, -i ,A one Xfofo,
2016244220 11 Oct 2016 and tb) one id' V( 1, V; ?. V, I. Ve 5, V· rt Y; “ \ , bk V;A Yt 10. V( 11, i 2 Y i 3, V; 14, \ 15, v ={., \ ; 1 γ V, ih, \ , p. Yjgo, 05 \ di, ue.
The lariou- eontbinattom· of heavy ch.-no mrlable re-gams may he combined rehh any of me ianon- eoathm.dson- rel Iteht eham luttahte tegum- re- ss apparent to one id Adi m the art h uf-ct maat i e\, the .-.t-geu b Thug |>-m- re- < re tret -- .wo . fens-. d Isgat char, retrt.'ble regions und'or two identical heavy chain variable regions As an e-ample, the antigen btndtuo ptotem may he .m a unhod', ot iminunoiosue.>.hy tuoetsrereji tremore-w that m-. hide- two Ught eham -. unable tegtott- and neo hem i eham iactable region- nt eornbittatton- ret pan- of it) t >ht ha \ , sal e egom <mj naw χ 5 ,re\ a,or -> t 2A region- λ-, t-tee res I , ie 7
Some amtgen binding protests.-that are provided comprise a hea vy chain variable • domain comprising a sequence of amino acids that differs from she sequence of a heavy chain .aoid'le oomnm v re-cfed ttom \ I, Y>}2- 5 - k 3 i 4. 3 >?. 3 tA, Υ-· Υ;Έ 3 ri. 3 a lm Yu I\ .(i 2. and V J 5 at only I 2. e. k 5 o. 7. re l'! 10, I i, i 2. 13. I I or 13 ammo acre! residues, w h.'em each-ueP-e ptene, dd'e- i> * is w.k pcu.leutts esthc- a dried.>- n.-eitsrenot
-nhstouiton o| one motto aetd. with the deletions. in-rentons and or substitutions scstdtmg in no more dw 15 amino acid elwgereretofve io the lore going vbrihfefe dororih sequences. The tree- > elsam -aoabte reason us -erne antigen hmdmg protents -ostipts-es.. ,-equenee of ammo ai id- th it ha- ,·.ΐ least 7t)%, Τ-Ά, sgre, op4',., 05--,., 07 -,, seqtteti-. e kti.mtty to she ammo aetd -equeoee- ot th; he.rev eham -. artah-e teuton o| Vi5i, Y, 2, Υ,ρ. 3 ; 4, 3'% Y- re 3k.7. RA. 3 ;ri. wtlb Ynl I. YuIA -usd 3 tfB
t. etta-u mtajen bmdmg p:ot> tu- . outpo-e a ugnt chum la-nO-h eomusn composing . sequence of utnt.no acids that differs from the sequence of a light chain variable domain set- vied -rim- Y: 1, Yt 2, v, k Y, 4, Y 5. 3 .re γ{ ’ \ 3 o. y. )m y. t i. \ J 2. Y 4 k 3 14.
3 , ire Y to, m I at ot!O L 2. 3.4, 5. -:-, , s, >>„ If;. 11, 12, 13, 14 or 15 ammo sesd residues, wherein each such -eiptenee dtlferenee A independently either a deletion, inset non or mb.-ltmttott ofretc etmno amd. unit thi, del.tmst-, m-e-non- and ot -tth.-tidittott- tv-tdtmg >n to more that: A ,uwrso .tent change- re-kno - to -he tore-gome, i r-reble ere'trem sequences The heist <. ham -;u iaike «τχηι ut -ome amire n bmdme pi mews comprise* a -equonee of annuo acids that ha< at iea.o '0 k>, ?%. 8?%, v?1'c, 0 ’’ < or -Hb·, .-equenee tden-my to the atmtei ac'd ctuten-e- of the tight eham -.tutahh. region ref V, t, V; 2. Yt k V, a, \ - 5, Yj o, \k 7, \ re V, ire \ 11. Y 12. % ;3, \ ’ l 7 Vi 15, \{ to or Y; 17.
In adekorereat mst-ttiee-, emgeo hmdmg protein-comprise thr.· forirew mg paumg-of helit ehatu and la,; ii ehtuts i .triable domains, \ IJ with YIIL Y I. a with YIL2 Y L3 o dh \ Ikk
6b
2016244220 11 Oct 2016
VI 4 w iih VIM, VI 5 w iih Vi 15, VI 6 w uh Vi 11, \ 1 w uh Vi 0\ VLb with VH \ U 0 w ith \ Hi. VI 10 with VH VI it wsth. H\ VI. i 2 with \ tlfo \ t 12 with \ II10, VI 15 with YH5, VI,14 with Ylll I. VI 15 with Yin 2, \ 1 iOwtih VI11 λ and YLI 7 with VI It 3 In some instances, the antigen hunhng proteins sn the above pimancx au\ comprise attune aud .-><s,:eeneex th<u base V s0;>,. G, ’Xi%, O5’b. or 00Λ·< sequence kiewtv wkh the snecified sawable domains.
Suit other mPs.cn btndmg proiem% e.g mnbodw- or irntninsoh'-gieatls ttmemmal iummenis, mebide \atium. toms- of a xatiar; bcasx eh'-eu aid a inswap injbt cham as pest described.,
CDRs the anti,vest binding postcius disclosed herein are polypeptides into which mae or more t DRs as.· arciled, uiseaed and ot osn- d Au anngeu busdun; pfote-u ,,m bare l< ? 3, 4, - m 6 C'DRs \n antigen hwhae niotem Ida- .an hare, On example, one 'sonsy >. tsaist ( DR I C'CDRH t Ύ and br one heavy chain CDR2 ('X DRH'2'Ί. und er one hens y chain ί DRd «'< DRHd'd, and ns mie limn cham CDR! f (OR I 1”t. and <n one light chins’ CDR2
V'f DR1 2 i, ,md or one bent eh.un 0 DR5 I'Y'f d<s v) Seme antigen brnmiye prote-ns ία. lode both x { DRII? md d'DRIS. .specsin iu-axy uni higheham ί Diss ev'denofiied m Fables 4Λ uts.l ΊΒ, te-peetisels
Ceuiplen-eniariiy detemun-ng region- tCDR-} and firamexxorl >egin$is (FRj of a ids on uimho.lx mus p.> idenefied uxmg tlu ss-teir· .Iesewhed t \ Rabat et al m sequences ni Pteteniof hnsrsttnn.ingienl Interest, 5th Ed , DS D-.-ρΐ of Hcabh and Human Services, EHS. MH, MH Puhmatson no fo-w-C, ΝΉ < euam atmoodies mo roe disclosed hetem comps ixe micor more mnit’e idd stmueneex diet are identic si or base sutist mmil -eqaenec identity to the aminoacid seqsienees oibmc or mm-., of tlu t DRs presented m Ί ublc 4,\ H DRHm and 1 able 4R (CDR.Ls).
Tahk-4t: Exemplars Ilmny Chain ( DR Amsmi AekI Sespseneex
AUNnm ; | SEQ ID | Corhawd m Reference | Designation | Sequence |
42 | n | 1EHHCDR1 OHCDR1 QG4HCDR1 1OHCDR1 | CORK 1-d | SGMH |
2016244220 11 Oct 2016
Ah Mum | SEQ ID NO: | (Watoed to Reference | Mgnsifen | Sequence |
43 | 71 | 1H7HC0R1 8F6HCDR1 11D11HCDR1 11H8HCDR1 | CORK 1 -2 | HAWYS |
44 | 79 | 2E7HCOR.1 | CORK 1-3 | SYAMS |
45 | 82 | 388HCDR1 | CORK 1-4 | GYYMR |
46 | B | 3C8HCDR1 5F5HCDR1 12E8KCDR1 | ChRHl·® | SYGMR |
Γ w ' | SS | 4H5HCDR1 | CDRR 46 | OYAMS |
48 | 82 | WE4RCDR1 | CDRR 1-7 | YGYYMY |
48 | 87 | 13H2HCDR1 | CDRR1-8 | : TYSMN |
50 | 189 | 32H7HCDR1 | CORK 1-8 | SYGMR |
51 | 74 | 1E11HCDR2 4E4HCDR2 9D4HCDR2 12GSHCDR2 | CORK 2-1 | ViSFDGSiKYSVDSVKG |
52 | 77 | 1H7HCDR2 | CORK 2-2 | RIKSTiDG(5TiDYAAPVKG |
53 | 88 | 2E7HODR2 | CORK 2-3 | ABGSGGRTYYADSWG |
54 | 83 | 3B6HCDR2 | CORK 2-4 | WiNPNGGGTRYAQKFGG |
as | 3C8HCDR2 5F5HCDR2 T2E8HCDR2 | CDRR 2-5 | ViSYOGSHtSYADSVKG | |
86 | 89 | 4H6HCDR2 | CDRR 2-6 | FIRSRAYGGTFEYAASVKG |
57 | 81 | 9F5HCDR2 | CDRR 2-7 | RIKSKTDGGTTDYT.APVKG |
58 | 83 | 10E4HCDR2 | CDRR 2-8 | WiSPNSGGTNYAGKFOG |
2016244220 11 Oct 2016
Ah Hw | S£Q ID NO.: | Con to med in fefemtw | Oesignshon | |
50 | 95 | 11DMHCDR2 11H9HCDR2 | CORK 2-9 | RiKSKTDeeTOYAAPVKG |
50 | 95 | 13H2HCDR2 | CORK 2· 10 | SiSSSSSYRYYADSVKG |
51 | 101 | 32H7HCDR2 | GDRH 241 | ViWYDGSHKYYADSYKG |
75 | 1611HCDR3 4E4RCDR3 9D4HC0R3 | CORK 3-1 | ORLNYyDSSGYYHYKYYGMAy | |
58 | 75 | 1H7HCDR3 SF5HC0R3 110MHCDR3 11H9HCDR3 | CORK 3-2 | DRTGYSiSWSSYYYYYGMDV |
54 | 81 | 2E7HCDR3 | CDRH 3-3 | DORRVGPYSSGWYDYYYGMDV |
S5 | 84 | 3B6HCDR3 | CDRH 3-4 | DQySOyLRGVFPRYYYGMDV |
56 | 87 | 3C8HGDR3 5F5HGDR3 12E8HC0R3 | GDRH 3-5 | ERKRVYySTLYYYPYYGMDV |
57 | 90 | 4H6HCDR3 | CORK 3-6 | GRGSAARWDY |
58 | 04 | WH4HCDR3 | CDRH 3 ? | GGYSGYAGLYSHYYGMOV |
59 | 90 | 1S8HCDR3 | GDRH 3-8. | DRLNYYDSSGYYHYpYGLAY |
70 | 95 | 13B2HCOR3 | GDRH 3-9 | eGVSGSSPYGiSWYDYYYGyDV |
?i | 102 | 32H7HGDR3 | CDRH 3-10 | AGGiAAAGLYYYYGyDV |
2016244220 11 Oct 2016
Table 4iS: Riempbn Ughi Chain COR GUI Sequent
Ah Hum | SEQB BO: | Confined in Reference | Designetfen | Sequence |
72 | 42 | 1E11LCD1 4E4LCO1 9041.001 12G8LC01 | CORL 1-1 | SGSSSRORWS |
73 | 45 | 1HZLCD1 SF5LCD1 1W11LC1 11H9LCO1 | CDRL 1-2 | CGSSSBIGSNYVY |
'74 | 48 | .2071001 | : CORL 1-3 | RASGGRBDLG |
75 | 51 | 3B5LCO1 | ‘ CDRL 1-4 | GGOSLRSFYAG |
75 | 54 | 3CSLGB1 | CDRL 1-3 | KSSQSLLHSAGKTYLY |
77 | 57 | 4H6LCO1 | CDRL 1-3 | RSSOSLLHSFGYNYLD |
75 | 50 | SR51CD1 | CORL 1-7 | KSSQSILHSDGKTYLY |
79 | 62 | 10E4LCD1 | CORL 1-3 | MGSSWGSRTVN |
69 | 65 | 12E8LCD1 | CORL 1-8 | KSSGSLLHSDGRHYLY |
[ M | 66 | 13H2LCO1 | CORL 1-10 | RASCCRKDLC |
62 | 50 | 32H7LCD1 32H7m LODI | CDRL 1-11 | RASOSVSSGYLT |
83 | 43 | 1RCL0D2 4E4LCO2 9O4LCD2 I2G8LCO2 | CORL 2-4 | DNKRRS |
84 | a | 1H7LCD2 | CDRL 2-2 | RSBORPS |
88 | < | 2E4.CO2 | CDRL2-3 | AASSIQS |
§3 | 52 | 335LCO2 | CDRL 2-4 | GKBBRPS |
2016244220 11 Oct 2016
Ah Hom | SEQ ID NQ: | Confeined « Reference | 8^« | |
87 | 3C8LCD2 5F8LC02 12D8LCD2 | CDRL 2-5 | FVSNRFS | |
58 | 4H6LCD2 | CDRL2-6 | LGSNRAS | |
80 | 61 | 9F5LCD2 11(3111(12 T1H9LCD2 | CDRL 2-7 | RHNQRRS |
| 90 | 63 | 10E4LCD2 | CDRL 2-6 | TNHQRFS |
67 | 13H2LCD2 | CDRL 2-3 | GASSLQS | |
92 | 73 | S2H71CD2 32H7niLCD2 | CDRL 2-10 | GASSRAT |
93 | 1 Eli LCDS 4E4LCO3 0D4LCD3 12G3L.GD3 | CDRL 3-1 | GTWDSRLSAW | |
94 | 47 | 1H7LCO3 9F51CD3 11D11LC3 1lH9tet>3 | CDRL 3-2 | AAWDOSLSGWV |
95 | §0 | 2E7LCQ3 | CDRL 3-3 | LGYHIYRWT |
» | S3 | 38SLCO3 | CDRL 3-4 | NSRDSSVYHL7 |
97 | 3C6LCD3 5F5LCD3 12ESLCD3 | CDRL 3-5 | : MQSFPLPLT | |
98 | 63 | 4H6LCD3 | CDRL 3-5 | MQALQTPFT |
99 | 64 | 1084(. CDS | CDRL 3-7 | AARD( YLHGVV |
100 | e | 13H2LQQS: | CDRL 3-8 | LQYHSFPWT |
2016244220 11 Oct 2016
Ait Bum | SEQ SD HO: | CsshlaM in Refwaee | Sequoca | |
101 | 71 | 32H7I..CO3 | CORL 3k | COGHSLeR |
1Q2 | 72 | 32H7m LCDS | CDRL3-W | QOyGNSLSR. |
fls»' sunetme and ptopeiftcx ef'GDRs wulnn » ttaimulls oecurriug antjbicis ha-, hires: described. MA'a Briefly, m a iradiuenui antibody, the CDRs ere embedded within a trameworl, in the heavy and Sigh- chain vaoubie region wh-ci'·.- they con^ms-te she regions respuUMide for asmpeti binding and mcogmta-n Λ variable region comp* ews at least disce heavy or fight enon t DRs me, m/m? ikr.n rt ,r m, Nvi, X(/'.aia >,a oz'Pc.-0/>0 >;' Λ».<η>,<λ·.>Λ>·4 h'kx w, PtiblK Health Sun see VS.H., Bethesda, .'HD; ό also I hothm and I esf. i*BV Dm d‘m, 19η-ορ1 -B \ C hothia. * a/. 1989, AGrex >♦? s-;.vxsl within A ftatnewotk legion «designatvil Itamewotk regions s -k 1 R k 1 R2, 1 KG and VP, 4. by k,»b n > 1 id o K'/r.e „kn f h-mua .end 1 os'.,, Hb ' <.>/>,>„'} (heVBRspL« id-d he?e n, however, may not only be used to define the antigen binding domain of a traditional antibody struemm, but muv bo embedded m a variety of othet pokpeptidc sttueturex ns dosenhv-d herein, in one aspect, the < ORs nio tried me ta'> u ( DRH s;ieetod horn the uttxtp vOttsistma ol ti t a CORD I selected worn fhe group consisting of\f\' If) RO ~'x Ή, h7, *5, ks, Ά A, and 100, s i) ι a COB 112 seketed from the gtotip coaxxntgot SI'Q ϊθ λΟ'Ή, Ά Sit, be, Ko,
Ά or 9R rt?, ‘R lot end ; ?c>, <0= j ,>. f DRHd selected oom the group consisting ·,·ι SVO SO SO ~x ~S, b ί, 84, e”. 'h) o»\ 90, 103, and 1 2 >, and uv} a Gt 1RI1 of 01, tjt t and {ml dart contains one or more, e,g.. one, two, dwoe, four or more .nnino acid subsmuttons sex,.
-..onset veuve ,ctnno >»C’,1 substitution,,), deletions o-· n-sertmus ot uo tnme dnm i've, four, t'mee. two. ot one irtouto uuds >»$t 4 GORI -eieeu .1 horn fix group eonst-mm oi «υ a ( DIB I selected from die runup egnsiehng ot Si's) R) SO 42, 4\ 7 j <S, 5-7 0?, r>5, nt» a-xl -Ό ).?'» a f OlH,2 selected (wttt the ,-Γοηρ constsinte of St Q 10 \(> 4b -In, -hb Ά he, 5 k ok *0, PR »jud '9, » I DRi 1 ‘elected from the gtoun eonsi-Png of bid) 10 SO Ά 4 R 50, Ru 5·'·, ri ng, pyg 71 7g, ;.q,| 1 4 COPS. ot tx, (nt and mt) that eounnus one v»r mme. e g , one, two. three four or mom amine· aetd substitutions te g„ costserv auve .unino acid subst tnu son*», dclenot! or utsed-ons nt no mere than fue. tour, deue, too, os one annuo seats utnmo »eidin another aspect, an antigen binding protein includes I. 2. 3, 4, 7 or 0 variant forms co the t ORs hoed m Iab!> 1 4 X and >B, 1 <Α having at »e »,9 89'», bA °0’. (Arts s'Oit u- e :30 tfktrtttv to .»GDR sequene». isste»» m Sables4,\ and 4S1 dome antigen btndttsg proteins aielude 75
2016244220 11 Oct 2016
1,2 Y 4, 5, >n MAihe VDR\ hmed in I'aVles 4 \ and 4B e ι·.η ddlefing by nomoreihan 1,2. ,Y -I nr 5 aninit! acids from Ihc CDRw Owed iu these lablev
In t' i eiother tspeet, th - ί DR\ di\ foxed hewm m. hide conxetwiix sequences I -need from gfoupx ol raDtaci nion-wionG atiOboibe* As described herein, a Υοο*ν.π'ΌΧ w-quanee' ? rafow to .nmno ,uid sequences has mg eetwen ad untnte. aeics common nntone >* ntursber of seciucrees and wen-foie .-eu'-no ,« Q* that \ai\ nothin a given «ιη-οο a, -d xeqnene, * rise t DR consuls sequences tw ;ded include ('DID. corresponding to e.uh of f DR HL ('DRD2 CDRI I.Y ( DRi 1,( DRI 2 and ( DRI I in soil another aspect, an antigen binding protein includes the following axxochtbo.os of i0 CDRi LCDRI 2 .-aid CDRI Y SEQ ID MR- 42, LY and 4-Y SI Q ID MR 4 Y do and 4;
MtflLKfo 4h,o9 awibO S:-Q ID MR bl.M and 5,Y Si Q ID MK b4,;o ended. 51 Q ID MR 57. 5S, and 59; SEQ ID M'K 60, 55, and 5A SEQ ID M'K 45, M, and 4?; SEQ ID MK o2, ο Y and b4, St Q ID Mr 6Y 5\ and 50. SK) II) MR bo, X, and Ox, St-γ) ID M is M, 70. and 71;and SEQ ID MO.< 6‘Y Q\ and Q
In an addttfomi aspect,. an antigen feiitdiug protein .tochtdes tbs following: associations of (DRHI, CDRH.2 and (' DRHY SEQ ID M'R YY 7 Y and 75; SLQ ID MR 76, 9, and 'S, SI'Q ID MK 7‘\ XO, md Xj, SEQ ID MR Μ, M „nd S4. SVQ ID MK x? Xb. and XY SEQ ID NO*; SY YY and 90. SEQ ID MK: M 91. and M SLQ ID MR 92. M, and o..p μ-q id NO,s' 7o. 94 and ?X; SEQ ID W.K' 3, 74, and 9<v, SEQ ID MX. 9?, ox, snd 99; <nQ SEQ ID
MX .100, 10Land 102..
lit another ,>creeE an ttfogu' hntding protein include1· the follow. mg association^ of CDRi L CDRi 2 and CDRi i with CDRE11, CDRI 12 and CDRII3; SEQ ID MR; 42. 43. and D wfoSi Q ID M?K ,Y ’!„ fod *,tQR)\Q^ m, K, end 1 - vnh SEQ IO Mr MX ano ~b X; Q ID MR 4X, W ,nd 50 wifo Si Q ID MR 7 Y X0. mid XK Si Q ID MK 51, M, and be wdh M Q ID Mr S2. x.Y ,t-td 54. SEQ ID Mk sa, my and be with SI Q ID MK. 5,\ xb, and x~, SI Q ID \<R 5 7, 65, and 7<i w '0 Si Q ID \(R XX. fot ,1}ί| ''Ό, xi Q ID M'R b0, 5b, and, .% with M Q ID MX SY So, and YY SLQ ID .MK -15, M. and 4? wdh SEQ ID MK D.O end K M'OIDMK · Y M end b < w Ύ SEQ ID M.R 9? η,,,Μ Q,XH?IDMK 45. 61, and 47 with SLY) ID MR 76. ‘45, and M, SLQ ID MR 65, 55, and 56 with SEQ ID ?0 MR X: So, and E , XrQ ID MR 12, 4 Y md Id with SEQ ID MX ' Y Y .mJ <7Y XI Q ED MK o6, b~, and bS wdh XI Q ID SD* o\ o,y ,,.q qq SI J ? sD Sfo* b'Y ”0. mid 7i wn'h Sid? ID SQs; 100, I0L and *02, and SEQ ID N'Qs t-9 0. and 72 with SEQ ID MR: 100. iOL and E02.
2016244220 11 Oct 2016
Consensus sequences were dotermiuefr usin g standard, phyiogenip analyses of the CDBs cm responding w th; \ ·. and 'W ofatsn-CGRP R aiutboibe- 'Πιο roasen-a-' -eqaenc/s een, denen-ined by keeping the { DRs enmigunns v innn the sam·..- s--qsxP.ee -. orw-pondmg n? a V» or Vj,
As illustrated in Rigs. 5A. -B, b 3A, 3B, ?C, 3D and 5E, lineage analysis of s variety »n iheat-ngen Gnune· proteins pto\ vied he'em tesalted i*> eto-ap- ofichued sequence-, designs led as baht chum I DR group- k k kA Kd. end Re t 3 \ und 3B). bgln Uwe1 DDR groups t I, t 2. 1 3. and I 4 ti nj 4 s. an·.! buoy eh-iin CDR guuipx HCl (big, ,5At, H€2 (fig.
5B s, IB' > t l· ig. ?< ) IK 4 i b\„ D '·, j Ii '> j*'$e 5D) and IK o D in >5·}, Some of the afro e proap-w, re used to genera:- aeditsona’ - om-ee-te- '-eqnene- s, as blu-moed m I ig- b-λ 3B, 4, and elb to v eld liglu chain CDR groups k 1,4 t E;g 3Ak kdD Bug. 53). .1.. 1,2,3 Dag. Ή, ami I 0- II i I ig 4 k and be:e, y t bain CDR groups I R A and1ICB ; Dp. %' i.
he eom<, nsu\ -eqnenee.s of the various CDR region groups are provided below: kiLs2toB.ID.RS
1.5 CDR I R XXQGiRXiDl G (St.Q ID \O BGk wherem X; i- selected from thegtoup consisting of X and K..
( DIM Χ- XSSI Q< tSPQ ID Xt t 104i, wm-rem X '- seb < led, iron, th-' group eou-t-ong of 4 and G
CDR a HYtS'XjSdAS Ϊ iSFQ ID X'G-10 D. wbetem X is-electee bom me group consisting oi : ami s, ,mcs X is -ekeied front the ero.ip eou-tsttug ί·Π and E,
B:iX.otoBnsus
CDR5 QD'vGSSLXiR (SEQ ID XO.Rlhi. whereat Xt is selected from the group lon-bintg of S and C
K. I. .4 Consensus
CDR 1 R XSQ.S X XDdGXo X, iSi Q ID XGiKCk whctcut Xi is selected from the giot'p χθη-s-tu'g of v .aid Cs X ts -clean'd boat die group etut-t-'ou> of \ and b X s--macted boot the group ecut astute of S and R. X; is set-rued bon: the group uon-tsttng ol S x ^td k.
X i-- seieu.-J from tue group ,οη-b-tlug of 4 nn-t D and X'„ e- -eM ted from the group -.ousixtetg of I and G
CD!'? X 4S>X ΧΆ, ist-t HD \O I(iSk obetetn \ w .-elected from the groep eon-Bhug of is mid Λ, X; is selected bom the etonp consisting <o R and l„ X -.s selected frem the ygoup constsfing’d X md Q, and X-, i- wleewd fiorn tlw group e>n-i<hug ol I md X
CDR > X Q4 X, X', X tX' X X (SI G IG XD KG}, λ la, rem X' is selected tiom the gienn consisting >4 Q ,-md I, X' is -JcGed bom the mono censi-ong D G and X, X. t- sebeted fiont
2016244220 11 Oct 2016 dm group wnvdsni! ot X cd I X; m s·. 'ced'd mm die group eonsisOng ot S, 3 a’>d Γ, κ selected ftont the croup conststiitg of f and P, Xc >s selected fimu the group c-on-wong of ('. \\ and x. end X ts selected I'uun the uronp consisting rd'R and Γ.
H) dm group consisting oils and K, X m sole, ted from the gtvt n xOttsO tun: os'F Dat'd X X to sek'tted from the croup couMsthte of Y, Is and K, Xj ss selected from the group con-u ante of X tnd Γ, and X- is selected trom die group eons'-sting oi D and 5 , ( DIC X'\ XXRXa <M (J ID XO 1 Ι?Λ vheteui \ is selected uom dsn gsoup vo-,tstirtg of I and r X - w se'ected from the eroar consists c of m and V, md X; is selected
I 5 irons the group consisting os A and F,
eoronduic af Λ md S< X' is sale- vd from we < I’-wp . onsistuig ro I e,d \ X is sale- ten Poet the group consisting ol R) .wd R, ,\. m •wfretut ftoiu that group eonswnw of t and 1,, and X nt selected t'rotn die group consisting of F and I .
( DR? R\ XQRRS iOtsD ID XO,111\ oisro;nt \ is seketed from shegroup consisting; of X and S
XOlogffias
CDR i S<iS\SXB LXA'Xs\ X «XFQ II) XD 11 sp wn-. om· X -s selected from the group consisting ot X and S X' is selected front the group cousjstntg of Y and I, ami ?<> is selected from the group consisting of S, X and 3 ( Died X \ X\ Rd's »\1 D ID XO 1 X g oik'.eet Y '« ve .d dom di. group > oicsisong of D, t and R X- ?s sele> ted oom die group consisting ot X and S. -rod X, is selected from the group consisting of R. and Qi
Ml CDR3 ,Χ;ΧΛ ΟΧ,.Χ.Ι Χ,Λ Y\ tSFQ ID XO : > Ό, vhe-e-n X o selected from the group < orousimg o*'G and ,X m si lech-d oom she group convOwu ol 1' and ,Xi is •selected from the group consisting' of W and Ifr AG fs selected front the group .consisting of S and D. X< is selected front tint ι,ιοηρ consmtunt of R and X. X. is selected from the group consisting of 5 and X, ami ,X- is selected irons the group consisting' oi A, ,U-K| q
2016244220 11 Oct 2016
Ab Consensus
CDRI X;G,\ λΧΧ-Λ Χλ’ΧΛ,ΧκΧ. (SLQiDV* to. toc-ww X fssekeied lictii g et. i <,onss?a..m ο \ ,iiQ X ts > e.s,.nt or <Λ ’ nip s' i ® it. is X. A.. is sckt.n. tom rite vienp c<w«tst ng o*X nod D. X-, is ^resent or βρόΒ. and ri weseot. ts \ is .selected from the group consisting of I ,md ϊ, X. x selc'tcd from the group < eusisitng ot Q and Ik X· t- selected from rise gtoup eou-astuie of X ,wd S. X>, is sdecteel tom Ihe cumin consisting of X ,md k X.'ts sek-vtcd from she group von-astmg idV one k Yf, ts selected from the ι ’.imp eons'sPng >>f V ,md Λ. and Xj is setcekd now tii,· yionn consisting ot S, X and \
H?K2 XiX XXdsPS >XkQ ID XO;I 19), wherein X; is selected from the group - o'enstrng ot D, <u T and R X 's s >ected how the ri.-onp O'i’\hni>a! X k .md \ and X» w selecied from the eroup consisting of k, X mid Q
CDRd ΧΑΛ ΟΧΛ-ΛΛ ΧΛΑ -,XI 0 ID XQ 13o), wberem X ts selected horn dm group consisting of G, X and, A. X; is selected fioni the group consisting of f, S ;md A. Xi k selected from the group consisting of Wand R, X?. is selected tom the group consisting of S at-ti D X' ;s ss. I>,t te i tow die monp t ons'si.ng of P, .aid k X, ts sale· 'ed Isom the group cpostsfine oft and V X- is s/lected Pom the gtoup consisting ot \ h end X, γ n, selected from the group cimsistnig of A, H and Cl and .¾ w Mdbcfed. from the group coosktmg of V and k,
Π( Ί konscnsns
CDRd. X > 5 MX {X| 1) H> XO; 121 ?, wherem X ts sdeeied isom th; gmup consisting of G and I \ X · is selc-.tcd t'tom the croup consisting of II nod > ,
C'DIk? V IX'PXSQGI'XYXQkrQG tSkQd Π> XO.122). w herein Xs is selected from the group consisting oi X and 3.
CDPM X \X SXtoXkvA.GXkM.X VAY.VbW tSI'Q ID XU 121). wkvtetn X ts setotcu tom me etot.p ,οη-ostmg ot'D one G, X w selected oom di. gsoup consume of 0 and <», X»ts sale,'ted tow die group cwisisung ot M and 5 , X, is seiet ted tom the mono conssstmg of 1 and 0,λ, is selected tom the group consisting pt t mid 5 . X, is selected Irom ♦he oap c n's's,'!got M ' d A, X ts p csent w .to t mid fptes m 'sIQ, s wesem -u absent, and ti'psesew. ;s k, XX is selected tom the mono v onsssimg of \ end I . X-, is selected Irom to g'Onp consisting of if mid Y, X,; is selected tom the croup consisting to P .md X. X< is sole* ted h<w the gtoup - ensmlBip ul P mid th and X -w rtesciu w absent. and ri present, o Y.
2016244220 11 Oct 2016
H( 3 Consensus
CDR2 KlkSX.IDQGTrOYX/APYKG (XkQ ID AOJ2U, wherein X5 is selected irom h:-. group eonsminn; of R and T, and A- t\ selected From the group consisting yf T and A;
H£%£ldisensus ('Dk I A \X \1X« tSFQ ID AD I 35h wherom X m selected freto the group urostsiuip, of f and S. X,- is scie>, led hom the group eot'S-shng id 5 anti \, and XX ts selected iroro ikv group eonsAtitte «>’ A .rod $
CDk? \JSX.SX A'-.XA, 5 X'ADSYku (SI'Q *«* AO ^>t. «hetero A, A sekxied fiom the uenp eow-ustuig' of 51 and \- ts seleefrd fiotn the group consisting m x and D. X.
Η) X- selected fiotn the group eo*isro>n$; of X ntd G, X , ts seks ted intro fee eroup > onstsiittg m'S attu G. X' is seioeled trout the group eeusxsteig <1 X spd R.. and X <\ sek eied *i>it« die viroip constMing of R and T.
t. DR) A- X X Λ Xs\, VID X\sX A\ 5 DV X 5 tAHb «Xi Q ID AD I2), u ne-c '., A.
Adeen d from the group eroisAtme oi h and D X. A seioeled fiom the group consisting nt G
1.5 atsi tfi. X - is st. kt io I from the group lensis'roig of X ami R. Xt ts sAwd Pont ihe group eonsAfine of x ,>nJ I-. \<t A selected fiom the group consisting pi C .rod V, A., is seketed from 'hs' <:ro,tp »ot v.-e, up ot X ,r\1 η, X w pte-e' o absent, ,etd O'presem, to e Xs's s Awd ; roe the group consisting id' I and S. ansi As ss selected from tits' group consisting- of S and G.
Co Consensus
CDR i SAXiMD iXkQ IG AO: I28i, wherein Xi ts selected item ihe group consisting of F and Y, ('Dis? VISA d'R ISA AY A.,X }DSv'kG «,81 :Q ID NO 1 29), w herero .\= ,s w. I acted from the group consisting ·Υ I- and X , \ > * -cleeied from the eroup eous.isi'ug of I and; I, X ? ts seketed Iron- dis' group consisting of S and X , and A, is sele>. ied horn ihe group consisting id
V and A.
UXIV A'PAA AA-A,SA-\A\XA t xfDuXA. YtSf'QiD AD 1 .fit» e.fi.nem X is-«.leeros 'to n <tu ets'eo vonstsiip. «ΐ 3 aid I X e sJcsfre iron I'e gu-i. > u< sedate of I ,-ubt R, X-, «s seR'cvd non- 'he group eonsis't u> ro A and R, \1 k select,-a Oetn t:u group consistent, ot'X and s’, \, Is seketed from the gtot.p ,oiro-ansg of X' and 1, A,, is «.elected from dis' eroup serro-mnu of D rod M, A A selected from the group consisting of S and T.; Xx ts selectei! uotti die group consisting oi st amt I . X ts seicelesi Pont ihe group consisting «η 11 see X’, A , is present ot ihsetu rod <f press.ru, ts X , A m set etc A from dis' croup eom>isKug ot k and kA-, ts sek eied from the group esnsMsiiro of M a*ni I , md X m -eks'lt d from d«t group constating or A, and D.
2016244220 11 Oct 2016
DC A ..Corr'Crtcm
(.'Dili X-.X'.X M\j ί Si Q ID XO. HD, w herein Xi =-- -elected Dorn the group oon-fst m, of \ \’i,i fo \, j- >.e.lesg.cc tr-om the group >„o'»Mst rt;, A, V «:<' 1 X-, w s 'eck'd item the mono coriMstmg ο* Ά , \ and G, and X, - selected, Don't the gomp consisting ol S and H<
CDR2 Xri\;.\-.X;.\ .X.iiX'X-WX-AuXi.X HX A'KG sXt CglD ΧΌ Hfgohesen X, ts selected from the group consisting ui R, A and Y, X> is sckxred frun? the uroun eon-.s-ring of K, S and \Y, ,X. is selected from the group -. ousisluig <n 5. < I, Γ and \ . X , is pre tern -.-s absent, end if present is selected from the gtutn) eon-wntg of X end I, X, is present it) or nhsnm, and if present, r- k -s -Reeled oom -he group consisting off) and S X is selected front the group consisting (it?ϊ end >, X. is -elected from the group eonwstmg of I, k. I. X ,md I I, X k selcxt.-d uom the group con-m-ong of T .mJ K, X{ rs sek\t. d ftom fhe gionp eou-n-lme of D end Y„ X;; :-. -.elected doth foe group eonstsluig of V and S, Xde is selected from the ueup eon-nsimg u* { A and \ , X- -w -.elected from rite group ecm-nmne of A mid f) and X:: i- -elected Dorn the group cons-Ouigof l·' and S, t, DIH X X-\ X-X X, X-\ Χ.Χ,,Χ \.Λ -X XtA-t\ GX,-X VRbQb) \O H'g vHeier X sek\X'o-'rom the pr-ino ousiste'g o* D A trO Γ, X --.elect doom the group consisting ¢.-1 11, Q and G. X -, .ts selected ft uni the group eous-sung of b 11,1 , G ,md X X w s> X'eted non', die po'-np eonwstmg -u G =” X, 1 ,-np R, X. :- s 'eeied notu the gtoup consisf-ne ol \ V utkl \, X, :- --.elected notn th. group eonsi-tsng ofx. G, h , Λ .md b X- is selected from the nr-eup consisting of I, IX D, \ mid Μ. X, k present of nk-mf. and tfpreocm, is selected born the group ..ousisting of S turd V', X-: i- psc-senr ot rd-sent. and -f present- ts -exeted iron's she group eonoMing of W, X and '1', Xu- i-> -elected from she group sonshnlng of S, G ami 1,. X ., is s,-te>. led bom die pump >. ouso’ ng id S, G, L mid Y X - is m.-s-eul or absent, mid it present ,s set- cted from the mono „oii-istsug of Y ,-nrd Y, X- = -,\ set- cted from the group eoswr-rm., of λ an ID X, 5 is present or nb.-nt, and u m.-senf, f-> select’d from t··. gtotm eon-ustmc of λ -md D, X :·> --.sleeted fiorn she group consomng of Y, k end ?·, ss present om-hs >' \ and o' p?' <- cut, η Y, V i is'vesent owd's ” s, one ' <-cm, ΗΛ, is s,-te> ted ts-nu the- group eonsimuigol'M and 1., :md Xp is sole, led horn the gmnp consisting of D ami \
H£>Consensus ( Dkl X- XfoXX.Xs tSEQ ID XO ; M), * itetstn X, ts selected horti ilk' sunup so^-nstutg of X, G, 1), S tstd A. X- k '-eicekd horn the group emiskhoe nf A r and \ , X, ssc’ei'ted fi'inu ths' group t-oiiM-nogof W- Y, λ md G. XX is selected Dorn the gi-onp cotisislmg nt \1 mid 1, and ts selected ftom ths' gioun -eou-rstnu of S η?Ή 11
2016244220 11 Oct 2016
1.5
2.5 ('DR? X t\ v\,\ k X ΚΛ.ΛΛ λ,Λ λ ΎΛΛ -GtStYJIOXo AM ά herein \, s- -eieeu.d from th*. group eon-si/tom of K, Μ, \ , 3 and t·, X - is seieeted from die group eem-mume, of k. V S, \V and R, ’<. is Ss-ieetod fiom the g?uttp eonsistingiat' X, P< u. I and MX-1-' pre-em ot absent. mid if ptesctii. ts selected horn the gioup eomusttug ofk, 1 and P, X G prowni or tMeot, md fi' present, is sGeeted oom the group consisting oi Γ nnd Λ.: X,:, t- srDet>„d fiom tbs g,toup> eon-usimg of D, V Π. 3 and Y, XX is sek\ tod lioni the romp consisting ot'G ,md S, X,- is selected from ilk' group con-dsbng of (i and Μ X·, is seleeigd from the semip t'emwong ol i. G, R, k k. II and Y. k-- m -<>. look'd sunn fi«e gtoup omi\tomv a; |\ k R and P, X is sekued fiom the gtoup consisting of D. \, \ and S, kt > is ejected item the pro > onsisiir ; «o'5 ano s X \Ο'> Α'Άόό tbo group i eno,<'p eH < \ ed \ X , u selected front the pro-ιρ consisting <5f A 0 mid D \o is sedeeted fonn the c mtm consisting nt P, R mid S. X!t, is selected from the group consisting of V and P, and X; is v k'eted Pom Hie oionp ,o'iMstim_ o*'K and Q
CDR3 k,V\A(\ S\,XΧΛ k X, \ \,Λ',\ M,G\ kA (kHAp kt ! 1 fig, A- it m \ -a seim tot fiom the oiontq , onwring of 1>, G, A toad l· k - ;\ sekt tod from the group consisting of R, 0 and Q. M, is Aeeted Irom fix group consisting of'f, kt Y, R, I , G and k, X, is selected from the group „ oust stint.· of to 3 Γ, k, 1 and R, k- is selected from the mono eomwonr of d , I, G, \ anti \, X,- is seketeu from the co-up con-astntg <o S, 1 \ G, k nnd T, X si- eject., d fiem the gtoup co wwtmg off Μ, X, P .mJ f), X is pi -sent oi absent mid if present, is seh „ted front the mono conststnia of S, i and \ , ?k is pu/cut ot absent mid if present, ;s selected fsom the group consisting of V, P, X and f. k;, is selected from the gtotop eonsisptn of S. m out’ i , k is selected tioni m, g?oup vOtisistmg o! 3, \ t,
G ;md Y, X,? is picsent or absent, and of present, is selected iron· the group consisting <' f, Y and W, X. is Aeeiml irom the group cons-Gmg of 1 , P, k and i 1, X 5 5s present ot absent, and tf pio-seng is selected iron) the gfoun consisting ol S P, D and Ik X·- is sclcck\i horn the group xonsisting of 3 , k and P, Xg, is ptesem or apsem. and d present, is Y X; is pieseni or absent, end fi pr; Kin, is 5', mid Xi t- -eteeted fiom die moitp emis^n;^ of \f Λη<ί I., l·'! some ea-es the .mtigen !nndmg profem eomnrtses ai least one hews > ham ( OR g (DR2, m < DR ; has uig one of the aho\ e <, mtsowns sequences in ‘-mmc eases, the antigen binding protein comprises at Das? one light Utam GDR1, ('DR.2, or GDR3 having one of the a.bo\ e -, onsensns sequences In ofig-r eases, the emmet; binding ptoiem composes at least m o h.ep.··> chain ί DRs .le-.ordirm to fin ehcoc eons.-tii-us .soqig-rmes, and <»r u leasi u\o figin eh on GDPs ai-eofdtng to ihc above consensus sequences In soil other casus, die antigen binding
2016244220 11 Oct 2016 pmiuin cnntprises at least three heavy chain CDRs according io the above eonsensus sequences, and/or at bast three light chain CD Rs according to the above consensus sequences,
Xceotdtug to one aspect, pso.tded -> an :«riesed utmeen-bindinu ptoiem that bind-»
CORP P enntpristna t 'D one os more hems chain eomptem.-mary determining r-.-eion< ( DR! Bs vriected isow rise group eonststt’.g o! r l -, ϊ Ί SRDI ss‘eeD.1 now rhe gaoup eonsbhnv ofSbQ ID \O b Ά D a.\ 33, s>- 93, 9'\ and 106' tli) x! CDRH2 selected iron! the sg.wtp i-on.s-.simg ol SbQ ID \O 4. p). So, o|, ·?>, O\ o\, I*)l. „naS I fob not=.-, < 'PRlle selected front th. gtoup eonswtwg of M w ID XO '5, >, s , h-h S \ R>. ‘u , on, s{;~, <md I 33; ,ntd t <\ > a CORP, of Ok to t and yb) the coniwn-, one <w more, c g , one two, three.
Run· or snore amino acid substitutions, deletions or insert on - ol no more than live, ionr, three, four, r.iP or ot:-.- nswno acids, t fit one or mow beta eli:>su eomph.-meni:o-\ duermming regions (CORLs) seiCsted bout She g-onp -..oo.sisStng ot, ti) a CDRLI -elected S'tow tit-,, group connstmg of 5FQ ID \t t-43, 15 1g, s|, S t, >?, iC (fo, np, and i»9; yri a CDRI,? selc, ted
1.5 from S'<, group -. os costingot SFO ID XO'4b 4e, 49, 52, 55, 58« 61,63, 67, and XI n.is a ί DK1 ? ^elected from the group consi-rtine o-'SI-Q ID SO 11, -1 ’, 56 ?b 5l! ol, oS, I, mo ” ', ,wd S ο I a V DPI of y s, -;-1'> and t nri dnn tout wss one or mote e o , one. tv.n, tDe>,. font or more ammo u-„id sue-Citutsoms. deletion- ot insertions of no -note than five, fonr, ht-ec, trim two or one umtiio <n ids, os t<''»one or more heavy bum CDRlXofi \ t and one os more heist cl,w' t Owl s «4 IBt bt\,-’ motu,-i cmhodnn,-m, the t nhrtod mi-gen bmdetg pom.-sr mm comprises Ό i DPR! I seleemd oom She gsoup consisting of y 5 =-, < '1 Hill I ‘-eieeted, ftom *he group cowi-lmo
ano : 23, t its a CDRI sole- ten worn tv wwtp - ose-wmsg oi ;ri v ( PR! ί -elected ftom fin-
.-el t ted from site git»op {.onMstnig of^l Q IS') a >, 4o, |o, 53. 5?\ JD, o k o5< t>~ m-l f>.
os, , .md or R'l one or mow- Ka\y eh,>m f DRIP of i \ ? and one vr more 1 iebt chain CDRI s ot t B) ft ow. enihpdm.ivi!'. She i-eDted euStgen-btndtng psotem m e, tnehide t A) a
2016244220 11 Oct 2016 m .. and <<9, a f DRi ? tit SFQ ID NO 4? -b, 49, % 5\ ® fit o5, %, and '’m and a ( DID I ot SEQ ID NO-44,4% %t, >?, ?p, 59, »'<4, Oh, ”1, and 2 tn another enibsriniu.in. the heavy ehaf'n variable region 1 Vi:) has at least “Tr’n, 611%. Ν5%, 90”,., ’>5%, 97% or 99% -equene- tdctthty with an armno arid sequence selected from the group xowustnig uf’ SEQ ip \Q 1 .% I 0. under the V, hn<,;dkasi Ο”,·. '5% x0'S>. χ%·<, 90%. **'%, 9' m t)% v ι-ηα.-, ,- aV-tittty wph an atmno aud seqceneo selected aunt the group consisting of $LQ ID NO: 13 · 153 In a rnnhei embodiment, the is selected from the etonp - o'!-i,\ting,ot Si Q ll ϊ Nt4 1 'S-mO, and tn the \ ts sek\ ted u<»m the tjonp . onsist-ng of SEQ ID \D. 137-153.
in another asport, also provided is an isolated antigen bmdmg protein that specifically bntds ni a,5 epdop- lormccl of ant-tie uctd te-odino. item both th.- ( Rl R and R.\MPi components ofthe CGP.P R
Io \er .motiiei embodiment, rhe (sol g.-d „,schocn bn.rin.tg protein desetid', d hvrem eiose comprises a te ammo acid sequence .comprising ar least one of the. CURB consensus
I sequences th-elused herein, and i sc-ottd anutte ucnl *<: qtietn, ,- umiptwrog at least on-. of the ( DRL con-ettsu*, swat-axes disclosed netem In one e*>pe„r, the fnv emut·? aeri -cqurttse composes nt lea-f mo of the t DRH ennserssis sequen,es. and or the se,ond anunt» acid ’u.ip,\hc- CiOiptf-es at i.-ast t\-e ot the < DID conseusas wdvxnees.
hi certain oinbodmsents, the hr,a and the second ammo aetd sequent e are eox -dentb.
2Θ bonded to each, other lit a ktrthei embodiment, the first mwno arid sequence of die isolated antigen bntdotg prot.-m unhides the C'DRim of M Q ID NO ’5, -Sril.Mri'’ 00, 9o, oa, 102, and 123, CORK? o? SEQ ii) \o Ί, ' O3%5 so. 39, UR 9% 1>N Idt,-md 129, and VDRHl-o'
Nl Q ID NO ~k ~f>, Ί, \2, be. %, 'C, <-% and 100. and o* the second aitttno ,« »d sequetad of the isolated anogers binding ptotem compose*, the ί OKI 3 of SER) lO NO ad, 47, so, >5, go, so, n4, oS, ~ 1, and ~2, Ci )R I 5 of Si Q ID \Q- 45, *b>, 49, %, 55, ?S, p 1, 0 R o~. and 70, and CDRLI of SEQ ID NO 45. -1.5, 4s, 5 1, 5a, 57. tri. be, ob. and od.
In 1 thrthiT emhodioii,to, the umtgen boridwe protein comprise»* at hstst txxo CDRlt sequences of heus y chain sequences ill, 112, ID, 114. H 5, i IP, ΕΓ. HN t P, 11 IO, 111 k Η12, or
3») 11:5, a<* ^hown in I able 4Λ in ac.nn a fuuher embod-roem. the antigen binding protent compose-* at least twoCDKI ^etuiem a*·of itsDP einun, seqncmcs I >. I 5.1 R I 4, 1 R 1 b, I %
Lb, I ”, I in, 111,1 17. I 13,1 El, I ie, 1 Η», or 1 1 , as shown ro kihk- ?B bt scam a furthet mi tn at new ,h, a \ go, et \h o p o,est eonp.s,* ts ,~u<a »wo t DRU s, qu, mes ot ua, , eLtro sequences Hl, D2. H3.D4, H5, Π0.112 I IN 1|9,1110, Di I, ItC.oi 1115, .is shown ttt
2016244220 11 Oct 2016
Talk 54 , aid at R'.uti twit ('DRI s of I n’lt' ekon sequen.es I R 1 R 1 5. I 4, I - I o, 1 ) 4 LA t in. 1 i R LI 2.1.. 15. I, 14,1.15. 1.16. or I I / as shou n in Table 5 8.
In iiatn nnniber enthodtnKni. the antigen lending protein tcmprHe*· the CQ811R ('DRII2, and ('DRIB sequences of heavy ehatu sequences HR H2 lie H4, 115. Ho, IB, IB,
IB, HIO, Hl I. Hi.?, or Hie. as shnun tn Fable 54 In \e> another embodiment, the antigen binding protein eoitsprtses ihe (DPI. I. ( DP I 3. etui DDRL3 sequences ;g tight chant sequences LR L2„ U. td. LB. 1,6, 1,7, IX I »> I 10, HR LI?, 1.15. 1.1 R L15, Lin, or L1 ?, ,«s .stem ti tit Table 5 IT.
ti· »et Otinhei e in hod intent., -'he ^fttieen lond.ng pi«nuu u-itipiises all sj\ t 'PE- of I I and HR or 1,2. and 112, or 1,.1 and I l.R or 1,4 and 114, o< I 5 and Π5, ο1’ I b nt id HR or I ? and H6, or Lb nnd H5, or 1,9 and .Η 1, or 1.. 10 and H ?, of L11 and ΐ IS, ot I,12 and H9, or 1,12 and H IO, or id 3 and HS, or 1.14 and Hi I, or I, IS and II12, orLIeeetd HRRortl/ nndHId.as damn in fables 5Λ and Mi
Table SA - Hew plan Heap (bain Arnmn Add Sequence Regions
o | o > Jp $x *** 23 1 £ u o | >r a s ύ«ά : 1 s £ 8S | 49, sx ££ 2S 'SX O ¢0 £ ax m O ί „ sx §5 ® 1 1 | Rt 0 'ϊΤ > S3 ,B O‘ m IM as CO O e f 1 | 0 0 0 na ϋ o 0 | 0 s O m 0 3ε 0 0 | 0 s O' UJ w &£ 0 0 |
LE11 | : HI | 29 | %f | 158 | 73 | 74 | 75 |
1H7 | H2 | 30 | Vn2 | 139 | 70 | 77 | 73 |
2E7 | H3 | 31 | VnS | 0 <0 | 79 | SQ | 81 |
388 | K4 | 32 | Vu4 | 101 | 32 | 83 | 84 |
3C8 | HS | 33 | VhS | 102 | 85 | 80 | 87 |
4E4 | HL | 29 | Vnl | 153 | 73 | 74 | |
4H6 | HO | 34 | Vq6 | 163 | 08 | I ®r | dO |
5FS | HS | 33 | Vi,5 | 102 | 86 | 88 | 87 |
904 | Hl | 29 | VhI | ISO | 73 | 74 | 75 |
9F5 | H7 | 35 | VRR R | 164 | 70 | 91 | 78 |
10E4 | H8 | 30 | Vh8 | 165 | 92 | 93 | 94 |
2016244220 11 Oct 2016
S3 «> <3$ £>£ | CS O §2 40 sx **· X Ή S ti- O | CCS XX o >> o *$ ΊΣ tS - o £ | S c ex $3 s£ O | Jg 1 i a «§ 0 x eo *s ,S «1 xs w <s ”fc -XroC XoX- | o ?jwd o O' tu « H o o | o a I o o | o s Q O |
non | R0 | 37 | VuS | 166 | 76 | 05 | 78 |
11H9 | H10 | 38 | 7,00 | 167 | 78 | 95 | 78 |
125:8 | RS | 33 | Vt-d | 162 | 85 | 86 | 87 |
i?G8 | R11 | 39 | Vdl | 188 | 73 | /4 | 98 |
13H2 | R12 | 40 | Vi-02 | 160 | 07 | 08 | 09 |
32H7 | H13 | 41 | VMS | 170 | WO | 10T | 102 |
32H7 CS | H13 | 41 | 7,03 | 170 | 100 | 101 | 102 |
32H8 | Vh1.4 | 171 | |||||
33B8 | :'%B· | 172 | |||||
33E4 | 7-16 | 173 | |||||
34E3 | 7.-:17 | 174 |
Table SB -- LxwKphtn Light Chain Askss Add Sequence Beghins
1 <3? 45 | ex XX U .-*M( XX „.i X 2xs si O | ’ex XX 2 o ix O «S — x: O s£ IH | X o ISs x x KjS UT XX X Λ iX S 1 I u > o | X ’3) 1 si g 5 i a '§ o 1 1 i | o o o tu w> »*** .X ££ O O | o *ej»: a o tu o 3 o o | o **3»: <sS3 a o w ο xs .X ££ O O |
tin | Li | 12 | VlI | 137 | 42 | 43 | 44 *T*t |
4H7 | L2 | 13 | V\2 | 138 | 48 | 46 | 47 |
2£7 | L3 | 14 | V=3 | 130 | 48 | 49 | 50 |
386 | L4 | 15 | Vi4 | 14Q | 51 | .52 | 53 |
3C8 | IS | 16 | V=.5 | 141 | 64 \y? | 55 | 56 |
8b
2016244220 11 Oct 2016
g o 77 gg £X S5S: £> s2 δ | g 'S 2 O Ή S U, £» | » (g $§f δ i I § s ,S? ys ,¾ ™r > O | 1 f § « Έ S 3s, § a > «5 | O o a na Si Si £3 tt | s gg*f ο «3 Tj | a jgg gs a s? rv «a si o o | |
4B | Lb | 17 | VǤ | 142 | 42 | 43 | 44 |
4H6 | L7 | 16 | V«7 | 143 | 57 | 58 | 59 |
6F5 | 1.8 | 19 | V«3 | 144 | 80 | 55 | 56 |
904 | L9 | 20 | Yl9 | 146 | 42 | 43 | 44 |
9FS | L10 | 21 | V«1Q | 148 | 46 | 61 | 47 |
10E4 | LH | 22 | V,1i | 147 | a | 63 | 64 |
11011 | 112 | 23 | VJ2 | 148 | 45 | 51 | 47 |
11H9 | 1,.12 | 23 | V:12 | 148 | 45 | 81 | 47 |
12E8 | L13 | 24 | V«13 | 149 | 88 | 55 | 68 |
12G8 | U4 | 25 | V«.14 | 'V | 42 | 45 | 44 |
13H2 | 115 | 26 | 64.15 | '01 | 56 | 57 | 88 |
W | Lie | 2? | W | 152 | 89 | 70 | 71 |
82H7CS | LIT | 28 | 156 | 69 | 70 | 72 | |
32H8 | Yds | 154 | |||||
33B5 | V:19 | 155 | |||||
33E4 | 7,20 | 158 | |||||
34E3 | Vl21 | 157 |
to one u'ipeei. the woktcd antigen-binding pn'neuts pwoukd herein etet be a «nonoehm.il antibody, a pe'selona! antibody, a oxombhiant antibody, «> human antibody, a 'iif'd’u .1 >r,nhoes a ,a ,un ..ut'bod, a t».ih en . fs. ,rh'w k o ar , to iu iv art uer button»* fruunxm that eot
2016244220 11 Oct 2016 in another embodiment. the antibody fragment of the isolated anti gen-bindi ng protents pi'ovided: herd» can tea Fai? fragment, a Fab’ fragment, .an F(·sb% fragment, an W fragment a, dt.ibtftly, or a -nude ahaiu antibody molecule
In a turth/r embodiment,me isolated antieen hmdme p-meta provided harem vs» human 5 antibodv and v-ut be of the iuG 1 ·, IgGN IgG?· or teG-f fypc hi another embodiment the antigen binding protein consists of a just a hght or a heavy chain polypeptide a·, set forth m 1 wbles > A 5B hi some uvibodinivnis, the anneen binding ptoieuf consists tu η *tl a h-ns chum v.nnhie ot he -e,v eh on v '-.rtahh· domain Mich as fiso-, hd.-d in Tables 5 AM B, Suda antigen bmdmg ptotgins can he pegy fated with one or more PEG !0 molecules.
in -, el .ntudk'i top*. a. the i-aUat- d .uttigen-nindme protein p-tovtded harem, east be coupled to u labeling group and t in -, ompete for binding to the eAtaeeHuinr portion oi'lmman i GRP R with an antigen btndunj protein of one of the isolated antigen-binding proteins prov tded beteirt. fit one embodiment, the isolated antigen binding protein pre-, hied herein can reduce monocyte eiiemomsfe,. inhibit monocyte migration into tumors on Inhibit accmainlabon and function of tumor associated: macrophage in a tumor when administered to a patient.
As. will be appreciated by those in die art, fer any antigen binding protein with mote than one < OR from the depleted sequence-'·,, any cooibiniUionoiCORa independently selected bent the rii-pn t.-J ' mw'1- es is oswid 1 hns, antigen bmrimt. protons wuh m<„\ two >b ee lout, five or m\ of tadependent;', selected < DIG tan ne generated Howe'er, as will b?
ipmeeiated hv tnos.- m the ar„ spe-Jtie emood wenm u/'v-raib atthee vombtnanuns ol GPRs that arc non-iepetitive, eg., antigen binding proteins are generally not made with two CI3RH2 regions, etc.
Sonic oM-tc antigen binding pjotents powided are dt-etisst-d nt more defat* below ~5 AsMd*...Bi.tidi.t:uyifrpi.e.tns \ttd Bmditm. Epitopes apd Bmdmg tMtnams \\ hen <m wiPgen h-orim-e mutem i-> wed to bwd m .-pUope, sit·,-;: ts one o1 bods vontpotu.ds ot r * jRP is, o; dw estnue'.h. dot ta n oft >'jAP is, ;o: ee.utsp e, wa e »s means ts that the antigen hmdofg profotn speeitu tliy binds to << specified portion of CGRP R, which may be on < 'Ri R, RAMER ot spun pm dons of bods CPJ.R mid R vMP I te ea-es vefrete the antigen binding protein binds only GA1 R Rmd nor R \MP1}, the unugvn binding protein would not be expected t<»' <.< m, P- bind ( <IRP R boe.iuso < Ri R *- -ft -u-, ri, ,o,n,- -ten, wuh Mi 1 awl
AM i receptors ri n Jut y m < aw*- 'hew? the antigen etndiny protem mnris only RAMPl tend not l ri-M R j, tl t .ottuyos* binding 'w-W-nt* noted M't Cspect.-d to Ά, no A h nd GtoP.P P beeau-e RAMP; n; mui'*. d, uttet aln-., with ΑΛ5ΥΙ feeeptor. In Cuses whetethe .mtigcn hmrimi.
8R
2016244220 11 Oct 2016 p«o -- m ticn-eio w ith boY ί RI R ., id R XMR the <i!,!i;er bn-tiny pto'em s eweefeti bind testtiues or sequene*, s id residues, es semens m boils (RI.R and R -XMP: In tu>sie of the foregoing embodo-:01¼ ts ,m antigen binding ptoiem m peeted io eonmet -. ι·;;ϊ residue w sthut f'RLR or RAXIRi Similarly, not every -.00100 acid substsmit-iis nr deletion wdnin < RI.R
RAMP I or the extracellular domains thereof is expected to OgmficuHtiy affect bitiditig affini ty ,
XIei ·η Is oetuneti e g 1 I \a»rp e ' “, may I e -ts.-o -o as- os 0 AU eg u\s n' tmtidmefic meeptots., snob as GOR.P R, may be involved tn binding to selected antigen binding: ptoteuts bAWgiiita.Ani.igcn.Binding pttgejns
In auothet <isn-o 1, ammon Priding psotesu*- are poo ttie.1 Ysi cotnne-'x- wnb <me of die escinpHded, os ''reierenee' mit-bodrss or tutieut-siai isagniwt'-bti-dii-g uo the cpnone dews shed above I-,'! spo, ?fie bnutim to CtsRA R Sneh «nnpeu btnd'ng mote:·» 0 <sy nko On-i to Y, same epitope as one ofthe herons exemplified antigen binding ptoiem.x, or an oxcrhsppmg epitope. Antigen binding protema and fragments that compete utY or hind to the same epitope as the exompitfed or reference antigen tedding proteins ate expected to show similar functional, properties. The exemplified antigen binding proteins and fragments include those with te- oe.iry and tsghl ehasw, v ante-te regOs? doo-ams \ k\- 1“ md V(:l· X A anti GIRO tneh-akti tst iables 2Λ, 2B. 3. AN. -113, 5,X and 5B. thus, as a specific «.sample. bhe an'tgcsi teii-isnp proteins fh n .«o’ prowled m-ehtec those dial compete wsY .-at ,-ηΐΟοΑ basmg «a s ail 0 of die f'DRs issted fot an antibody Ikud tn Ί nbles 3Λ end ,>B. tbi a X',t and a X', se'.e> ted bom X I X , 1 ',- id \'i I X 05 end feted tor an entibodv 'swd -n fed-, s \ ,;5d TA ot sc) two light t'hauts and ’wu ti-, a-y chains a.-- '-pe-. -tied hu at- at-itbo.ly hated in fabies ·’ X anti ?B Other examples ox'suitable teterenee antibodies meh tie Yose that have a heavy knits variable region basing a sequence . otregumteng its any ofthe sequences identified as Q ID
Ni) If-N-1 7U ,utd a heist chasn -.arsabuc teinett hav tug a wquettee t-otte'-ponding to any ofthe sem·1 tn es -demoted a-< St Q ΙΠ NO 5 0] sy sAndnu. eoo'ei-j.uos' me e x e-sCs „.d, fet csaum,-., tosne a bts'S'-.ur as-av s s, eh a- the Ιμ<«.ογ v 1 <· ϊ co, I, or < « ow Ο n t ox ηρ ν ’ ί d>oO es I ee> be’o wen.: tested against each te m\ ' referen-.e antibodies — five nestnah/mg ntmfiodies sj ΐ Ol 1, 3i3fe ti 1 Os tnd * <1- o j a nd one non neutral' .'mg ant tin Os OOI 30 The assay tesulte, sho·- n in k-. he I \ indicate t!\,t a I ofek teste I tientmN ' w aut-b-sl e«II O J11 \?b 'jBo„fes-A'-h ΙΗο,ΟΥΟΟΤΟΟ,ΜΙ' 5011,0 0010 b. I ?Gfe I Ml? aiO 320'1 i'nst tti vsst utadb, the same region of < GRP R, otiii, h ,,, OiMinct ftsno the legion td t 'GRP R, tn,U s-bound bv the ison-ttetmOi/me inihbodtes tested (3205, 33B5,33E4 and .Mho). Bitted on these
2016244220 11 Oct 2016 data, any of the mmti.iti/mg anulmdim· would mate evemplary n.-fereoen antigen bunting proteins nt a competition ussm, particularly any of the neutralizing antibodies that vv/re immobilized m the tssay d.-serdvO m ksampl· 7 — I I ί> 11, efiw 41 R>, I A l\ and 9Γ' 'he »r men υ di e ptok'rs h 1 me» ded »< twe non c v> f ! ft bodies 1 n m d to CGRP R. Monoeional antibodies nu\ he produced using any rechmque known u ihe ad, e.g ., by hnmordbzing spleen celU harvested from the ti'>in.*genh; mmui she’' completion of the imr.mnv u-on cchctieie 1 he *gti,en »ells can re immveti.ibze»'! using any let hmm, known m the «rti e <;, b\ fuun^, them we'h .nselnn,, cells to pu<dnee heet'demac \b dome cells Sos use in hybridoma-probe» mg tuGon pto * dimes preferably are tion*,muho>iy~proJucmn., nave high fusion efficiency and ·. nzv me dm „ e e-e*. that tendet them «neapahk of growing nt certain selective, media which sagpoti the gro wth of only the desired (bsed col ly (hybridofw;) , Example* of smtahie eel; hues tot use in mots** fu-aotis in-, hole Ορ-20, P >-\ot Xp\ p >-Xo V Vgh omk \\I i Ac 1 1, sr? |ti \u| t, ft ), \RO I , MIX 1 k MPC 11Λ le G I'G I, ? end
SP.M'5X\O Link examples of call tines used in rat fusions include R2 ;0 P.CS k Yd-An I 2 A IR'-’kei ..id IR?10 Ornes cef hue-» awtid for cell Os.on* am I. 2eo. k-MleOd GRG2,1 ICR 1 OVHMy? and I ( .y,» ~>x>, οχροη y method of prepsong monot hmai antiho»ti.’* r, dexer-oed nt I xample 2. eeioo, hi sonic uisi.ine-,Λ, ,j hybridoma cell tine Is produced by immunizing an animal (e,g , a transgenic anmnd hax mg human nnnumogiobuhn sequences! ο-th a CGRP R immunogen, hatvestmg ,*pk\-n cells frotn the tttumumecd annual, fuxmg the harx vied spleen cells to a inv'biina e>, ti tine, theieby w neurone by rndmna e«. tis, ».ssabn*hmg hybrnloma cell lines from the hybridoma cells, and identify mg a nybrtdema eed hnc that produces att antibody that binds ( t »RP I* i. ,g , a* des< t'lhed m I xamph-c 1 - k below ) Sn>. h 'm hodotms cel- bus's. and mti25 ( GRP R monoclonal antibodies meduccd by them, me aspects ot the pscsent application
Mono» Iona? antibodies seeiefed by λ hyO'idoma - eh Hue *an be purified u*mg any technique known m the art 1 hzbitdoma*. or m Ve* may be further screened to identity mAbs xv itti parti» tiO. ptope r>, v voh is iht Vnti'y \> hum t elk* >, '.pmvam» t GPP eetiuv to I k\ k m mtisfe.e the banding· of the CGRP l-t mdoi CGRP,»- peptide, ui rtte aluhC to finsemuniPy ?d block the re-.emoi e u using a e.\MR ,.-»sav> e g . a- desvabed hetiwy .ίΐ11Μ2α2.4Ι.1.ί.Ι:1ϊί.Ρ'4ίΐ .4Antibodies
Chlmeoe md htiniuuh'Cci antibodies based upon the foregoing sequences art also piovtded Moimeloual antibodies for use as therapenth. agem* may be modified in various xvay.s prior to use. One example is u chimeric antibody, winch is an antibody composed of
2016244220 11 Oct 2016 gem. segmenbi from different antibodies that arc covalently joined. fo protiiw ftwenoi»<j.1 immum<gh-buhu toiu o- heavy ehams or immuiOloeieadly bmeoowfi pontons foueof ikrseraliy, n portion of the Heavy chain an J or !η:ηΐ eh,tin is ifotmeai w-tii or homologous to a vorrespondfog sequence· m antibodies dersv eti from a pameular specie,'·; or belonging io a ?< is-mecDi antibody J tss or sub.,lass, while the i roairtiei of t te eh,-m(si is ue identic si v 'tb ot h-ww-foigoe-, m a cmicspot mi y u artfio i *- iV-ov,-e bo n «notin', specm-et belonging to another aimbodv das-, <n -ubeia-s I ot methods r dating -e ehnnene -on fo, tot „-.->, v t, foi evareph , i riled Suites Patvul No 4,Slm'ti~, -,n-l vloirison w to,, ί tit-5, Pro,?. YM ό a / Ow . 5 ? to idol ιλ5λ. winch are aerebv nicr-rnoraud by 'cleience v DR giaiimg ', i(t -b-er-md fm m-ample nfo nneti Slates P item No b.ISfod^O, No Yem ΥΎ-,Ν No Υ·'··Μ ?<.!v No. .\5fo\0fofo and No ffodti. Itii
1' jcneiaiiv, die go η o·' orfoing a ·. lumen- nntibo-.b. is io > reau- a chmteux tit which the number of atmno at id-, ftom tin, mt,.n,i-„d, patient xpoe-.χ is tnasninred One example is die ί '1 iRwrufieti'' amfootiy m which the antibody comprises one or mom eomplemenmrhv
1.5 dem-mmimg rt moux tCDR-j foots a puiltenUi spin les m belonging to a purtii ul--a antibody ehe-xe-s wibelu-o. while ''he remainder of the antibody ebampst is am identiu’i v- 'tb or homofogous to a corresponding sequence in antibodies derived trom. another species or balmwnw to another uultbod'-. eki-,χ or subclass, rot u-e m tinmans, -he variable legion or .wo eied ί'DRs ftom ,-. rodent embody often ate gmtieti mto ., hum -n ammo,·/, repi -.cun: the mmimllv -oeearrmg variable region-, or C 'DRs of the human antibody.
One useful b,pe of .ntrneuc a ufoed) t- a ’uur.atueed antibody Gene'- til'·,, a hutnam, ,.ti anntimb :-· produced ftom ·, monoclonal antibody mixed h-tiiulSv in a non-human animal ί ertam ammo acid residue- in tlu-; monoclonal antibody, typically from non-antigen efouiu/mg pomoitsoi the mmbetiy. -ex. modified to be homologous to eonesiiotulitig luxidu&r nt a bum,m antibody of ecu responding u-oippc Humani/aitr-n can In performed, lor ew-.ntpD, u-tittg vauoa-; methods by substituting at lets! a portion ol a witieni vert,tide iegmn tin the voricxpondmg tenons ,4 s human antibody gu. e.g 1 'ruled Males P.nem No. .'..NAib-i, and No 5,0 D,7o?, Jones , · 4 i4Xo to:-*', jj, 5''-'’? Y Riee'}uvnnn < /to, DK to?. toY?~, ve'hoey.-.,7o', ifofo.
In one aspect, foe ( DRs of th.„ light and heav y eh,tin y oi.fole melons or the antibodies provided hemirt Gee, fable 4} ;ue eiafled lo ti-miewofo legions {ΓΒ-t fomi antibodies born the same, or a different. phylogenetic species I'or example, the CDRs of the heavy and light chain vntnmle region^ \'Hi, Y--.2, Y|;d, Υ,Η, V jf'- 5 -fo- Ytw V:jK, \ fob \hjlti, Yfo i, Yfoto. and v sid, and or Y I, \ {d, v Y Y -I, V, 5, v m Y, , V, 5, \ ·. fo V, 10, \ , 11, v . i2. Y to, \ · id.
2016244220 11 Oct 2016
V« I5, Y: I b. and V, I ex, ba grafted to conwtMh human F'Fl· I'o exmc romxnso·., 1,uniats 1 it·-, bHs horn -xx- ml human bens, chant <« debt chain unnro acid sequences max be aligned to «damns a consensus ,-,«nmo actj sequence hi otoet embodiments. the F 11·· of t m-av, ehiin or light chain disclosed herein are replaced ouh the I Fl· fiom a d tin. ten I haaxx chant os light team. to one ,nqx\u rare amino ;«mds in the kte of she bvaxy and light chains of autif GRP R antibody are are replaced, while the icst of ihe IR ammo acids are replaced. Λ 'hare amino acid is a. specific amino acid that is in a position In which this particular amino acid is not usually touud m «n t'R Ahetnatixely, Ihe gsafied s unable regions from die one heavy m light, eham mas he u--»„d odh a concern region mas dtikiuu stout too constant reemn <n {»,,«
Kt p rfseei a bans \ m right ; bam as dx- 'os>. d bexw b« vibe . mbodmxms, toe ; r.dtod sar ab«a regions arc part of a .single eham Iv antibods·.
In · at mi s« embodimentx aerv mt legion- t'rmn sp , ms ehiv than unman x'nt ba used along o tilt the hun-aii ,,u t tola ieg imps? x prodsta·,. hx brid antibodies BdiYlkRUarLAnimodjes
1.5 « ntlx inuiu*' a«mhodics ,na also pioxided Methods ,n,a ι«χ,η!α1·χ io? making lull·, bum in utrimodtes spee«fu tm a given arrtgen xsifbont esrovt-c bt«man hemes to the anngm fWliy tertian antibodies’'). One specific tnecna presided for teplemenfing die production of fulls human antibodies ?-> the '‘homant/aiton’' of the mouse humoral Immune wtoem. Inmsdnebon o'hum ut uvmmoglobt'b «tig's ha i uno mice «η >\h\h tin,- endogenous lc genes have been maefivated is one means of producing fully human monoetonai antibodies (oiAhs) in mo»<x, an <m;m,«i dial can be immumced xsito any desirable antigen, FRing fully human ar i io I -ia rirr < t, r ttao^en .use ahxgie msponxs ri,at « χί>ι, owes a, v a-v to. adminiOeimg mouse or moose derived p'«-\bs to human-, ,r- tbempenite agents.
I mix bum,r« ato-bodies a n« ba puxhned «v «mmnm,· sug- iiansgeme ummalx (usually mice) tow are capable of producing a repertoee of human anfibodies in the absence ol erdogcrou-, ii'intunocRsb'-hn piodtu non Avti. e <, bn tots οηιρο,χ ixpteabx Ko a six ot mom contiguous ammo acids, and optionally toe conjugated to a carrier, such as a hapten, ,s-v t ,y., jnkobevus :2,W93, Pr.i< Yam -her Me i'.Y-t tot ,M51 -25? Y Xiksibov ns .7 m.. 190.1. :Ypii.'.’'i np2-,25.5-258. and Bmggerm-nui c/u/, 199a, terImmunol. 7 53. In one example of ?0 SUM. t method iruux.pxia antotaks ,na produced to mcapw,.· taring tbs' auifeeamats rro,t,x tmm«tnoglobubn Io, an, odu«g tri, mouse ha ov and right nmiinnogtoteini chants therein, and irs time in* the ro ,e eero.re knee ri.igm Ά of bum r: e,neng OSA co tri wine I xs ’h.o •.unde human rieavx and «rmt team pioteoi' Paitjalys modsfte I annual·, win, n have less than the full eomplemcnt of humais immunoglobulin ioei,,are then cross-bmd to obtain an
2016244220 11 Oct 2016 aromat hammi dl tn'the d· wm-d immune -o sten. modi beat iwro When adnnms-c-eo an immtmogcm these trausgeni e unbinds produce' antibodies that are inirnnnospeeific for the imrt.tnoqer bat base human - ith ' *,h.m routine .curoo a td sequewes wennhea -he s cm-Ee region'·, i or hinder details of such methods, --. e, for erorotpla, < No 5 Γ fo .,-md
WO9WG26G2, Additional methods relating fo transgenic mice for waking human antibodies ait -esetibe-fou I tme-i States A ;e tt No ·<Α4^>0, \o o.”' bo'b. \o tvXANn,
No, 6,102,963; No, 5,545,80?: No. 6.300,129, \o w?5;· fob No :<>/ ,M/; Xo ?A 74.290 and No. 5,545.306, in PCI publications WOP I iO4t, WYH0 9 Id fo, and in I'P 54H5YM31 and £F 540073AI.
7'be tramgetn-. mice dosen'Ud above. rel'ere-d to herein as ΗηΜ,ιΕ' rotce. contain ,.
hutintu itirntanoglohuh.n gene mini locus shat encodes nnreaoratgcd human heavy (instil and igammnji and jkapp.ii hghi chain mnrgrooglob.ibrs sequences, together wbh targeted miitaifons that inactivate tin,- endogenous iron] and |kappa] chain loci (1 tmbeig. eted . i’’94, 20,16.0s--.n ; op Cod’ el' I .niu',' ib t w, „ed Wt’iwio efoi,v C-d ot fo ιρη P me ro response to nnronro/atsuo -,nd the umoihe ed hem -at luav sod dght chain tratiM’enes undergo class switching and somatic munition to .generate high afnnity humiui IgG [kappa] monoclonal antibodies i I otiborg < 7 o/, snyrou; 1 nnherg mid llns/ar, i095, .61/.777, Age. Erowroo,'', B 05 Ab t hadrog and Losthem, fo-fo, ,p,^, \ ) p,,·,/ 5,·, 2gd5.fo-Mp}, I he p<ep eaiio'i i»« Ib-Mab ,r e ss d< ro fb>, d in <’< uni m Mt-, Io ite-' !Aw Λ. , . roh /tewwifo 20:6237-6293. p n.C{, l7 ίί;ί, οο,ρ /suvwumroo? brown?, Auge g 6-7''~ό5ο;, 'tXahfou et nA 1994. J, htiiimnid, 152:2912-2926: JLonberg ermA 1994, ΛΡθο<. ΝΑΑ56··859: Lemberg, 1994, /foffforoohofr&p· Ahip'pidwfogy 112:99-1 OI; Tayiorwsh, 1994, At/rowrfrwZ Prowws\sgu’O.5’;<i-50l; 1 onforgand Ihsszar. 1995, b??e,;?, fo-n. /mmuno/ 13:65-93; Harding, and Lonbetg, fou-g ,1,.,7. \ } j <; 7 A >' AM ή fo-54o, ΡιΠι^ρ,Ι, HA V-,
7A<m. - foeroro’ 22 R45-S51, the foregoing tefr-renees are hereby· incorporated by reference in iheir etusr, u, Os a U purpose-, A, I'ltidie; Armed States ban-ut No 5,5-*\SOe No ,\5-’9,b?\ \o %'2'J2t\Xc 5 6%.42m \o s 730,6-0 \o s,k,fo , \o moobOlo, No .\bfo,MA No 5,374,209; judXo. 5A7G,429; as vvoil as Aroted Slates Patem No 5.5-45,307; International IbibOcatio'· No·- W(i -P. 122, WO'E Enfo. mid Att’M U'folS. tn-. dis, Asm- ol ail ol
0 inch me herobv r-eO'pw, ted h> ufrtenee ro th..i . ntireti fro al' pu noros b\’ 0-,-0-0.7utihzed h.; producing human -embodies in these u.wseewe uuec dis, losed J-o ro 35 0 .'h-o-O.Aand Meodce eAb 100?, \ AMrom - i? 116- I5o vlwh arc hereby sneerpos ded by 0 fricwe i'oi esa-npie, the Hi o” n.d JR'o-2 ts msgeme twc<, suamsem- be
2016244220 11 Oct 2016 used A> gem') ate iiitbt GRP R .·, ηΡκοκ- Furihe4 xlcu.Ps tegatdmg dm ptodm bon of human antibodies u^nu mmsgrmc «nee ate ptrotdcd m the examples below dig hybridnnu technology, uptigeu-speciiK humors in Ah- w. Oh the desired spectfs;.ity can be produced and -ek-eted from the transeetne mtec such as those dc-'cribed above. Such amthod-cs nuy be Joned red e\prc<-ed using a suiiuhie < ector and host re il, or the antibodies < <.u bx-1 uneA'd w i i, m i\$ ash menu·, .eli*
Fully huinsn anti bodies e m ri-o be derived from phage-displuy librnrieu ins disclosed tn I iooswtfbooc .red, i-)*':.,,1 Vo/ &>><' 22 *M, md \latksre <7. 1^1, ! If / 7”>*
222~5>-1 ι Phage chspho techniques mmne immune selection through the display rP antdiody re-p·. noues on thr surfac.' ot nhunemou-· b.n ieriophuoo, and subsequent selection of phage by tbvtr binding Io mi antigen of cliotcre <>ne -uGi technique ts nose- sire d in PCI Publication Ao. \\P ii y pre betxtre t ofo π .,, s ire, re -1 ’ q.re ! r.s 1κ ι-χ·> iotof i all hup, and functional agonfstie antibodies fot MPI - and ntsK-rei.eptots using siu.it an approach.
BispeeifieCfr.Bibmedmnd.AnuuerijiiAidii^.^iidni4
The andgen binding proteins that are provUlcd also include btspeeide cud biftn 1.00.- n ti'ouo I the. 'c'nPe cue o- mo- ( BRs o- encm no-e\.undue regre-s isPe-re bed above Λ PrepeufK' or bounetion.il antibo.h, in some instances ss un artificial hvbrtd unttbodv has me two ihffi-u'ui h \i\) hgh: iham putts and two difforeu* h-n-.hue --res Brep, i dh nushudire- tn,re bx' produced bv a larteo of methods uwludmg, but not tunned to, fusion of hv-hndomas or linking of TW ftagmentei., Sen, ng;SongsivtUi and Caehnnuny 1090, .fb, /win-wf ’d Vi5M21, kosK'bo rem. SW,7 14d 15a7-k%
VdrWsOlh^^
Some 0* Uk arm <. n bu-dtnu ptoiems that are pto<. -led ate v c sunt hums »n the annger
2o binding ptoLins disclosed above ό g , those hw, nm me s<. quettces It-ted m I .Poles 2-A, l or nisi nice, some ot toe <usWku bmdmre wetems h.o one os mow eonsetv<·ΐη>- menu acid nibstnutiou- ni oue nr more of toe lureo 1 or light chawre reumi-ie rumens m CGRs listed m Tables .2-5,
Natiionly-o. eus one ammo ,u uk mas h> eh reded imo >, las^ ,x Orecu on O’Pii'mii s-dx' chain properties.:
I} hydrophobic; noth, tu me. \b {, Ala, Val. Leu, lie;
?t neutral hvdropluke f Bcr. I hr, Asp, Gun 5 i .Kidie; .Asps, Glu;
4i basic; Bis, Lys, Arg;
2016244220 11 Oct 2016 s residues that u-lbienc-..’clu-.iu oriennniow Gly, Pro, and oi urotntto-c: ‘Trp, 1yr, Phe
Cons-.-rx s’be asoino acid -obsiitn’itins may involve e\,h,utge of a mewfe io on of these vias-es w tft another member of the same eia-s Couwivative amino netd imbstimifes snay encompaas non-naturally oeemring amino mid residues, winch am typicaliy muorpomted hy· chemical peptide synthesis rather than by -ynthcsis in l-tologteal systems. These inclurle peptidomrmeiiev and other reversed or inverted ferns of amino aeid moieti es,
Noii-eottscr-ato, -.. sn’ostOutions m-ty nnube*he exchange of a menfe? of on.· ofth.· abo\ „ <. asses {ot a mcmbci now mu-thei claw sfe· sal st need u. femes may He wtiodiued b,t into iepuins ,>t rho embody that am ho’ee!o< ons <v»,h uiiriau arobod. -, o< nvo die nonhomologous regions of the molecule, in making such change- aceosvbug to cerium ewho-kweni,- die by drop tohe mdes of amino acids may-· he considered. The bydropattuc profile of a protein is cakiuetcd by as-m.-nn-g each amino acid a numerical value C'hydmpmky lodes ;aiu then mpetrnv cly ,o /ravine these
Viduex along the peptide chain:. Each amino acid has bsen assigned a hydropathie index on the o s-sor v by'dwmneb.edv w'd fegve dt mwier-mw 1 he- . *, n>oku„ ne i - ' -a urn i ' + ” s, 1 n- me t · 5 S ?. pb/rsy hduum g ”* 5 1 xy.-tenw c) son », ' 5 u we-i'Onme t ί l’h ahuuuc k I hl, Jycufe-Od). threonmcidl.'), sentu. s -0,3'». tryptophan 1-0,9): tyrosine t-1,5), proiin-.’t* I ORksOdU'e s-' ?1 ghttamat-..- (-¾ 5» giuiamme i~ 5) aspartate (-¾ 5 r asparagine t20 'M e, sire t e'0, a»d .uui'-me ί -t 7?
I he impownwe td the hydropathic profile in comcrrmp mtcr.wttvc biological tunenon ou u prinein is nnd--.rstood in the art fee, e.g.. Kyte wo/, 1032,,/. .)/)7. //.7.7) .1.57 105- 14I ·. it I- known that artim ammo acids may be -ubstimted tor other ammo feds hav mg a similar liyd-mpathic mdC', m -eo·-..- and still letaui a simdai Ιηοίονηί',υ aemfity In waking changes based upon the hvdropkhle index, in certain embodiments, the .substitution of amino acids whose hymepuihu snbic-c- ate willin' to is mo>ud-'d In some e-pc> % those which are wUhin
I ere w„ hided, and in other uspects, those w ttbut 10 7 -,uc included.
b r-also nudes-too,! m th ' an that the Mihsitfuf-en of'd.e umno i-eub t m f’ n„-k
-, th. et'sep, ou tit- basis of hydtopbiliesiy, paitienlutiy whole she bmloy ieally lumtionai ptuiew ?0 or peptide theteby erected s-> tmended for use m nnmueolotm d embodiment-, a- w the pte-eut ease, in certain embodiments,. the greatest local avenge by drophd-edy of a psotom. as uo'cmcdby the Ifere-fewem of tn- 'diac/uf muuo sod >, cone' tes w 0' tts immunogen un-, ai d ,w‘uge?i-i'nidnb m immunogene rt-, that is, w-tl- a l.io-oeietii mopert- ot 'bcpioteiu
2016244220 11 Oct 2016 ί he hnkm uig ip, ,lj ophth> u\ \ diiic\ have been nssagned to these -anmo ;·,« -d residues 'VI ,\M'C1 R) isoat.*„‘ ' 0< It „lt, , »{«· ( Ri ilVI'Ct d'i s\!ii>tk' ( rd * K gbitjmt''\' i 0 ?gA, me;()'» iB oem o-O-ss piohne'-d? Π, alanm,’ (-0 O, htviidme i 0 5h evstem. < -1 Oi med'ummk y-1 di satnu t -1,5b leeente t - Lhs, isbLuetne (? 1 Η, n resme t \u pnemUlnntne t λ?ΐ and nvpTophun i 5 is In tn i\mb chance*- bawd upon smuGr hvdiopbfe ns it- eeittno .-tnhodnne-'iis, dm sulMdutfun td anntm aeuis whom h\drophbe··'·, t antes are wabn τ2 A nieb-bd, m ether ensbo<imsenis. rhe<e w Itsvh >u ,· withtn ' I a-'e <n, leded. and tn etU other embodiments, iho-e o ubm ts ς< am meleded Os smile nssiauees. one mm also uk tint). epnopes trera piininiy ammo ae-.d i-eciueueea on the kw* ef b d'ophd:- U\ Tli, se rentons am <dso mtened io ns 'epimpi> core regions ' \entpiuv tenses \ utn e nnnno aeidi stshstUaiiOn*' are s< t brut m I al de «’
Table 0; Comorvfeive Audrw .Acid Subsihubook
Origins! Residue | Exemplary Substitutions |
Ab | Ser |
Arg | Lys |
Asn | Cfi.fi, Hr·? |
Asp» | Gb |
Cys | Ser |
Gin | Asti |
Gin | Asp |
Gly | Ρ-Ό |
!>. | Asn, Gb |
He | Leu. Val |
Leu | He, Val |
Lys | Ary, Gin, Glu |
Me | Leu, 1b |
Phe | Met. Leu, Tyr |
Ser | Thr |
Thr | Ser |
9b
2016244220 11 Oct 2016
Orlgirml Residue | E»rapl«-J SrtMHosiens |
w | Tyr |
Tyr | '11 p„ Phe |
Yin | lie. Leu |
A skdied etosan w «ji be to determine settable \au'.irtts n{ pub peptides as set I'oitb herein using wen-known techniques One skilled m the an may identoy stnl.thh’ ,uea- of the .roLxme that mas be eh mye.i wtthei.* eesuovtfe .mto us tw t.gyem'g teutons nm bJ-es' J to be impenam for activity The skilled -wm-mn also will be tible to identity residues uid portions of the tpolet toes tliut me eons-. rsi d among sunnas polypeptides hi imthei enibednnents, e\ et· are ts thut ntav be important for biological n-< to tty or lor strucmm m t> b.’ <ubu,et to uriset vativu .rnnwo tie· J sii'istitutto-w w Urnne lesitoy tn ; ts biAum J a, os tty m w tt-iout adversely affecting the polypeptide stmcture.
Id \edfitP ι iy,one «sf le 1 n 11 at' ,nn tev'ew soutu m*l ortso t-iwlnw mer'shr 1 rexducs in sttntiat polypeptides that ate important lot activity ot struciere, In view of Mteh - omparsoo, o m t a*' pm b t *be ..mportance ol am.,no λ,,,,.Ι residues ,n »* pio'cm 'be.»ermpo \1 m amnio .sold tesidwe- tmpotuint for aohv tty or '.itn>. lute ns simdtH ptotot's Otto skbled m the tri mis opt ler eh/miaul ly smnhrmmmonub sid'simmons fersucb predicted nuportan; ammo acul testdues
One skilled in the art can also analyse the Amhtnenslortdl structure and atnt.no acid oenuene · tn n kttson to that so step m m » aid m pe» pepnees In \,., w <n on- u mimmeiseo, .we skt'l.-J i the utt tr.e, meuset me ahcmr/ut ot uty-ino uud tcs'dncs ot mt mid t,.iv wph tesp.ei io ns dire dnmuvtn.i tl \*iiu tme One sealed m the <nt may eitoos not-o ot.A tub. at changes to ammo netd re-nuies predicted to be on the -mrtace of the proieni, sines such residues may be involved in important interactions w id· other molecules. Moreover, one skilled in the art may generate teat ;varianq eojitairtmg a single ammo acid gubbthutimi at each desired ammo .utd sestdue fhe-e v aunts ea-i then oe screened usmg assays tor t \«R? R m-msabeuin aciisn'y, to c esaniplus below t thus uehbne tnlbonatfoii tegardtng winch annno d? aCitls can be changed mid whteb. must not be dimmed itt other word-, based on irtiurnunion gathered moot Mieh routine experiments. one shilled tn the .-.rt e;m readily determine the amino ucid positions w here inriber substuvutoes -hotdd he avoided cither alone or in combination with other mtnudens.
0-7
2016244220 11 Oct 2016
Λ -mfiilH-r of scientific ρΐιΙιΠν.ιΐϊοη'* nave been devoted to the prediction ofscennhuiy stvuetme dtt.Mnuk. DM' -: m- {>>< Λ; /Λ<»λ,7< yddd 43, ( hou .:-o . 1974,
K.323-745 Cb.mm?.A, |o~4, ip?II-322, ChmaPo/, H7\ 4,4P,A\7m' A/mA ZkoA 4 /.45-145: Chou cmd,. P>7A .{#>?, A\ v. ///000001. 4 7,351-5 276; Mid. Chots u ,ιό 1979, BbytAys, X 36:367084. Moreover, computer progrants arc eio-e-:0y -e,aihibic to assist with predicting secomhuy stiuchtfe. One method ofpiedtctnig seconder·, struetme ts based upon horno'ogv modeling her example, two poo peptides or proteins the;- have a sequence identity of greatei than 30%, or snn-hsils g· cates than 40% can ha v o similar xiti.se lurid topologies. The recent giowth of the protein structural database : PDIM hes pros ided enhanced pw-dkiai'inis of secondary strut hue, including the pofontia! number of Inks άιιΑ a n-'Npe'b.L w« p oietN stj.etate Mr. Holm 0 7, 5», <’ i Ad ? ;.ί,Λ e~ h'i\bo” » ip-este 11 li’Cte', ί 1),-5-,-,-1 Btt-l to M 6 >
that these are a homed nwohes of trdd* in a given polypeptide or protein and that once a i, ritual number of structures have been re* weed, structural prediction will become dramatically mow ue-. node.
Additional methods ol prcdMmg secoiulnrx onteture m-Jude ''th;\admg Gooes, 199 i'arc <’p?a 7??’-<* 7.,,) Kv’~~dX~', Xipr4 t ? m , |'U6,>„ 4 15-59>, ’ p.'obl ’ analysis ' tbo'v ie e?o.’,. o*9t. Awe s?253 lo4-;7(.i, < triklos A,A, i*liΌ, l/crd A??e”,o BG l-K-B’i, (oibssos . i o’ -- A,/Ms ’for * o</ 7 ; \i 4H5..555A'} and' evohftiooufy 1ml age’ sAx.
l lolrn, I'foA -eo-m and Btetmer, TG7, we-m) bt some embodiments, ammo ac'd enbstimtdom; are made that; (I) reduce .susceptibility to ptd to lysis, (2) redone spaeeprihilrty to oxidation, 0) alter bind mg afdnity for fbtpting pre-min complexes, i l> ,dmr bg.md m antigen binding afunitto, and or {4» confer or mo„hp. other p!!\s-„o>, heimcei of imiehonai psopeshes on such polypeptides. lor example, single oils multiple amino acid substitmiohs (in -cemin embodiments, eouservative amino aeid std’stit'.foon*) may he made m the uabo nly-o, cmimg sequence Subslimtions can be made m that pmiion <4'th. autieodo that hes out-file the domains si toimmu ottArnoleenier coma.is 5. bi meh et ibod'meni.», cons, native emmo a, id xuhcnnmonx - ,-n be u-ed that do not suh’-tautiedtv eh ewe the -tmstmid 1 isaiuetriisoes ol die p mm? s.-queo.e 0 ; , one or mose replacement amino acids that do not disrupt the secondary structure that ehareetenres ihe gamut et uatf',·, eeingeu bindingpson.mj I sample*ofatt-oxoiinf/ed polypeptide see-imbuy and iciiiary sneemscs arc described m hrotems. Structure* and Molecular Principles M (Cightoii, 1 <!.), 19X4, A II, \,-w Soil, I fccm.w ,nd Cun-nat-x. Introducl.on k> Frigem
2016244220 11 Oct 2016 vtmerm · (Bnmden η id Tvo'c c<R ! RG Sosk Gcr'am5 iAibfobma ami ; immo-i ,, m’., I'Wl, YrtmvnSHOk which s?c each ukoi-pmated he-cm h- leibronec.
Additional preferred aubhodv vath-aus include cysteme variants whereat one or more ..e-^kine residues in the parent or native amino acid sequence are deleted from or snb-4ifoled wah mmhet ammo amd te e , serine* ( ysteme v tnaut- are u-cb.d, Am when minbodies must be sehbdcd into a bioiogicaliy active cimtormatiois. Gy-teine variants ratty hie- e fewer cysteine residues than the native antibody, and typically have an even number fo miuirmze trtenh t on- sc-alte e fro t . np< nodι v \}>n- eI he heavy und light chains, variable regions domains and DDRs that ate dr-do-cd can ί’ a-., d to pi pate pel· pepnde- fo,’! , oamm an atu-qc-n G-Mmy tegtoa th V > an sp t ig, .rib bsnd to t Gel·’ R, i'or esample, one m more ot the t DRs hv.ed nt I abk- n and 3 -an be incnrporafgd into a moleenlc (gyp, a poiypcpbde) covalently o? noncovnlendy to tnahe an inntmnoa.lhe.-ion \i- niinmncrtdhe-ion nm\ atempotate the i'PRm ,w natt ot a ;,uge? poypepvde cham may eova:cwy Imkthe GGRi 3 fo trni'oroolv p efide J\nn et m \
1.5 iAeo.tpo«rfo the CDR(s) noneovdetrby., The CDR(V) enablo the immunoedhesion. to bind spectikuMv to a pertwoho .mnacu co nnes-va w t, , k uRP P or epitope dt -rem) \bmeo,s n y , ''peptnb mimetic- er pepisdonnmeo, V'; based upon P.· -enable region domain- and CDR- that ate de-enbed herein arc el-o pro- ided. These analogs can be peptide-, non-peptide1· or eombin.-aiom- ofpepnde and no-'i-pcptide regions. Rauchere. ; 9X6,
GY /ν-,<> tw- he,2°, Yehct .md I icnbiib-r, Ifo-A ,7\<n ITA and! -nn-m v, lua',7 tfo/ G'Am 3d I '.A?·1, which are incorporated herein by reforcoce for any purpose. Peptide irutn-fos d-at ate -nucmmlw sttnOa*’ to thempeoneMA u-efir pepndes tnnv be used fo piodnee a amniar fhempetittc or prophylactic effect Such -. oinp«.ntnds ire often d.w doped w nn the mb ot eompatenyed mokimlaj modeling. G.-nemik, pcptoknuitnehes nm ptolems that arc srruetuiml- stnuhtt io an aiusbocb dispiav atg a desired Guiog-ea! aetiv ny, -uch as hete the abihi> to speeidealb. bind C GRR R.htn Ko e one of mor·- peptfdv nnhage- optionally replaced lw a linkage--elected lienn Gli-XD , t I l-b , -GD' -GH. -CHA II ms and iraii-b GtRIG. -O hOI I sGi i -. and ~G> 1 -SG~( by methods w eli knewn In the a: t System me -nhsninhon of one or mme ammo a. ids of -, eon^m-ns sequence with a D-tunno .m-d of the -- one Rp. r g ,
D-ivame in place of G-lvsinef nutv be used in certain embodiments fo geuemte more stable proteins, in addition, eou-naiavd peptides comprising -, consensus sequence o· a sub-ttnUtailv ideinieai consensus sequence variation may be generated bv methods known in the an i'P.igo uild Gierasch, 194?.» · -;nn ,Άί- Zbm At-m. pi:.IS7), ineorpomied herein by reforeaees, for
2016244220 11 Oct 2016 e-suinple b? «.Ming Pion d cysteine -estdaes ear u«le ot IXnung niu-aitsoieeni ir dtsnlbd.' bridges winch cyclic the peptide.:
Detm ttf\es Adie .mtie.-i; b'.ndmg pioieins that are deser-U -J herem me also pun ided 'fee deti\atszcd atutgen binding proteins can comprise any molecule or suh.-tfunee that imparts r< a deseed pmperiy to fe umibo<R or fragment, .-meh ,n inetv tsed half hie in a particular use The doiisnniz'.ed antigen binding protein can comprise, fm example, a deteeitthle {or labeling) moiety {ey t raJtoacnu, cokmmeiric, aungAe or cncy malic moleeu-c, a deieetehA head i'-atek as a magnetic os deetrodeusc te g., gold) bead), m it tnoleenie that binds to another rnoleetdc {ο.ν,, biotin or siiepunodut5f a the* ape tine or diagnostic motetv tc g , a radioactive,
H) cyioto ;e< or phunnacent Lally arrive ntosetyp or a inolceine dint increase*·· the ,->utt<febiy of the antigen nmdmg pttfiem lot a parti, alas use R o . ddianttisifatiotj to a stdeect, seeb us a human subfebor ofer Zo my? or Zp fey? uses)., Examples of rfidlecufe that ew bo us«d io doriyatfe an antigen binding protein meh-de albumin tc.y, human -on mi uihnnuiit and poly eim. Seise glwo! tPKR, Albumin·linked and Ph'GG.ued dcmaioes of antigen binding proteins can be
1.5 piep-ncri using techniques well hnoon in tiic ait. ί ettaiti -ntf-gen bmdmg piotems inekide a regy filed single chain potvpepiidc as described herein, in one embodiment, fe antigen bmdmg piotein .s eonpig tied os nfetu'oe linked no n mistily t etin t1 Tx) or a FTP < <n t.utf I he 1') R nr f I'R ν,ϊ,οΐιηΙ cait be chctnieallv modified with, tor example, a chentieai Meetcd from die g oisp consisting of >b-\iran, poly «η-v tm> I py rrohdonot, poly efe'lene giycoR pioprvpy lone glycol hotnopolytneis, pnRpropy lens' OMde’ctfn:cne oxide co-pohmets, poi\twyethylated po'yo's mopey η' fame ο
Other doixebscs sm led. < toaiem, m aggiegatixo -oimtgntcs <e% GisR R binding proG-irw n db edict piviems or poly peptides, such as by expression o) recombinant fusion i'ioicujs lomprisnig hot·,, π «logons polypepiftlm fused to die N-ti.tminus oi C-tOiinnins of a
2> ( GRI' R I Odum p-vlei't ’-o e\un. pie. me eoo.ueatyd. oeptioe m.o K a betetoh-gogs -'uiel tot I adet 1 pofecp'fd·. < o , the ye*·»' alph.i-i.n *ot 1 adci, o1 a n. pude meh as an ’Pitope iag CGRP antigen binding piotent containing fusion psmem- can sompnso peptstks added to faediiine puritleaiion or idemtikmum of ihe CGRP R 'randmg pro.vm g g , poR-11-.-0 s ( GRP P binding p-’oteni also can be imkad h> the 11 \t - pent.Ή as eles. nbe-l m Hoop < > m,
IbbS, ffeAbfeio/o®? b; 1204; and United States Pafeof No, 5,01 I ,9)2, The FLAG peptide is InghH anti-geme and pios toes -,o epitope te\ emti-'U. hound o\ i spot ilte monos Iona', .mm'-Gs on Ab). enabling rapid assay and frefe purifiestion oIAxptvssed recombinant protein Reagents usAl tor piep.unts·. fusion protein- tn u Inch the I'l \G p>, pitde i- feed u> e gtSs'n polypeptide arc commercially available (Sigma, $$, Louis. MO),
109
2016244220 11 Oct 2016
Oforometx ro η .onktin <'w ot »»w t, DRR R -«rohro. protems ot q be ’ropkqed us ( GIG* R aroagomsts t)hvotue:s mam b< et the form of eos'd/mlronikcd ot eon eosulentlv finked tinners bmt,m* or lugger oheetocbs. Dln’omets composing twoo; root* ( i.-RPR binding piotems am cnnteanplated for us„ writ one «sample being a bomodirnet', Other oligomers Inehfee heierodunero, homotrnnem, hefcroirimers, bomotetrnmetx hetcrotets'nmcrs, cm.
One vtuboduTient n directed to< oligomers eompiroug mtdttpt. < GRPR bmdrou po-\pepfides jmtfed i>,< e-unkte m non-e-.wafem mtetnctOtisRfiv en pcpmfe mroebes lusen to the V GRP R binding proteins. Such peptides mas be peptide imkets (spaeetsi, or peptides
H) that ha\ tn 1 pryp>. riy of promoting oltgomeriyairon. I eucme zippers mid cenmn polypeptides derived iron; antibodies sue anting the peptides ibat can promote oligomerization off GRP R binding pfotenm ait u bed ther Io, as dost tmed m mote detab below fit pmiteukr embodiments, foe oligomers comprise from two to font f'GRP R fending ptoi ,-tn* Ihe CGRP R binding tnotero moieties of tlx obuonu nt.o be »n m> -d the t'-'-rois
1:5 described above, g.g:,. variants Or ffegmccfe. Preferably, the oligomers comprise CORP R bbtdfeg proteins that have CGRP R binding activity,.
br one embodiment, an oligomer is ptepnred using ooh peptides -Icroed from immnnoglobulins, Ptepmwtion ot firoon proteins eemprisine cedant luterofogous polvpeptides fused ty \ arsons portions of antibody-derived pobpeptides tiro hiding ihe F> domain} 1 as been described, e,g,, by Ashkenazi et ok, 1991 , Croc, Mri/. rieufe Sci GS.i 66:10535; Byrii et 0/., t’f-tb, fec.ro 5 H'·'-·'1, and lloitenbaugh m' , fox? otroruettoe of immiisb-gl-feubn fusion Protein*’, m ( uoen· Protocols sss Immunology, Ruppl m pages 10 l‘> 1 -1 (t io 1 line embodiment is directed to a dimer comprising two (nsion proteins created by fusing .-. CGRP R fendmg protein to the I e teuton of an antibody The dunm can be made by, hu «s.irnole msettnic .· gen« ro*nm ereodum the tesOtt ptoiero tmo an app-.opr ate evpiess-on sector, es pressing die erne fusion m hero tell·- oarisiortned wnb the ?e> ombmant -esps'sronon \eetoc and allow mg the depressed fusion protein to assemble much like antibody molecule's, whereupon Interchain di*nlbde bond'* tfimi between Ihe I c moiebcs to yield the’ dimer.
Fisc trim ' 5 e poh peptide'' as used hetero includes naltse «ml tmib.ro lornis of rely pert: do* de; A cd from the he region of an anuboeb 1 runeroed torois of ,*neh poh peptides eommmrro the binge region Run promotes dimerization also arc inchubul bustou proieros comprising I'm moieties bmd oligomers formed therefrom) oiler the >gh enrage of taeilc pnrith .coon by affinity eh-'Omatogmphx o*ei Proiem \ ot Iholem G toburoi*
2016244220 11 Oct 2016
One *-mlablc fc polypeptide, described in PCT -Application WO to tOtsf and Gnited State-·; Patent, No. 5.426,048 and No, 5.262.522, is a single chum polypeptide cstending irom the N-',- rmmal hmge region to to.- native C-',.-rw»nn· of 'die he tegton o: .1 humvo antibody Auotbef useful F e polypeptide is the be mutein desciibed to 1 rated Mates Patent
No 5.45/,035. and in Boom et ii/,, 190-4, £5///(5,5 jj:39^2-4001 The amino acid sequence to bus mule»· ts i-icnt-cul to that of the native i -.: sequence piv-entcd at W<) 95 I OI 5 I except rib? amino acid 19 has been changed from Leu to sht. amino acid 20 bad been changed ton-. Lets to Gio, and; ammo a„id 22 lias bee» changed now <ds M Ma Phe nuium eVu'wts rcda.ed a ton; ty for be receptors.
it) in otbet v mbodimeius. {be variable portion of foe hcoxy and or light chain* oka CGRP
R buiibup protect -.«eh a-* disclosed hetetti mac Ik substituted im the var-ahle portion ot an antibody heavy and/or light chain.
Mier» at · els. the obpom. is a fovwi p-oi'-m conet»fO»g mull-pic t < IkP R bsoraor pi» n* v d oi e'To tt wnsec ·,···· ··.,_ pern d o vo® 1 x *»w to pepiuv > hikers are those described in (.«tied States Patent. No. 4.751, i K0 and No 4,955.235.
Another method for preparing, oligomeric CGRP R binding protein derivatives involy as- ot' — leBxme mppet' 1 eawne .'upper domain,- a»· peptides that promote obgome- t/atto’i -, u the | twins n..aeti tee·· .«c ..o„.a,... Leucine ...spinis oiminaJx .to n ned m w-, „ a DNA-bmdmg p-oicins <1 antoehub e< fo, i9Xs, fo ., a. o 2-H- I ’59j, ui-1 have since bee» found
2(1 m a vuricw to diflerem proteins \mwig the Know o Icuene wpp<. r.- are tiatuudly occurring peptide1 and derivatives theretothe; dintervc os trnn-.-ri;e bsamplcs » leucine trippes domains sorae-le sot pioductng soluble oiigomet-c proteins am -tescidn'd in K'T application WO 91 )O?0-x and the kiuinc /ripper eeso ,-d from lung oarr'ict.mt protein I) (3RD) described in Hoppe;? u/. 1’t‘A / /.7/,4 / cm >44 i^i.lietebv louer-wat/. J b- ick-msec 19-. usi ot a modified h. ucme zippei that allow s for '•tul-le timiet teattmi of a haietoogon·. protein fused thereto is described in Fanslov, <ta/, i’t'M, oavi’<? bvm.vj .,·/ 6 26ΎΎ In on-.-approach, meoi lb·,» e-t o -,-ei pioteuts comp ‘smg a t v >i<P R b ml m„ Pioteai f-aenmat o den> atsxe fused »i a mue-nr /;ppcr peptide ,nc e-p5'- l-sed m swt-ibl.’ ho*-t cel's, and the soluble oligomer» < GRP P 1-mdma protein i'ruements nt ikovauxcs Tut two- aie reco>c;e-.· t-wu ihe cainne sdpcrwwmt, hi certain embodiments, the anime» binding protein has a kt> fe.'pubbtuitu binding affinity ι of less than 1 pXt iO ρΜ, ϊ 00 pVk 1 n\l, 2 »M. 5 n\t, 10 nM, 25 »M or 50 oM
Anoihet aspect pros ides an aniineu-bindiiig ρ-otei» hoy'»;g a 'ualt'-tue of at lea-t one day »< too,; or w rfo; fog., when administered to a human subjects bi one embodiment, me
102
2016244220 11 Oct 2016 antigen binding protein has a half-life of ai leasi three days, hi another embodiment, the autibo.h oi pomon theseol h-ts ahail-hf„ ot font daw o: lomaci In at'olhci embodiment, the anobosk or po-ion fh.-w of has t halt-bn-ot'entin e.tys or longee hi mothef ombed-meni. h;,. antibody or antigen-binding pomon theseot s det'oaheed oi modified -meh that it ha, a ioiu-er half bfe as compared to the nnderivatieed or unmodified antibody, in another embodiment, fho amngen kudme protein contains point mutations to meio&sc scrum half life, such us described sn V O od tnifod, published Feb .? D 300b, incorporated h\ reference
I Kton he anticen-bjndmg piotcm Out base .¾ gl\ce\> lation pattern dint is different or altered fhipi that found m th-’ oafs\e spe, i.-s As is know<t m rim >ut ghcos} htPvn panelm t an denei'd on both bx sequence ol the protem <',·- the presence m absence ot paineular akeos;, kmoo ammo a, id nd-t -s dtst msed k-kw s, oi the best ceh -u mg, eusm m ob'-eh the piokan is pioduecJ PaibcstUt espiesJoo ^vstenu are -ksems-ed below
GhsOig lotion of pop, peptides is o,pwalh either \ -linked or O-linked Vbnked refers n> die attu. hment of the uukOv, .hate moien, to th- side chan- o- „n ,-.spa'ag.nc levdtte 1 hc in-peptide sequence- asparaeme-.k-serme and asparagtne-X-ihreoninc, where X is ,m\ an-moae?d e-,e, pi pioluie, 'c- the lec-ymiPoo s- oitet^ es tor enc;, maim attachment of the embolo .hate moiet? to the ast\nau„ne -,\b chant, 1 has. Hie presence co esehei of’h/se in peptide sequences in a polypeptide creates a potential glyeosyladou site, O-bnked
2P J>u-s\ khon feie-s to the a:ta„rm ent of one ot m„ s.v; -> k ,c„f > u d< eiosammc, ga'aetosc. o xylose, lo a hvdivcyimmo aem, most ^ommonty .-enne or ihteomne, althot eh ? lo dtossptubite οι 'dsvhoxs Issmc tu«? JAi. used
Addition of gb eosyi ifton sites to me antigen bin,tine protem is coweni/ntx accomplished t'y idtcrnn- the amino turn! seqnenct. such that it contains one oi more of the abo$e desetthedrn-pepudc s„qu;pecs (tot k-lmked ei\co-station s-tc-d Ihc .dtetnnon m,o aUo he mane b\ the addition ol of snhstmmoe b\, on.- ot mote s nue of dneonme rewdr.es io the staling. sequCfiee tfoi (‘-linked elseos\lat-on sites}. ease, the antigen 1-m.lmg ptofent ammo nod seqnc me mac ho nPe*en -hroagh - bam:r<- at the I'fkA lose!, partu uksdy b> rmfianng the Dk \ euct,ditty the tai get polypeptide at pis selected bases .such that codons are generated that o ill mtnshife mto the de-sred amino aesd-, knofhei means of mere is- tg die nnmhet el emboii,, .hate moietms on the until -. n hindina protein is A ehemse-d or eiv'.mutm coupling o’ e’veosides to the pmiem ihese pjoeeduics an ch.-jit&geons m that fk \ do not mqiui. ptodu. lion ol the prok-tn sn a host t eh that has gh, cosviafiott capabilities, tot X- ,-.nd D-tinks'd alyeo-o iamm. Depending on tbe
2016244220 11 Oct 2016 coupling mode tued, the sugaris) may be attnehud to i a) arginine- and hiriidiue, fb) free earbo.syd vt'Otips, tet tree suiihvdtv I wunps such as these id' essteme, t,H Itei hydtoxyl groups sn· n t\ those w -w 10,-. threown.' or by Jrosy ptohu,-, ·,οί tromatte iv«dsseo such <A tbo«,- of phertvlakwatte, tvrostne, or n\ ptopitmi, os u't the amide gtottp of glutannuc Ihese tneUmds ate dvsenlxd in V- O $’'05530 published Sep i I. k!S'\ and in \plin and Wristow Hte j f,\’C <’>>/ #m fi v<-, pp, 25°Π06,
Removal oikarbohycimte ntoicite?- pre,-cut on the starting antigen binding protein may ba accomplished chcnneatis w anz-m meahy ('h’.?Wa>„al d^giycosylaiion τοηηη>, ·- mposme of tbeptotqin to the qompouad bifiuot'omethmtesoktbote aetd, or an equivalent compound, Thia
It) treatment results in the , Ravage ot most or ah sugars a'.ept the 1 wkmg sugar {Xte .web Igluvosiunotc os Vaeeiv IgaDuoMminek while leas ,ng the poR-pepti.'lc ntteet Chemical degjyvasy :,otoo is Jest ttbed ay ’bAsmuddm -1 ,d , ΤΆ s(< /?-, , /\;η ,9 ,-g - . ?yp rp ίΛυ;{ by I dge t / at, 1‘frk ,Μιί/ itkki Λο-ίϊΐ IH Hi bmyutato ckasage oikalhohy d,raie mesiettes ott poly pc phdes can be achieved be tbs' use of a variety of endo- ,md evo-dveoodsses nv described by Thotekte'a m of ? 1987, 3/eril fri?zwte£ 1.38::3.50,. Giyeosylaiioo. at potential glyeosylatton sees m,e, be prevented by the use ol the compound humanly cm <ts described by Diisl m c: η/ Hvy g 3<; p-v~ i pyy Πμη,,'πην am blocks the ibimafson of oroteotA glveowdc huhug;->
Hen - , asp -· is welt-i ’ gkeesy iauou veti.tnt* o'the at-ugen nn.dtng protews wk tern ’he e, whet md, ot 0 pe o’, Reo-v wmn sjtet ,ιό, Ken alts'- 3 eempmeo .0 tb m.vte ae ,1 sequences of rue parent roly peptide. In eertaw embodiments, antibody protein v ari.inn. comprise a greater or adesser : number of X-iteked glgeosydaftou vires than the native eetibody. An Yltnked ghvoyriation site is characterized by the sequence; -'wn-S-Ser or AsnXlhv w h.aem the ammo ui id residue .l-w-nated 0 \ ma> be any emuo >icui tesidiic cm apt poTu,
2*> I .est Ps'iVjtto 0 armnoauP es lees u<create fit's , tp e> u rttos.des t Potential new s >„ |,u ihs' t'ddit'iin ol an Vbnhe.i t a-bohym ae ham \h- ru.oweh, sub-ertfitoos that ehnnnata or alter this seqnenet, w tit pt cut addition of an Vlinked sarholtvdiate- chain present us the nmric polypeptide for es-itupie, ihe niyaosy hnion >..;m be reduced ny the doleoon of an A.\u or by suhsutsttniu the Ase with adofetent amino acid, hiotbei etnboditnents, oneoroiore new bklmlted site.-» are -. re a ted fouteodics ty pteally have a N--linked glycodylaticn site in the Fe region
Labels and Effector Groups hi ,soiua enibodinieuis, fim >utrigenrintubus: eompi ises one ot wore labels The term 'abeotiv uowp' ot ΊΗν' weans any dte.eeiab:c Loci 1 samples oi -u u-ble label-sq. motets
2016244220 11 Oct 2016
ΚΙ
3.0 unhide Mn m rot to the iollowmg rmhe5\ok>p>1 o? radio ns, l«d‘ h< g,, 11 Y\
S.'A A'k. ’ In, '1 '”ji, II· loresecM groups i zee, t-isC, Ihodatrutte,iandimnde phos >beo >, en/y mane groups p g , hvoe\,dtsh p rosida-,, I’-galn. tosnlase, la, oem-m, alkiduK ph'WpduuKP ckoihurou’ieseent groups, b>oiinvl group-got prcdcterntiued pok peptide cpinipes recognized by u secondary reportei toy., leucine zipper pair sequences, Gudina sues fot s,'eo'id,i!> .ernbeihes, mead birding dom on-, epitop.. tuns) In some embodimc'the h p„ug group m „o.ip'cd :-1 the antigen pi: du.u protein i<u .-pis' ί mis ot various lengths to reduce potenii-ti sietu hnnDanee V?,irons method- tin i.ibeimg proteins are known nt the an and may be twed us is seen it
The etm eftbetm gnuip means me. ηοιηρ -.oopled so <m mtdgen binding prut, m s' ,,i ads ,;s Λ esmto.sic «acU I \antp:es |<n -eiu;dd„ .-deetot gemps „re fmati'i-otopes o nm.ou, id m< g, 1' <1 S -v, 1\ 1, it tbheistd.il· group-'nt h ee ne.ms, foetapeuKc gsonps, or eheroortrctapeiUie group- 1 'samples o’ suitable groups include c«h>, hwtrmehn uunsiatsit,- geldanamyein md m tytartstne, in some embodupems, the effvetor group is coup led to the anti gen binding proton) cur spacer arms of various longtbs to: reduce potential steric bfodraoee.
b> gen.-ral, luln-k ltd; uuo a sanely til eluso. depending on the a-sac In w hieh dies ate to ΐ\' detected, a) i-otoptc lubeX, which aiav he lachoactiv a or kc,iv v .isotopes, b) nsanmusc labels o. g , m ignetie paritehs}, et redos active niofeUes, ,1? opimel dyes en.wn'atn gi'onps tzee hotsetadtsb peros-.d^se. p-e.de.eto-ida-e, luctiertse. allahne pho-phan-e}. et btnprsv sated groups ano ri pseddetpttned nolvp.-prole epitopes ><'.<>,-meed b> ... secondare lepmurr g t,, leucine sripper pa& sequence^, binding sbsn for yeeonriagy unubodisn, uietui, binding deenuins, epitope tags, ete t, in some einboibtnenis, the labeling group is couoled so die antigen binding ptoicm spa,arm-ol vat sou- lengrosu» ledu.e poSeuPwi -ten» Innd.anee \ -,'sons ipctsio.ls tr>: hhchiro ptolents arc known m die art.
Speciin labels inelnd·-optical dye.- including, Inn not iimued to, ehromopnms.,-, phi'Sp', οι-«ml lino vpUnes w,f, the'aite P-u v spcc-bc ,o u ato tustai,c«» IIt.o op: <n.-. can he euher ''sum!! mole, ale*' lluores or protein,-loroo- ilw.By 'TliiOrescont t-abef' -s meant mn moke uie ih.u may be detected via its inherent fluorescent properties Suitable fluorescent labeU include, bin are not limned to, fiuomoeitp rhoriemu:e. n.'i,unetlo hhrokunroe, coon,. nthro-m. eoutnatm. ns thy;-, oumasuis, pyiem. Maisen.-green,s'dlbeii/, l.nctfe* Yellow,!' tsetde Blue,’, k\a- Red. lAHbWS, VOWS, BOPIRY I'i , I (' Red Odd, ( y 5, C> 5 5. 1 V Red Al·’, Ptegon gis'un, the Alc-a-I'Inoi gws trile\a I loot .Ash Aleva I luot tert. Ye\u i krordus \ri\a rnmr.'-de, \L-\a I tuo: bob. Ak-\a
105
2016244220 11 Oct 2016 loo. Alex,* Pinos t 7) Ak*^a 1 dot fi{“ Ah xa r<uor060, \i \a Pipoi ChUL I .wCul· Bloc, CAscade Yrilev and R-phyeoei-ilnm (Pi 1 (Molecules Probe·*, Ragene Did, I I Π', Rhod<nnnx\ and Tt«<n Red {Piero-,, Poeksosd, ii ), (\ \ r ~ ί \ i Anu t darn I ne S> moee, Piltxhagh, PA'» hummi- ορικηί decs, memduig Onoroplnxios. ate described -,n Mdt ί > Vi \t
Pbe'-u Ή \\5«4- (>κ % R^ka'.d P H«ug: inch hctem ’\pressi> m> orpomt-'d by 'eferuxe
Smlal 'e pouets.uc tnt\ dnoscxcew I Ρ» A also i’k hide, bv no) iim-md to, g.ecn tluoresecm protein inehidmg a Panda, Pidos-ncns, or Gnmorvx ssvete·* orQFP iCh,>lfi,e e? >F, rood, \ „ , , do > k02-N0'R>. I d: P A loe.e-1 I uhs , De , Cerhur'-v A. eaxsvu-Num't i l 55”Ρ2), him. nnoroeent protein iBl'P, Quantum Bioteeimoiogtes, hx„ Quebec, Canada;
1.5 No. 577707% No 56043X2 No. 914 No 5Χ2νΜ5, No .'ΑΡΡ'ΝΜ
Nut'lew icfitx linn encode for the nnfigen binding ρ?οιαη,* described her-, or o;' porrioo.i ihereoi. ,kc aGo provided. including nudeie acids encoding mte et Poth chains of an atsnbodx, or a fmgru>,-m, perkanx-e, ?nutem, or van no thereof pob.nueh'oodes encoding y eh uu satiable regions ot onb, CDRs, potynueh.oitdes sufficient fot use as hybrdie.oton piobce, PCB primers or sequencing prinxir Hu ukritBuig unuivzrog, nuiHdsn.g or amplifrine a poGundeotfrie emodtre a pop* peptide, anti-s-.-us-e on-, rise acids io? mil-biting e\ptesvo?t of a p-ηχ nucleotide, tnd complementary sequences of die foregoirm the nucleic acids con h.> un\ length Fhey can he, fi» pxampky 2 IP, a-, 20. 2R 91 IR 40, 42 Ό, 72 too, 125 Do, CR
200. 250, Rh}, 550, 400 450, %{ρ- %o, 1,000, ),500 or m.nr, uurieotiiks ni length, and or can compose one o; more Qdrionui sequences, fi> example, regal,lUmv sequences, ami or u- pan of i lamer i\,d-.e ,esd, hu -xainp'e, e x-.-io; lb- me. e,c a.'d·* e.et be *meL sOamkd m denote si? ,n,;e I and e.et ικι-ψην kN \ are ?n DNA m - 'em A, % and atfkr*i x arums tn of ie.g . peptide naekte ands) '1 able shows exemplary nucleic add sequences encoding ,>u IgG2 heavy chain constant segton, a kappa itghi eia-ati constant region y»j.l a knnhdu nr ί-i tight chain eonsta.m region Any xanuble muton poo ded herein may he aim-.hed m thev constant regions H- firm <, ?>mpb\o Guvx and held chant seqaemes ikmev.·, ti shoni.i 0-' mt-le-siood that iha-e
Cf'-isnnu revmns sequences are prov tiled as specific examples only --- one ot skill in the tut max
2016244220 11 Oct 2016 ,-mp'.ov oibes re gto w, π,, bidmg by Ή 'n’<5'> -bar? iet>'!\ b’CC ot igtsd heavy eham eon-dimt teutons, ans of the seven lambda hght chain eon-wmt regions, including hi l-!,h( I ~lb nCt -v and hCt -7, uvnM.nn regions th » have been modsbed fm improved shsbuitv, esptesumt manager luiti no es othu ecsned vbauste,tst,es. me the ni,e H som,.
embodiments, the variable region sequences ne joined to other constant region sequences that am ί>u i\\i at th,. ait l-v.-mphey ttneiete aetd sequ.-it.es encoding hews .md hoist eltiutvariable «egions ere provided m table X table 7: Fxemplan tk-nxy Assri light Chain Constant Region Audck* Acid Sugncnccs
Type | Nucleic Acid Sequence/SEG ID HO, |
lgG2 heavy chair» | gciagGaccaav}ggGOG§lcggicitGCGcetggGgcccigctc®ggagcaGcicGgagagGacagcggcc cigggcigtxiggtca3gg8ri.acitccccgaa-xgg?ggcggigicgigga3ctcaggcgcicig3rxagcgg GgtgcacacctiCGcagGt-gfcciacagtcctcaggactclacicccicagGagcgtggfgaGcgk>xefccagG aacticggv^cc^gacctscacdgcaacgiagaiGacasgtxi^gcaacatxaaggtggaraasacagt igagcgcaaatgitglgMagk]cccacggtgGGcagcaccaccfgtg<}caggafX$)icagtctlcctctxece txaaaacccaaggac<iCcd.txvlgai.ci.ccGggacqxjlgaggicacgtgGgiggiggiggao-gtgag(X3C· gaagaxGcgavjgicGagitGsacfggiacgtggaq^gGglggaggtgeataatgGqaagacaaagccacg ggaggagcagbatacagcacQliocgtgtggiatycgic.ctcaccgttgtgcaccaggactggctgaaeggc saggagtacaagtgcaaggiqccaaGaaaggcctcccagcccacaicgags^aaaccatetecaaaaccaa agggcagc'X;cgagaafxacaggigt8Gac0ctgccixcal<xcgggaggagatgaoc<tfig3g{xaggtc agccigaccigoctgghtaaaggcltciatxccagttgncdd^cqitggagigggagagcaaigggdngccg gagaacaactscaaijaccaeacdcccaigctggactccgacggctccficttGCtcfecagcaagcics^ecgt §gacaagagi:aggtggcagt^ggggaaGgicdctcatg(..lct>gfgalgcatgaggcictg<Ga®accacia0 acgcagaagagcctGtxGtglcccgggtaaatga ISEQ ID NO:2§9i |
igG? Mw light chain | cgfecggtggcfeca^atcigtcttealdteccgceafetgaigagcagttgaaa&tggaaGlgGctGtgtlgtgt giXigctgaataaisticlatcccagagaggccaaagGcagiggaaggtgga^acgciXiccaaicgggtea ctGGGaggagagtgiGacagagcag^cagcaaggacagca'Gctacagxtcagcsgeacectgacgctg agcaaagcagacbtfteagaaacitcaaiKfichvegixtgcgaagxtacccatcngggGctgagGtcgcccgt cacaaagagchiwcaggggagagtgttag iSEQiPNOiWt |
igG2 lambda hCL- 1 light chain | ggtegGCGaaggccaacsaeaGtgtcactc^ncGcgGGaiGctctgaggagcfeeaagccaaGaaggcGa cacfagfgigtqg3tcagigacii.ct3Gccgggagcigtg:3cttgtggcciggaaggettgaiggcag*W:gtc «sQuiS'dS^S^SsgaGcaccaaacGciccasacagagcaacaaGaagtacgqjgGcagcagciaGGtg agcclgaGgcGcgagcagiggaagtccatcagaagctacagctgccaggicacgcaigaagggagsga^jgt ggagaagakagiggcccGlacagaafghcatag ISEQ ID NG:2S1] |
107
2016244220 11 Oct 2016 fable o shows cscnnVan nuclei; ac;d s. qixnees encoding he,e<y cknn and huh? chant \usbhie regions, in which id·.. sunou*· CDRI 1, C Old ? and CDR? 3. or VDRIH, CDRH? and CDR HA sequences at'»; embedded.
Table 8: Exemplary tight unci Heaxy C hub V anabie Region A'udek Add Sequences
Reference | SEQ ID NO. | Nucleic Acid Sequence |
2E7V, | 176 | gaCidixaQtnigtgdxagiciccatecfcfxigtideeatagleggt'igaithgagtefcDPcadl gccgggcsagt^ggg^nagaaaigattfeggctggidcagcagaaac^gggsaacscc (Mm gee tgaimigctgcaicesgilgcqhsgbgggfcceaiceaggiicegcggcagfg gstegggaesgaBcaetcfeaea^ tctacvsg^^^latttacxcgtggacgUcggc^agggacxaaggtQg^^aicaaa |
13H2V, | 176 | gacalceagetgecccagiciccatcclct'xigtclgcaicigteggagacagagicfiecfdcecit ge^ggcaagicagggcetiagaaaggsttleggctggtelcagcagaasceagggaaagcc cctaagcgcdgetctatggageatcceghigceeegtggggieccaicaagghcaQcggcagi ggatctgggacagaadcacicicacaa'Xagcagccigcagccigaagatttigcaactia'uacl giciacagiafnaiagdiccegigga^hcggcceagggecceeggiggaaahsjee |
3385 V: | 177 | aggtgcegdgglgcegicigggghfgaggtgaageagleiggggixtGagtgaaggtetedgc aaggcdctggaiacaccttcaccggc’isclafetgcaclggglgcgacaggcccciggacaagg gchgegtggetgggqtggateaaepctaaeagiggiggcaeaaacteDiacegasgiheegg gaagggica^i^gagcegggig'UAtgiCiiatetgeecagccfaetdggngcigageaggelg ggalctga^acacggccgtgtaUadgigcgagaaatgagtaiagcagtgcciggcoaHggg gfetiggggccagggaecccigglcaccglclctagi |
4H6 V- | 178 | gabUglgatgaclcagtciccaiAclccdgcccglca^cctgyagagciggccIccalciccig eaggtctsgtcag8.gectcd9C8tagtDg9giaca8ct3tiiggahggtacHgcaga»agccag ggcagicicca<;^gGfcc-getcdttfgggri<;iaaU;gggceiceggggtce<,igaceggifcagi 9gea9tg9a^ggeacagaBacactga8aatcagceg»agig9aggDga99atgUgggg hlattacigeaigesagcteia®aa3ctec3lteact&ggc(xigqgaeDhisgtqgabic.aaa |
lot
2016244220 11 Oct 2016
Reference | SEQ 10 NO. | NuAfc Acid Seqaence |
SCO, | ns | caagtGtagtcagagcctccigcacagtgGtggaaagaGGtatKgtattggiacGtgGagaagx agg(:i;agGGtGGaGagGt{XigalGl.atgaagUk;«)acxgUGiGU)gagtgGcagalaggtte agtggcagGgggicagggacagathcacactgaaaaicagccgggtggaggGfgaggatgte] ggaUlafeGlgcaigcaaaghUGcgGUcGgcl^G^GggGggagggaxaaggiggagatc aaa |
SFSVt | 180 | galalt3ttaigac0aagaGtGcaGltfcteigtecgteacc'Xlggacaga;ggcacGatctccigc aagtetagtGaqagcctCGtgcacagtgatggaaagaXtetSgtaUgglacGigGagaagGCG ggcGagcctGcacagciccigatGtaigaagttiGcaacGggttQQggagagccagai'aggitGa giggGagGgggiGagggacagaittcacactgaaaatGagccggglggaggctgaggatgtigg gacUalfeitgcatgcaaagllkecgebcegcfcacHtGggGggagggaccaaggtggagaika 38 |
1WW | 181 | gataUacaitgaGPGsgactGG^ctttcnkgtccgtctGGcciggacagccggcGtGGaiGicGtg GaagtGtagixgagcGtelgGaGaglgaiggaaggaactalclgtaFgglactegcagaagGC ^c^^wg^gc^c^aagtgtecaa^ghfetfetgge^g^gataggfic sgiggcagcgggtGagggaGagatltcacactgaaaalxgGcgggtggaggctgaggatgFg ggatttettaclgcatgGaaagiiOccgctlcGgclcaQitcggGggagggaccaagglggagatc aaa |
0J-*/ 'Λ | 182 | gaaaUgtgkgaGgcagictGcaggcaccctgietUgMccaggggaaagageqaecddxt gcagggccagtGagagigiiagcagcggciacitaacGtggtac'GagcagaaacGtggccagg ctctx:aggck',Gt{tetkaiggtg?teta.ag-;aggg-'Ga-Giggcat!>GcagaGa@gtica§tggG ^IT-OSSiGOSSISGagactlcaGiGiGaccaicagGagaGtggagcctgaagattstgcagfgiatt aQgkiagcagtalggtaaG-GactglgcaggtUggcGaggggaGcaagGtggagatcaaa |
32H7 CS W | 183 | gaaakgtgkgaGgitegtGtxaggcaxGtgtcttlgfctaggggaaagagecacedetel gcagggc^gtcagagfgUagcagGggciacttagoGtggtacGagcagaaaGGtggccagg ctexagaciqctcatctglggtgcatccagGagggccsGiggcaixcagacaggttcag^gc agtgggicigggaGggaGdcaGlGlGacGateagGagactggagCGtgaagattftgcagtglatt acIgtcagcagtatggtaaGtGactgagGaggittggxaggggaxaagctggagafcaaa |
HQ
2016244220 11 Oct 2016
Reference | SEQ ID NO. | ftadefc Add Sequence |
33E4 Vi | 184 | gaaabgfgafga^^gideGagxaxdgtctgigtemggggaaagagccaecddc dgiagggccsglcagagigUegcagcasftiagcdggiaGcagcagaaacdggccaggdc GcaggGkctcattcsigatgcafcccccaggacGgdggiaicccagixaggncagtggutgtg gatdgggacagaatfcacfcfcaccateaacagcctgcagidgaagatnigGagiitahsdgiG agcaglataatiadggackxgaicacdicggGcaagggacacgaclggagaUaaa |
3»M. | 188 | gacalcgsgalgacGGagtdcxgaGtGVdggclgfgtGtefgggcgagagggecaeGdcaa cigcaaglccagccagagtahliagacagctccaacaatgaiaadadtagdigglaccagca g3aaxagg8cagcdcda88d.qdcah.fadgggcaidaxcggga»ia>ggggtecd.g accgattcagiggGagcgggfcigggacagafttcaclctcacc^RiagGasjCdgcaggdgaa gafglggcagtifatiadqicagcaala^algalackca^cacUfcggccctgggaecaaagtg gaislcaaa |
1E71 VL | 186 | cagidglgUgacgcagcGgccdcaghiidgagigGCGcaggacagaaggicaGcstctcdg dctggaagcagatacaartadgggaafaaliatgfetcdggtaixagcagcteCEaggaaeag cccccaaadcGlGaUlalgacaaiaafeagGgaccdeagggattGCtgaccgattGldggctc xagidggcacglcagcdtGqdgggqaiqaxggadqGggadgggigacgaggccgalfat tadgcggaaGatggga^gGcgGdgagtgdgiggitttGggcggagggaceaagdgaGcgt cda |
4BVt. | 18? | cagidgighgacgeagccgccdcagigictgcggcoaGaggacagsqggfGaccaidcctg dclggaagcagetecaacat'igggaataaHatgdtcetggtafvagGagdfxraggaacag cvcccaaadcdcathatgaGaafacVaag'SgacccfG'igggaSteclgsecgaHddggd.c caagtdggcacglGaaccaccdgggcaicaccggadccaqactggggacgaggccgatiat tacigcggaac^ggafaggGggctgagidgiggmicggrggagggaccaagdgaccgf acta |
904 V: | 188 | GagiGgtgUgaegcagGegceGtGagigtGtgGggfAXGaggaGagaaggdacGaiGcdg cccGaaaGt<xk;atttaigacaat83taagcgaccctGagggahcGlgaccgaHciciggGtcc aagtdggcacgfcagccacGdggt^caieaecggadsGagaGtggggacgaggjcc^aliatt: <WgsggaaGatggg8t8gxgcd.gagtgQgfggtfflGggGggagggaccaagdgaxg?e da |
j H)
2016244220 11 Oct 2016
I2G8 V.
cagtetgtgkgacgcagccgeccfcagtgtetgGggGGGBaggaeagB igglGaccatetCG^ ctctggaagcagGtG^acattgggaaiasnatgtatxtggiaccagGagctxaggaacaa GCfXGaaBCiCGkAkpiktecaataakagi^aaxtcagggattGCtgacGgaSctelggGtG | caagidggcaGgfeagccacxtgggGatcaccggadccagaGtggggacgaggxgat^t) tactgcggaasrigggafegGcgcdgagtgctgtggMtcggcggBgggaGGaagdgaGcgt | sets ΐ
--:----:-:---:---——---:-t
GsgtetgtgttgacgeagscgsccIcastg^gGggcecGaggacagaaggtGaGcaiciectg j GtsfggasgGagGtGGBaGa^ggaafeatfe^taixiggtaixagGBgctcxaggBaGag | GccccaaacfccicalitalgacaataataagGgaeccicagggattGcigaccgattGtctggctc ' caagiclggcacgtcBgccaccctgggc^teaccggaciccggactggggacgaggccaatta ctgdgcggaacatgggatatGgg&GtgagtgUtgggtgtfcggGggagggacGaaaetgaccg tecta
Gagtc?gtgclgsctaagcGa(.<'?ckxagGgtctgggaccaccgggcagaggg?caccatdcttgt tciggaagci59itC€aatsieggaat>-iiaGtgigaadggGcca$)cagctcccsggaaeggc
CGcyggadcxTGatetstaGte»ata»stGSgcggecetsaggggigoGtgacGg,3t&tctggGtGC aagtetgt]eacetcagcctGcctggccateagtggactccggidga<)g3igaggciggtitisd gtgGpag-Bgcgggatgagag-xtgaatggtgtggtakcggcggagggaGxagcigBccgicd )1 D'M \A 11H9 V,
Gagfelgtgi'.i.gucfcagccaccckAgGgt-TgggacGGGcgggcagagagksccaicicitgt tdgggagcsgctccsacakggcagiasttatgtataciggtaccagGsgctcciaggagcggc
C{Xcaaada;k;ak,daggaariat<;^gcgga>akAggggta,dga{X.gi:tfcBtgg{:k:c
a.agtdggsa.cdcBgeGtcGctggc<mtcagtgggdccggtcc§aggatgaggctgattattsGt gtgcagcaigggatgacagcctgagigguggyigtLqgi^gagggaccaagctgaGcgtccl
cagtctgtgctgactGagccacxctcagGgtctgggacceagggcagagagteaeeWtctgt tefggaBgcagGtGGa8catGggGagtaattakgtataGtggtaceagcagctc©Gaggagt^gc cGccaaactcctcatGgtaiigagusatasgcggGCGtGaggggtCGdgaGcgatiGictggchx aagtctggGacdcagGdccciggccatcagtgggdGGggtccgaggafgaggGtgaftattBct gk]cagcaigggatgac;igxigagtggttgggtgttGgge§ga§ggacGaagdgaGGgteGt
B m
2016244220 11 Oct 2016
Reference | SEQ ID NO. | Hcdelc Add Sequence |
194 | ceg ictgtgciga· :U :agicet;ccicagcgicigggacax· ;gggeagagag icaccad·; ;ttgii dggaagcagdecaacafeggcsgfeattatgfetactggtaccageagciccaeggagcggc eccca33cksiC3tccKaygaslaalea9cgg>x«caggggiccGtga<.cgaUctciggdec aagfciggcaccfeagccfecd.gaccaicagtgggdacggicegaggafgaggdgactaita6 gigcagiialgggaiga^gcidgagtggtigggigUcggcggagggaecaagcigiJfbagtccI & | |
386¾ | iGdQgagcigaciGaggaccGgciglgtelg^gccttgggacagacagteaaga^Gatgec eaggagacagcQcageagttltiatgcaagdggtsccagcagaagccaggacaggccccIgi acikjtctlctaiggiaaaaacaaccggccQcagggatcccagaccgatlclciggciccagcfca ggaaaca{>3gctl.cc0gaccal.cactggggafcaggcgga3gaigaggcigacta6allgfaai tccGgggacsgcagtgfeaccafctggtacfcggcggagggaGcsagcigsccgiccfe .......... ...... : : : ' ' ........... | |
386 Vu | 196 | caggtgcagitggtgGsgiclggijgctgagglgaitgaagcckjgggcckagtgaaggiciccig caaggcUciggatoccttcaccggcladalaigcacfgggigcqacaggcccdggacaag ggcUgagtggatgggaiggafcaaccctasGagigglggcacaaactaigcacsgaagtiicag ggcagggicecceigaccagggacacgtccaioagcacagcdacatggagctgagcaggct gagafckiacgaaRggccgkyAUtQgtgcgagagalcaaatgagtakaUatgGttcgggga gitrif.ccccc6actakaeggialggacgfetggggccaagggaecacggtcaccgfetctagt |
WE4 VH | 197 | eaggtgcagctggtgcagictggggcfgaggtgaagaagcdggggcefeagtgaaggicicQ gGaaggcdctggatacaxUcaiKgactacfelatgiactgggtgcgacaggcGXlggscaa gggcttgagtggaigggatggatcagccdaatagtgglggcacaaactatgcccagaagfeca gggcagggtaiccaigaGcagggacacgicfetcAgeacirgccfecatggagcigagfeggcl gagaidgacgacacggcegigfehadgfgigagaggaggaiatagtggctaegcigggetds etca:actacDcgglatggacgtctggggcc8agggaa,acggk;accgtddagi |
32H8V;-· | 198 | .caggtgcagdggigcegtdggggcigagglgaagaagcGiggggcciGagigaaggidca gcaaggctfciggaiacacdicaccgaiiadadacadgggigcgacaggcccdggacaag ggt'dgaglggatgggalggaicaaccxka&agiggSggai&aaadatgcacagaagtOcag ggc^ggtcaccalgaccagggacacgiccatcagcacagcdscaiggagctg^c^gct gagaldgacgaca^gccgigttdactgigcgagaggaaggcagtggdgggcfegactad ggggCGsgggaaccciggicaccgicidagt |
I 12
2016244220 11 Oct 2016
Reference | SEQ ID NO. | ftadete Add Sequence |
33BSVh | 199 | gacatccagatgacxagictccalcctcxtglctgGaiciglaggagacagagilaccafiacUg ccgggcaegfcagggahagaaatgaittsggdggtafeagcagaaaccsgggaaagcccc taagGgCGtgatGlalgngGak,eagi.Ugeaaagtggggk;cGak:aagghcagGggGaglgga idgggacagaattcaGtctGacaatcagcagcdgcagxtgaagamtgcaacflatac^fct gcaglafaadacHacxgcfcaciUcggGggagggaccaaggfggagalcaag |
11013 W | 290 | gaggiaGagcfggfggagiQgggggaggcnggtaaagcetggggggfikO^gacycGlg ^gxlc^gaUcsQfteggtaacgcciggaigagdgggtxgxagggteeagggaagg ggdggagfgggSggd^taiiagaagea.aaaetgatggtgggacaacageslacaGfgegcG GgtgaeaggcatgaltGaxatolcaagagalgaMcaaaaaaGacgclgtatofgeaaafgaac agcdgaaaaecgaggacaci)gcogtgiaUi.Gi.gtacOTgatcggaecgggfatagd3ce gctggtctagi.taci8mactg-chf)ggl3fgg3cgicigg<3gGcaag§gaGcacggtea.ecgfef ctagt |
9F3 | 201 | gagglgcagQggi.ggagtelggggg8ggdtggtseagcGiggggggfccdfagagfe;Wtgf gcagGciciggafteactUcagtaacgcctggatgagcfgggtccgccaggctceagggaaggg gGtggegtgggttggGGgfalfeaaagcaaaacfgaiggigggacaaxgactaGadgdiccG gigaaaggcagahcaccafctcaagagaigaiieaaaaaacaegdgtetetgcsaatgaaiag cetgaasgecgaggsGacagGcgigtafeetgUwtGagaicggacogggletageatoage tggiciagRaGl3ciaciaciacggl3fggx3Ggfc?ggggcc88gggaccacggtGaccgtcl:cls gt |
1 IKS Vi, | 202 | gaggtacagGrggtgga^ctgggggaggafggiaaagcdggggggtcccifagacfcfcdgi gcagcddggaa^ctti^gtaacgixtgg^^g^W^ggci^^^gsS. gdggagtgggtiggcxianaaaagcaaaactgatggigggacaacagacfaegcigcaccc gfgaaaggxgi)UeaccaictGaa<)agatgafk:aaaaie)cacgc-gtak;igcaaatgaaca gcctgasaaxgsggacBcagxgyatetgtacGaGagatcggaccgggtaiagcsicag etggfctegta-AaGlaetactacggiafggacgiclggggGcaagggac-GacggtGac-Ggfcki agt |
13
2016244220 11 Oct 2016
Reference | SEQ 10 NO. | Hncfeie Add Sequence |
1H7 Vh | 203 | gagoMC'^^lggtggagdfgggggaggGffggtegngix.iggggggfccdtegaetetedgi gcagccfcfcgaftcacmcagfaacgxfggaigagcfgggfxgxaggciccagggaaggg gQggagfgggUggccgfadaaaagcacaacigalggtgggacaacagaciacgGlgcaccc gfgaaaggcagancaccatdcaagagatgaftcsaaaaacacgdgtatcfgGaaafgaacs gccigaaaaxgaggaca'GagixgiglatascigiaccacagatitggiiccggatavvgcatGag clggtctagfectaciadaGfaGggfatgga.cgtctggggecaagggaccecggteaGcgietct agt |
204 | gagglgcagGlggtggagtelgggggaggcatggtcaagcdggggggiccdgagactctedg IgcagGeidggataGaccbc^ ggcfgg3gtgggi.d.Gaiccaftagiagl8gt3gtagff8cagat3fiacgcngadGag!.gaaggg cGgattcaccatGtGOagagacaacgccaagaadcacigtaldgcaaatgggiagcdgaga gGcgaggacaeggGtgfgfaladgigcgagagaaggggtgtcfggca.gtcgGCgtetagcat cagdggfaegactacditacggtaiggacgtdggggccaagggaccacggtcaccgidcfa Mi, | |
?E7V;, | 205 | gaggtgcagctat^gogtGtgggggagggiggiacagxtggggagfccdgagaGtGtectgt g^gcetctgggticaccttegcagdaigccstgagdgggicc-gxgggctccagggaaggg gdggagigggtdcagctettsgiggiaglggtggfcgcacatectecgeagadecgtgaaggg GxggtlxecatcfceagagaGaattGcaa.gaaeaagetgfafeigcaaatgaaiagcctgagag i ccgaggacacggccgtatadadgigcgaaagateaaagggsggtsgggGcgfaiagcagig : gdggdcgadacdefecggiafggacgfciggggccaagggaecacggk<n{xgtddagf: : |
3CSVh 12E8 Vh SES Vh | .206 | xgglgGagdggiggagtdgggggaggcgiggkxsgcdgggaggxxlgagaddedg tgcagcctctggattcaGdfcagfsgdatggcatg-GadgggixgccaggdGcaggcaaggg gQggi>gfgggiggcagdalttc8digaiggaagic8lc)a8fa1atgGagadixgtgaagggc : cgateccatQxagi^gecatacGaagaa^cgdgtiitctgGaaafgaacagxtgagagG gaggaeacggdgtgdiitcig igcgagagagaggaaaeggg kacgafgteedlatehad adictadaGggiafggscgtdggggccaagggaccaGggoaGcgtettagt |
2016244220 11 Oct 2016
Reference | SEQ ID NO. | Nucleic Acid Sequence |
4E4V(, 9D4 V - 1611 Vh | 207 | »ggtgcagcfggtggaatetggggg^g^lggtogccfggg^gicccl.gagacicfccig tgcagcciciggatfcaxtlcagtagctttggcatgcaGigggiGcgGcaggctccaggcaaggg gclggagigggiggcagltalalcadigaiggaagtaUaagtaUclgwigaciccgtgaagggcc gattcaccafGfccagagacaaUcaaagaaGacgcigitl-dgcaaaigaacagcctgcgagcc gaggaca^gctglgtatiactglgcgagagi0cgg(;V;:aattai.4atgaiagiagtggitaiiatea cMcaastactaeggtaiggGcgiaggggc^agggaccaGggm^tctcfagt |
1283 Ve | 203 | caggtgcagctggfggaatctgggggaggcgigglccagcdgggaggtocclgagaeicicctg tgcagcciciggafeaGctiGagiagcftfggGaigc<inggg?ccgccaggcbcagg©aggg gciggagigggiggkagttalaicalfigaiggaagtadaagtactcigtagactccgfgaagggcc gattcaccaiciGcagagacaaircaaacaeGaci^GlgttiGlgcaaatgsacagccigcgagcc gaggaca^gctgigtatiactgigcgagagalcggctcaadaclafgahgtagtggdakaica cteCsaaaiacfacggtciggccgiclggggcGsagggaceacggtcaccgtelcfegt |
4H8W | » | gaggigcagcigglggaglclgggggaggcttgglaaagccagggcggtccclgagactcfcc! giacagcUciggadcacctttggtgadatgciatgagciggttccgccaggctccagggaagggg ctcgagkggefaggttfca®3geagcagagcflatggigggac<accagaaf8GgcGg?>gtCigfg saaggcagatteaccatctcaagagafgaifccaaaaccafcgccfaicigcaaaigaacagccl gsaaacGgaggacaeagccgigtefttctgigcfagaggacggggiatfgcegctcgilgggacl 3dggggcGagggai3C£Xfggicaecgictctagl |
32H? VH | 210 | caggfgi^gciggiggagtctgggggaggcgtggiaxga,tgggaggte(;cigagaclck,ctg fg^gegfGfggsffcacGUcagtagcbtggcaigcactgggrccgccaggciGcaggcaagg ggcfggagtgggVggcegliataiggtaigaiggaiigtaibaaaiacOigcagacIccgtgaagg gGcgattceicatciccagagiafeaaiGceagaacecgctgtaXigcaaatgaacagcctgaga gGcgaggacacggctgfgtaitactgtgf^agagcggggggt3tagcagcagctgga,xtacta cfactacggiaiggacgtctggggcxaagggaccacgglGaccgtctcisgt |
33E4 VH | 211' | caggigcagdec^gGagiggggcgcaggscxitgaagccitcggagacfxtgkxHGagcig cgcigfct<itggtgggtccttcggtggdactactggegGiggatci>gGcagc{XCG3ggga»aggg gctggijgtggattggggaaabaaicatagiggaggcaccaaghcaacccglccctcaagsgl egagtcfrGcaiaicagfagaGacgtccaaggaccagltctixcfgeagdgagctctgtgaecge cgcggaea^gefgtgfattfcigigcgagaggcgafgfagtaggmcmgaciatlggggccagg gaa(xctggfcao2gtefeMgt |
2016244220 11 Oct 2016 bitoe o shows the M Q 10 \ds of -, \eiapian wipicic a,'id sequences -.ίρόρρρ; compL’x heavs and light dnnn-g us wail heavy and light chain variable regions, co' exemplary isolated anbgeii~hh:>lh:g proteins, spedto ill\, hLGRP R landing proteins, disclosed hereto,
I abk 9 - Esemplan IK', LC , Yu »nd Vi tetdek Add Sequence Ul Mis
s | a 1 8 | a ? 1 1 8 | 8 a £& | § a S3 u. |
227 | 175 | 25$ | 226 | 244 ' |
13H2 | 175 | 254 | 239 | 267 |
4K6 i | 178 | 209 | 230 | 248 |
3C8 : | 179 | 286 | 228 | 246 i |
8F8 | ISO | 206 | 237 | 249 |
120 | 151 | 256 | 237 | 268. |
1E11 | 155 | 257 | 224 | 242 |
40 | 187 | 207 | 229 | 247 |
9D4 | 155 | 287 | 232 | 280 |
12G8 | 189 | 208 | 238 | 2S6 |
WE4 | 151 | 157 | 234 | 262 |
11D11 | 192 | 200 | 230 | 253 |
11H5 | 192 | 282 | 238 | 254 : |
1H7 | 193 | 72» | 228 | 240 |
9F3 | 194 | 251 | 233 | 261 |
385 | 155 | 156 | 227 | 246 |
32H7 | 182 | 210 | 240 | 258 |
lid
2016244220 11 Oct 2016
s | s 1 ί | a 1 i 1 § | I S lu | o 1ST eg a wt : : >' < IS |
32H7CS ; | ids | S3 o: | 241 | 258 |
32H8 | 185 | 108 | ||
33BS | 177 | 109 | ||
331::4 | 184 | Oil | ||
34E3 | ISO | 212 |
\m lew a, ι Is cm etime ,οη,η·: xtitieen bmtimg prox m- nr pontons sbereo'' teg , foH length antibody, heav\ <h tight chant vartabti dmmtm, or ( DR; 11, COEHti, t'DIG la, ( Dlxl 1, CDR I 2, o1 t'DRl 3) i?ti\ be isolate from li-eel's of o nee tbas have foeu -mmum/ea wtib .5 ( GRP R or unnunOgeiue components theseof, e.g , by unninno-ainj vstiti bsli-length C'GKP R «xomp tsra bo.n I »'i K and P \MR - w ,b me e'tts. bd » derm.n e’5 CRE R for psm.ng ev,m-. eltnUi domains of CR! R and RAMRi) wnl- whole eelk ·, xpiewme CGRE R, with membranes prepared foonx cells expressing CGRE E, with fu-aon preRms, eg, Fe fusions, -.ompoxfog CRd R, RAMP I to5 rstree-.dl-d a dommrn fo, reefs fused m id, <mti other methods
Id known in the art, for exarnole. as dexu’theb >n the Examples 1-3 hetem. The nnekie aetd may be isolated by eonventional procetiares such AS pelymetwe cham reaction .(..PCR). Phage dt-p av is another example of a known teeltnniuc whereby derivatives of antibodies and other ap'tgen binding proteins may be pteparsd. In one apps'oavb, polypeptides that are components ot m antigen hm-Ctm, ptotem et -moe-ti are express, ti m any ,unable w>omhmam espresoon system, anti she expressed poivpeptides are allowed io assemble to form antigen binding protent moktepifes, she niselete acids provided m tables am exempknv onlv. Due m the degenemev of for genetit ,ode each of she polypeptide sequence's tisted m T.-bk's ,?-ς or othefw’s-. depict ti nerem are .sti-o encoded by a large number ot omei nueiese atsd s^quesiees oesidt-s tho-e ptoxsded t hie o·'ottius.-ty si,ill m Pie ar wfo χρρη’κ’.ι,’ tbas the m went appl.„<nion fo’-s
2016244220 11 Oct 2016 wto . i \ ; x ό n u J s< i ( r to m x'kf x i iv x> i b fo cj x5i x i <, o tee w p m eneodmt. each antigs'u binding ptotem ^n aso>-ti tnfiher pave ifo’x nucleic feels dint hybndu'e fo elder nnet-ie .«'Kts u q .
nut len. aetds comp' w a a . fecm ,k x.qucuc b >R0 et 1 Role ' I ·. tk F I Role 0 mid ot SI Q
ID \O‘'2?+ under pameuku by bridi/ohon conditions Method-» for to, bridging mulea.
aci.S are vcb-hnnwis m the >to fo... $.» < uncut Pnitoeuk ns Mohauhn Qio’ogy, John fo th, y fo, Son-, \> {bfo'w (<? oSt V femed ecr-w, »» moxtef t*el\ stringent hyonei-at-itt condition uses a p-'eviistwig solution -..etinmimg % sodium chief nie odturn -/male (SRC's, thfe SQo, I 0 mM I D; Λ tpH :< Ok hsbt idlest ton butte* of about for’,» totinarnnkn o\ SFV, and a hybfes/afow: temper Uvn, of yx ί to5 tobet 'nntlaf' uy b-uh wiwst solutions, su>'b as our ei'tiirttnmg abma 50% lornvnntde wnh a h-hrids/utson tetnperamte ι-f 42'C'i, and washuse conditions effe'C, m 0 5\ SSi ', 0 1%» St)S Λ sfrmgent hybrtdieuman condition hybridizes 1st ps SSC it|S{, fobowcxl by one os niots washes m foi\ SSC, 0 2% S!)S at ffo’'C. f nnhe-mieac, oneo? ->ktti tn the ml can ma nip η lute th< hvbridiearlon and or washing eoudimms to 'n,;e,se ώ\',.ιν t% st irgistes h-bi'du turn cu- h ma; nnehne <η ids lowpt'smp nucleotide sequence1» mar are .it least p>%, /0%.
idemsc ti to each ofm r sy pwaily r mam hy-feds'/ed to eiwh owes
I he tois»», parameters .pVcetntg he ehotCs fo hMtffuf/atio’t condstiers mid mmkn„e to; -I oe·f'-g MUk'bk' lonxtoi-ws aw -,, i forth by, ref w,<n fee, Sanfeoel , I'ltscli, and \kiedw <2001. Moieeulai Viomrto Λ I abermot\ M»wu,fo ί old rtprutp ibubor Laboratory Press, (.'old
Fprsng H.irbor, fo,Y . vi/eu, and I urrent Protocols tn Molecular Biology, 1995 fousubel cr to., eds, hum Viiley fo Sous, we, -- i-vons 2 10 undo >-ffei, ano Ιχίη b lefely dfoesinsued fo those h<e, sue oFilmnr» skip m the .to Ivfe on, <,g , Ov length and w b»i-e rerup-'stuen os t|i,nnelmc acid.
Changes can he introduced by mutation into a Kuclek acid, thereby leading to changesIn the ammo acid yequePee of a polypeptide fog., an antibody or antibody derivative) that it encodes, Mutafions can be Introduced using any technique know».· in the art. In one >, mbodimx'rn, owe o5' mow particular momo fed residues aw elt.mged nfing. lor example, a stfe-direetcit ntutugene-is protocol bi .mother embodiment, one oi mure rnttdomly selected residues is eltnnged using, for cx-impR. a random mutagenesis protocol, However h is made, a mutant poly peptide can he expressed and screened foi a desued property
Munitions can be ntrrodne»;d isik» a nuekue acid with.mt signibea.utly altering r|i„i'n»l.»yaxU xictwitv ol ,t puiypepudx' ihxti n cncn les lor example, one i an m,dm aucuOi,.k' supstitulious leading to anwo acid sunstputions at non-essenmu ammo aonl rwnducs
II8
2016244220 11 Oct 2016
Aiteroafively, one (fi i«W mutations can be introduced into a niteleie wid. that: Selectively ehuny. s the h-ologfeal aettx ft\ ot a pod peptide that st encodes 1 ot example, ih*. niuudton can qisandfanxc!\ or qualitaitx My ehango the biological activity. examples of quantitative changes include frtercasme, redeem- ->r ehmmahtt^ thr actons I, samples of ,iu:mmtive ensnges include changing: the antigen specificity of an antibody. In one embodiment-, a nucleic acid -,.-t lotbifi? any antigen binding ntotem desesd'-eh Itenein .an be mutated to -diet the aimno aesd sequence Using molecular biology techniques that are wdl-established in die am
Xnodau usipest piiotdes nucleic acid molecules that are suitable lot u-e as runners ot hybttdmaqon probes rbr the detection of rtudete add sequences, Λ imdeic aetd nudeeule can co-uprise only a pomon of a nucleic acid sequence encoding a fall·length polyp-mude, rbr example,: a fragment: that can be used ae a probe or primer or a. fragment encoding an active portion -y e - a CGRP R binding pm don t of a pohpermde
Probes bused on the sequence of a nucleic aetd earn be used to detect the nucleic acid or similar true I etc acids, lor example, transcripts encoding a polypeptide.. The probe cart comprise a label.gtoup, e,.g., a ta-latisofope ,-. fl nor,?-, out < osnpound, an eu/\ me, ot .tn an?·, me ro-fi-c'ou Such probes can be used io idem-fi a cell that expresses the polypeptide xt'omet ispne, pmo, le> >ee om-or pnsun , t 'e .-< d cured ng .-polsm-p-td et .pettiest thereof *oy, a trngment eor-tasmrte on-, ot mote ι'ΠΚχοι one ot mom vat uhl/ reeioti .li’pfjii·; Γ samples of \,t ·>.> o< mde but <-tc no* honk'd \> pxisimds, \u<-i vectors. aon20 epi-oma: rnmmuaban v„',-'ts ,md expie^-aus scetom. fot example, tecombmant espres-Ou vectors 1 he te, omentum! espre.-sioo \ec-ors s' m emnprisv a uuclete <*,d in a form <- uif able fin exptessmn of tne nuei.ue aetd tn a host ecd 1 he omombmant e' pte-sion ret tom include sum or mom regulatory .sequences, selected, on the busts of Ute host -< dis to be used for expres-ion, which is operably linked to the nuclesc- aesd sequence to be expressed Rsgoiauuv svqtisiue-<
tnclnde those dud direct constitutive expression of a nucleotide sequence in many typ.'s of ho-t eePs u v, 3\ fit eatb gen - enbanre-, Rous non- -, ires m-mioier ami e;-tomep-,io\ srnpromoter), those flint dnetd expre-sion of the mieleoftde sequence only m cerium host v, its t, e ,'ixsun^pe.'”e ?i m-k-.o y seqnen.es ,Ve*\o /, - fifix Λ < n -./ΛΆη ’< ' i ? x~,
Menial--. ,/ o/, rib”. 51 rem , 2 fix 12 A, incorporated Iw -ckreur'c Iseieu'i tn the-; enoreix.”-}, and those that direct indue idle expression of a nucleotide sequence in response to particular ue-.tment ot condition 'o'y, the niexdlodnonu! paui-m.-i m m,unmake, -mils and the tutresponsive and oa smeptoi-n,-, in response e promoter tn both, prokaryotic ami eukaryom, ss d.'tux tsoi, /,/} It wdl he anpieeuted hv fisose -kibed u- Pm ,m mm the do-ivif of tbe s'\p<\'sMon v. c:-u can dep* ltd on such laemts as the enmec of the ho-it cell to be imm-lbtmed.
119
2016244220 11 Oct 2016 foe level of . xpo-ss:on of prob-ro doored, eft The , \po-ss:on vtxrors i an be mtro.bieed soto host cells to thereby pio.btr,- pt'ob-ms or peptides, including fusion, pifodns or peptides, often, tea by to.:· k.>. act J* ;o< describee h.-ivm
Xnother aspect provides host cells into whtdi ,t teeonPmtaul eeptcssiot- \ceto' hu* been p inrodtucd \ he*? -<e:l e,.n oe try proMiy-foe cod Dos e\amp\ ί <.>>/<) vr euk.ir ode cell <ibt e sample, yeast, insect, or roamm-foan cshs o g, CHO .eb-o) \e-, for O\,\ cat- Κ introduced roto prokaryotic or eukaryotic eeiks »w conventional transformation or transfect Ion tc, tempi's I'm stable transicchoa of osunniJian cells, tt s* known rout, Icpea-hup noon the expression vector and transfection technique used, only u «nndl traction of cells may integrate
H) the foreign DMA info their genome hi ordC’ to identify and select these integrants, a g-cti-c ibat et cooes a -.cketihL t-taforo fi o, to: icsxup.e u- aistibroo,. ο :-, get-etallv nfoodueed {--to tne host cells along with (he gene of roteiesf Pteieoed selectable mtrokera nn hub' Pros- which confer teatsiane>. to dtne*, stud! as <34; fe byi.-moyero and oh thotiexate. Ceils stably transfected veuh foe introduced nuefe!e mid ear- K tdendfied hv drug < -lection u g., ,χ-lis dial
1.5 have ineorpomted the seiecfohle marker g>.ne wdl survive, while the otliei cells dies, amoinj other methods.
Po-paring Of Antigen Burning Ptoleroa \r'it'hu;n-.m antth<feies that am pros ided can he. tor example, derived from ans anubody -prode. mg ammal, ou.h as roev«e fat, roblm, goaf donfo-y or iron-human pnma;.20 touch ,<s monkey G c , m ο,ηϊίοΜί.χ m tlx.-ns monkey) ot ,-,ρ„ y, .u. ensmpaii/cefe Mott-hnnaan ift’lbo-vhe* can b.- used, fe-r instance, in ->< ego-, cell erthure mad cell culture be*.-J appli-ufoons, oi >-,ns tnher appln-aisoi: w lice an nmnutie ra«pou-O to ihe ai-troo.b, does nol <roi nr ot ts trs’gn'ftc mb can be prev rated is not * cone .-nt, ot i« bro red in e.-tfotr c-thornrooms, the jtn'ibo.hes m q be piodu.ed Ov immur.i, nso anunals u*any meti'ro.is known nt foe at',. -„s dose;food abov t and ot tn bxantples i ) below Ills' esanipm-, efesuibe the generation o; .out; t GRP l< embodies using thtee dilfeiem mtmnnogen preparations - os whole cells expressing fulkk'ngih. v ersions of two mapu >.ompoitettl, of 1XIRP R IGVIPI mid VRLR. t ti i membrane extract·» boro siteh xdl\ and tin) soluble t ’GRP R obuunej by co- -xpressmg and psit ofeitg dse A-letnunai - siiueehulat croman-soO fit R ,-et.i X \\1P: 1 he .end'-foms m.e, he polyclonal. pvouoelonat ormro, be synthesized m frost cells by „wpr..->.\ing roenmbrouot DMA h nl :y human untihodies may be pn.pare,l as beset foed above by nnmeutenro transeroee animals «.or-tamutg human immautoglobului foes or by sek-vttng a phage d Apfes hbrery that ts sxinessroe a mperiouc of human mfobodies.
120
2016244220 11 Oct 2016
The nsoHiR'Io-irfi utit'boCK's (m \bte -. an be pmducvd b\ a variety x'f txvhuiqves, mnnoeimta embody mePtodcmge , g , m„ st-pyj ed son me „e',i hy bmbzuhen tevinisqnc of Kohler and MsBteifk 1975, Yuno ,?5p'riO5 Altemntw ely, other techniques ibr producing monoclonal antibodies can be employed, .for example, the viral or § oncogerue nee -> Forma non of B-lymphocytes, One stumble aturmri system for preparing ttsb-iriomns i‘~ th,- nnaita· ν,·,ι< m, wlw h is ',ety well es^bl-sbed pioeeti-ae humum 'abuts protocols and techniques for isolation of immunized splenoeytes fur fusion are known to the art and idus'OUoe apptoaehes u>„ ries, Jibed m the 1 >,aswpies helms Bor χηι li niuceriutes, B , elk from immunized mice are p,piealb, fu^d with a suitable nnusmtshucd fusion partner, such as a
H) un:H-:‘ - sm.eioma - ell line, if desired, rats ojufb>..r naomnals besides ears be immunized n^iyad of mice and B cells from such: animals can be fused with the murine myeloma cell line to form hyb'ldmmis Ahetnatsvmy, amyemm i ceil hue dote , sottre, other than mouse may be u-se.l hstsioj. psoeerinses !ό making k-oiidomas Jso are w ell known.
he aingk- ehum .embodies than are pros tded may he formed hy linking heavy and right
1.5 chain variable domain ;{Fu .region) fragments nm an amino acid bridge (short peptide linker), ’esiutmg m a smale poispepurie eri „n xim single e'1 tm 1 \s tseKs' may ee pr.,pa,eri w ItfMug DNA encoding a peptide linker between DMAs encoding hu.· two variable domain pefr peptJes * \\ and Yj. > 1 he wesutimg pels peptides xan fold Pack <m yh/msafres to ''oim ifrnpgen-bmdmg monomers, or they can form mtsbomeix κ g , doners, turners, or temnners).
depending on the length of a ilextbie linker hetw' an tbs' two '.auulue domum- IKortt et m, 1907, Frol £>x, 1U.122, Korn m,fr, 2001, /?bwd Aug, IbAe-lOxt. By combining different \ md Vti -eompusmg peg,peptides, one can fuiin swibimeise set's \ ritat fund to rislfrmut ,p.topes tk.sente am ,< m Did d-wmd 2 >w _X > 1 Rtf 1 vb te„<,' eeselnpee fos the proOij,tfsiriofsiui'b'ibam aimbodtes-neriul'· t: osedis’seifri, d m i. Pat \'o Ί,Ο-Ιο,Ήχ, tout,
antibodies dettv ad from antibodies psostried herein include., but arc not lumtcri ts- sei o comprising the variable domain cembmetsmia nt the heavy ansi bight eualn samsbb' wgtens depicted m '1 able ί,ο* cn’isbitsapons of hght and heasy chant satiable donum- winch include ( Idris deputed to I able- I Wand IB \nribo,kes pt<>\ tried he’xm that ,u- of one mbela-s can be changwl to ammoriics bom a different ,-nbei.os nsnm suhelas» wvitehmi. rnchnds ihtn, igi* t'tubedimmw h, derived {soman lg\l antibody, tbi example, urn'i i?,, ν\.ν>; Xu,h 1/,longue- a-Mw rise psvp nation m new un‘iho,'hes mw poxses- the antigen bmrimu pioprities»»{ a given antibody t the p<aem
2016244220 11 Oct 2016 johbodyi. hw also e\lnWt h-fooufcai properties exso<. iaix-d with .»» awfondy isop.pe or subclass ddkunt to n w-, 11 .he p-a„ antibody toexu tlvt. * i>\ \ ed Kji.srsa- tecn'O^ed i loned Π\Λ erixOibiig partieiriar antibody polypeptides may be -. t«pk>yed «η such pro-, exlures, c PY\ aucodmu me constant domain of an antibody cd the ik-nul isotvpc, < c. <. g, f antm ct ((> c 200.?, .Veto><A 5 A->>', ό\Ά' bM;?03-a to.
Aecoidinalv. tbv antibodies that ate pun hied include ihosc conspiisutg. for example, the variable domain combinations described, m/vn., having a desired Retype Gw example. IgA, IgGb IgCM. igGb lgG4. Igl , ano b’Dt as well as hub os Rah') uapm>, m*· tbewol Morose} d n le* >4 m be-ned. a mm < Iso b„ nexeon to ntredew; a non t mutation :< Ph< 1’ '4 PPt p > oi the bioge ο-ονι» a\ ,tcsx ? tbcd m Elnom < ?»/, 1' Zfoa > S', gy-a t o 40~% sueorposatcd bx rcki.m-„c hereto to aik-viaic a tendency- to term lutrud! eham ehsuifuL bonds that, can lead tx> heterogeneity m the lgG4 antd-odlc^ .Morxovxi, techniques for deny mg antihedixs liaxmu xliffeicni. properties v < , \<nv ng affitrito for thx' antigen io which they bind) ;η\ also known One such tx\nmque, rekrivd m
1.5 us c «am .shutYling, invokes display isig mmiuuoclobishu vuiabn domain gem- tepeinums on the vurlaee oi fiI snvufous toiermphage, often referred to as phage display € bain shuffling has been Used to prepare high d finny mobed'es to foe tinmen ?wbe«yiovd?oi->o«e, as described by Marks c/ mA 1 dbd, <%A,A< to-ano· Ip '?o
Censer- aux -’ mnditl- noons one, be made to the heavy md light t bam xat Iahle regions described in 1 able e, or the ( PIG described ut tables 4 \ and 4B land corresponding mod ill eat tons to the encoding nuef.de xesdst to pr-Muex' a CGRP P binding protem having certain devtt -.hie functional and, biochetmcid dunaeseiisties Methods for aehmx usg such modifications are described -foo-e
CORP antigen bm.hiug proteins may be further modified ui '«arsons ways. fo> example-,
11 they arc- to be used for therapeutic purposes, they may be eonjugaten wdh polyethylene gly col i pegy 1 atx’d s to ps olong the- sci in « half- It Ie or to -,. tm<m-.. e protx-i n xlelix cry Λ Itx'mat ix et > the \ ixuixm of the subject antibodies m n.gemcm.s thcicof may 1·.- to-d -x ith the I -. ternon of a dd ferent antibody molecule The Fc region used lor this purpose may be modified so font If dor's not bind complement, dins reducing the likelihood of inducing cell tons m the patient ed o u.,'. ri'e ft.-leu pt >w. a-'> Used a·-a t'e ι ape n (<. igent in iddition. the subject nmbod',.-o' inni.fiona! ftagtnents thereof max be - unjumUed wu.lt human semm albumin to enhance the serum halt drib of the antibody m enug.-n binding fragment thereof. Another useful fusion p'zii Win for ihe .intn’tw binding ptotxm·. or fiaernenis thereof is truustbytetin (Ί 1 R i. Γ'1'R has
2016244220 11 Oct 2016 foe capacity to t'otot s tcPum- r, thus an antlbo ,iy - Π P Riston ponem e.m toon >·, w.btsxuk'W 'atttilxtdy.: which, may increase its binding avidity,
Aitcoumv eiy< wtoCinriai modtfiem'ions tn the iuneuonai ,wd orb:o, heoucel characteristics td the antigen binding prcteuts described herein «tsv be achieved by creating .-eubsfituuons in the ammo acid sequence of foe heavy and built chains tout differ significantly a. then etieet as a atm nt-.iso (a) tor spaetute of the mole-, nlat h;-,< Lbone tn da mcaot da substitution for cvimpk. w- a sheet or heiicai confirm nson, to) th., eh. ree or lgdronhobwhy of due tnolecuie al da: target site, o· u. t th>„ bulkmess of ihe side chain \ conservative amnio acid snbstimtion ' may mvoive a subetiturtmt of a nati ve armno acid ryatdnc with g nounstive ” -stone Ι'ηη ha,\ bni,> ,>r no , tte t on toe polatity or, barge ot the ammo at, id u1 due at that position S.v, Ί alto' 4, sn/'-,< I uttnerotore, any native residue in the poly peptide may also be soi'shing'd o «th al.in.ue, <0- has bee·'1 prev io,isiy dcsenb, d for nl.mme ,se mnoip mat igeneos
Ammo at.id satotrnmons (ok, foci ionisersattvot lon-eo.o.xetv aloes ol the mbieto antibodies can be Implemented bv those «ktlied in toe an bv apply mg routine techniques
Am mo acid substitutions, can. be used to identify important residues of the antibodies pro vided herein, or to increase or tto-;i\as>, die affinity of these urttihodles tor human CORP R or for modifying the binding affinity ot other -mtigen-binding proteins described herein.
' pmssx'i syxfotos and - onsiineP- m the torn oi piaoiiuk, exp csmou \i\tots, trattsei iption or expression cassettes that eotnprts. at least one pnlvnueieeiide as described above are also provided herein, as well host cell· eompristr^siieh expression systems or constructs.
fhe antigen binding proteins provided herein nt.:\ be prepared by any of 5 number of -..onvc'tooiud teehmques t\.i example, CGRP I', anisgeu binding proiem*-- tie* to' prodaa<'.5 is >ecotnbtnant expression vounot, using ,my technique known m the .nt c g,. Motsoeioual Xulfoobtes, I lylxtolcmws \ \ov> Dveeio-ioo w Fholoyu al \n.ily ws Rennet et f b -Is ; Pkuuiu Fh„w, \ew \ot, il'foOi mid vntmod.es \; abo» cot·, Mama, P. Row and I uo„ tnd,> t Cole Spring U.nboi I atov ttopy P«'e>\, Co· I Spring 1 latoot, \ V *
Antkcn binding proteins ean he expicxsed iu hybridoma cell nne- ο .g., m parikniar antibodies may he expressed tn hybridomas) or hi ceil lines other them hybridomas E spressmn eot.xtnu to encoding the ambodv'· e w be used to tmnsfoon a ttiantmah -at, msec? ot mn'rob'Cl inist ceil. transformation mm be performed using any known method for introducing p-eynuehoiides mto a host info nn-inding, on evan-pl · packanun- the j'ttoi.m teotats. m a sons 'or buctcnophuge and tn-msduemg a host cell with. the construct by tranJection procedures
2016244220 11 Oct 2016 known tn tl·? nW a*, eremphtrob hy 1 mn d Sretes Pat re No 4,v»0,3 1 o, No 4,>'>| 2040,
No 4,N0,lh,, No 4 Ihe opt teal tt'tnsQruekon pmo *h?e . mJ w,b ,Lp„:td enoit w hit h ty pe of host ceO re- berog mnistottned Methods fot nmp.inetion of helot morons polynucleotide,·* into nturnmahan ceils arc o cP : ι«.Άη nt the art and include, but are no) limited e to. dm dan mediated fr.m-dection. wdcinro phospk.de pre·. spiinhom polybreue mediated iriitnocGtom prute-pitree tusiotn cleeinnomaijotf, encapsulation ol the poixuneieondets} it; liposomes, mixing wefete add wbh positively-cfearged lipids,. and direct rotcromisedon of the DNA into nueiei.
Reeofnhnnnti expression eonstrtn.t- ts pteul!> somprtse a nuelen. acre! molecule encoding a polypeptide comprising one <r mom of inc tollow trig· rue or more CDRs pros hied herein, a Opp.: cwtm constant re mou, a light chant reroutt'k tegton. a lc aw eh.un eotjstaut tep.ton <c g , C I i ; rod rore ;dt; and os anethm scaftohl portion of n CGRP R antigen Otndtmj pfoietn. These nnelcte ae-d v iptoi» e*< use ure, Bed neo -ui apprrepreafe expression vector using standard kgauon techniques. In,one embodiment, the heavy or light chain constant region is appended to the < -tettntn-as of the anuA GRP re-spedOr ttenxx ot hen? cheat: s triable region and «> hatred into an expression veenu, fhe sector :,·* typically selected to be iau: bond tn die pa^teniar hoct evil etnpiored (,* t , th. >ech>r ts compatible w oh th,· ho*»t eel: rnaeitmctv, permitting empid'reanon and or expression of the gene can occur' In some etnVodnoe us ret to.s me urea fmn employ mOt/iirefiagtncm rotopk'ni.'tOauou assays using ptoteui tepo tex,-*neh asCahvdrt'iolate imluctase in , lot exaroole I x Pat No redAVkA, w hfeh ns hcrCro incorporated bv refeicnc j Suitable ckpres-wren '* cetmx v,m be purehased tor example, from lu\,uoeeti t ife Ί eciroeiog.es o? BD Btos,rienc>..s iknmuly 'Vinnteeht Dittei ttsokii sectors lor cloning and expressing the annhodiei and fragment*, in Jade there described it: Burnetii and McGrew 200 >, fhmkvh /kto h<u>; h.reereg M.-P’ rea-4, x>* hteh is hetero* rocorporotcd hs rekrerree. Additional snttahh, esptesstott \ reims .ere discussed, for example, tn Vet.ksA Ff,’r«nJ ,\oi IxfiD V Gnedriek-.-b) 1990, New 5 orro -V<nk-tm< Rows
I spieulk. esptes'ion x cetots treed tn am* ol tin. how cell· wilt content reqnencs lot plasmid mnmienanee and tor clotnng .rod expression <u csog>- nous nucleotide sequence*· Sneh sequences. eolk *tixGy* scscocd to a·* flunking seq nene... >*' in cedain embodiments v-h typically include one or mure of dm following nucleotide sequences' a promoter, one or more enhancer scqueixes. uitoiiuiri ot replication, a traureripitoual ietmmaiton sequence, a eompreie iniron sequence eontammg a doner .rod ,receptor *-phce she. t requeue- encoding a reader seuuenee ibi polypeptsds' v * eetnro, .* ribosome hutdmg xU*, a pmy -,denylafion xcqncmx, a
2016244220 11 Oct 2016 poo 1ml ci re gum io· inverting fne -mJ -\ at td encedtnc the poly pepu.le ie be exptevO.I, nn.t a sekv.abk m cxet elemcm beer· oi theso -aqucuees is d'seuss^J below
Optionally, ibe yeetor mas contain a ''ia;?.*eneod;ng sequence..- j an snk;onne!eoiide molecnL located at the ?' 05- 5' end of ihe C’GRR R iundnig pu.«tein votimg sequence, Ibe o! ken ue ieedde sequence encodes poly Hi-> t such ns hexaH is), or another “tag' such us FT AG ', HA (1 temagiutinin tibkieiixa suns}, or ntye, for which eonimcrcntily uxaiiubie ntifthodlex exist 1 his lug is typsc die in-vd to the poiypepode upon expression ef bi,.- polypeptide, and cm sOxe as i me -ais soe aHhniv pui-dfeation ei Octet non id ibe t GRP R binding p'Oien· hem th<, host cell, Affinity purification can be accomplished, for example, by column chromatography using iq ar'ibodn's i>« ,mu the tag a* eu.db'uiy mauiy. Opno-xfiy, Be tag e.,n sitl'sequemA be removed from the purified CORP R binding psotem bv various n.« .ms each as using ecrum pcpiiduxes For -cleavage.·
Flanking sequences niu\ be hoinologous R < , ttom ibe sai':-,. species and m emm a- ibe Ii· «si cellg heterologous < ·„ , Aeso a species ome* than dm- ho«t cd· species or straw, hybrid «?..·., a combination of iiaukmg sequences bom more than one souixe), \vnthetie oi native. As suGix the sonme -.e a 0.0-0 nye -emu-ixe mas be any prokaryotic or eukerveib. ot taoism, any yertbhtare or myertelmtie organism, or any plain, pro', ided that the hanking sequence hr functional m. and can be activated P> th. bo-4 ceil .machinery, flanking seqn·. nces us·, fid ,n the xei tors may be obtuned by ,·.· q. of -wera! methods ο eh know n m the art, I \ pmal i\, thuH.mg sequences useful het cm 0 ill bay c been pres sous?, identified le. mapping and 01 bv restriction endonnUe.ise digestion .md can thus be isolated from the ntepet θ’-su - some c using the app’opriat, scsiomhen endonu, leases In some euses, the b.dl nucleotide sequence of a hanking sequence may be knoyyn, lien,-, the hanking seeeerec ;rc,y t>i s.i hi, mwe tstng t . nGlmns ieseroed nme·-! Rv am. leu . ds.rli.e>
or dotting,
A hohsoi ah -,ti one, .5 portion et'-he hanking xe pienc·,- .\ known, 0 m.e, Ve obtained u-un-. peomecasc- chum reuuton (PGR ? and or by -eixm-umg ·.·, gcnoime hbrmv w-.th a suitable piobe 'fieli as an obgomn k'oitd;· anO os slant,me scq'at nt e fri.>niem *rom fne .same or motm-i sneeit, 'd’lietc the 'among s· tin t >,,- is {«{<ΐ so-owr. a bus meut r«f I *\ λ louta asm a haislong eh sequence may be i^.lated from a huger piece of DR \ that may <ont nn, lor example, a ceding scqiiviu e sir ever! mom·. r gene 01 cc-nes Isolation ma·. be accomplished )-', sestnetiou endonuclease digestion to produce the pi'ope? DNA fmumcm followed b> tsvlanon unntg uguiosc cel p'ifdii aiso-i, Qiao.cn' tehn-m chrom a'esy ap>by A h dWoiih. C \h or oibei methods
2016244220 11 Oct 2016 knoon to the shitted astmrot. The selection of suitable en?y mes to accomplish ibis purpose roil!
be readily apparent to one of ordinary skill in the art.
4ϊι origin of replication ro ty pieully part of those prokaryotic expression sectors purchased eornnterctaliv, amt the origin aids in die ampbfieaiion of the vector in a host cell If the vector of choice docs not contain an origin of replication site, one may be chemically sy uthesired bawd on a Lttoro n s \pi,-n, e, and ligated into the sector, rot example, the origan of ’'epbroiiOon fioro tbs' pktsrntd pBl<522 i\e\x I ngUnd Bwlubn, BeseHx, MX) is smtabie for mu-a gtatu-nee Oise bat tcroa, <aut \,u ,mm ·> if J otigms w g „ S\ ep, pnhoma, adc'uex ntm, vesicular teem. tuns \ nns S\ k or pamllomsx traces such as 1 U-M or BP v t oe usehu fo;
Ift > Minng seete>i ·> ro ro eromdsan eeUs 1 hmortdly, Ute ottgm to rep'teatton component ,s not he: ded for maroroulnro expression \ „etors < to; example, tne S\ Ml origin is often used only bee „me d also eo’drorro Me s 'rots ><n m p-ot o\ ;
\ u unset ipoon iron η tun ton ’eqnene',. ts typically located 3' to the end of a poly peptide coditm region and serve·, to terminate tnmxenptivn. ϊmualiy, a tt inscription tevntluatton seemenec tn prokaryotic edis w a <»-(' neb ImgroetU tohoroed by a potyd xetpiutee, Wink' the seqttenee is e-mtly cloned from a library or even purchased eonnncreialiy ;,.·> part of a vector, it e.ei «Be he leadtb, -y ndteu/, d ,οη < ΐ 'ed ods tot roa, 'e'C ,-e d -y 'thesm am h as Moro described herein.
\ select ede ipaiker gene encodes a ptotenn m-t ess my. k„ tbs' sin s mat and groroxth of ,·, liost cell grow u nt a seleerme culture medium I y pteal selection marker genes encode protenw thm y B confer mstsi wee to .intthtotte'- or other tovaro, s. v , arop'edlm, tern. el mo et kanarnyehi tor prokaryodo host ceils; (h) ,eompioment auxotrophic deficiencies of the ceil; or ed supply critical nutrients not available from complex or denned med,a Npcedte v„ leetable markets ere the krovnuystn rcs-stance gene, tin ampnuiro tesmianec gene, and the tetraeycime
2a .esmtanc*. gene MixatUsgeoa-dx, a ,corns cm tesmkaue gene max ,th\o ne troed let s/L\dots in bob, prokaryotic and eukaryote he<u cells i hher selectable genes max be used to amphtx the gene that ro til be expressed. Wnpbfkation m the process xv bet eh, genes hi.,* rox- teromed ho production of a protect wtiicai tbi crom'.rh tu >. el- suiso,d me reOciated tn tandem rothuu the ehtotuosonis's td\ue-.. essme ed geuewpom, of reeort'bro.ipt eebs bx troph- of suit tide scleewbte rn t'-kero for m.> turn slum eelm. include dug, drobdate icdnUase iPtil'R I mid pom,rootles-· tb ,uu,bne kmase genes M'nroroahkro, cell trntisformattfe w· placed under eelesfen pressure whereto only The transforrnanLs are uniquely adapted to sou, roe t'x virtue of the seleet-tble gene present >n the sector, Selection pres,roe ts imposed l>x cutrnruig the transformed ceils undet conditions tn
126
2016244220 11 Oct 2016 which the - oiiccnii.im.iii of sclechon -igoin in the medium c< sue- cssreely tnere’ared, there hi leading to die amplification of both the selectable gene and the DV\ that encodes another gene, su-..k ..is mi .tnhgcn binding p-wen· dim emds to Ct m.P is As , resreh mere ire.I qured ere ot red jregt ires .reancedgeG m rn i etc n .reoitk'M.o *ϋ wire amplin>,d l).\ ihresoif'c-hwhiig ‘-'fc i* usually receswuy fot hansutton nub -,non ot n-i\\A and is eii.trivtoozed 5w ,, rehtnc Ihdgarno remureree tpnn, snotest ore, ko^ak sequence teuharvotes} he element is tipi.aby located ' totb>, ptowotes end to the coding scqtictfi'e of the poll peptide to he expressed,
1(3 b· some cares such .is wre re gh cosy bn.en ss cesce ί 'η i e-ik.cyoti· he‘t eril expression system, one may manipulate the various pre- o- pit .-sequences to tnipi-we akeosi b ϊ.οπ or y teld t o? -wimple, one may J ter the p -Widuse > ie is.tec site ot a p ehenkr signet peptide, ot ;ukt pros.-queuies, which also ntci affect glvcosy tanon The thud piorem product w tv hr ve. m to, < position u, i mvc ό the firm rmise acid of the nt ton.» proreu'A one
1.5 or .more..additional amino acids trtetdedt to expression., which rnay not. have been totally removed for esempte, the final protein product may have one or two amino acid residues ton:id i-'i the peptidase eh as aye Mie a-Ua, n.-d to the annno-tcrmmu-·. Aifetnain ely, use ot some enzyme ei/avage -'itex may s remit nt a sirehtli truncated wren o-l the dv-ned polvpeptidc. If the crewmc , ms ,ιΐ such un-a wuhui the mature poh’pcpnde
I repression .end riorum, w id typtcaltv- contain a promoter that is ieepeni.red bv the host oreamsrn anti operabtv hr; cd to the molecule encoding u ('GRP R binding protein, Promoters ate taurauseribed scquiinccs located upstieuin (g ;, 4’) fo the start codon oka st· sictniat gene ig.-ucmds wnhin uhom 100 to sOdv bp) that maskol non sen poor of die structural eene. Promote!s >·,κ com .-mmn.dly ^youped mto one ofreo ehis-ie-·, inducible promoters nod enitstittitive poimioiere. Inducible promoters minute increased Gi ris of trainer'piton bom
D\'A tind-.r their control in rewpoure to rente thangc in culture conditions sti>. r as the present's ot .erereec o''.-, n.uoem re a sh. ;se,. ct tenmei sti re ( ot euutsve pjornoters or the otn,-. hand, umforeidy trnnsi rtbe a gene to which they arc operably linked, di.n is, w n'h utile or no coiurta user gcuc .„\rscss!oif. Λ hues' number of promoters, recognized by a variety of potential host cells, .are we 13 known,. A so j tah 3 s promoter is operably baked to the DNA encoding hem, y ehaiti ot nwu eh un composing ,-. CGRR R b-ndmu pmucm bv re moi mg the ptemuh - km t the source DNA. by roirictiois enzyme digestion sod inserting the desired promoter sequence into bieveetop
127
2016244220 11 Oct 2016
Suitable pmnioters fon UM’ w tin ye -,st bort» ate .-.ho web known m the art Yeast enhane/m are adv uuta'?e<>nsi\ nsfo wsth yeo-t piomolets. Sbfoahk ptoteotets ibt w uh mannt'al· ,n ho-a eelR me w-Ί: known end m, tisde, bm are net hunted ',·«, those cbt need uont the eeutetti t of » ifuses -meh as polyoma virus, fowdpox v u«s ade.no» >ηιχ t -melt a* foemw ttus 2 ·, oo\ me papilloma v urns, ,»o tan s ηνοοία \ uus, cvlotue^alov ires, rmrov irttse» hep units· R V) ts a ni S' e at \ nt.s 4ti t,\\ 44) O',he Mnfobie t \»'tr ah/t ρ»ηρ met - we'de h. ,e o'og»ti's mumroalfon promoters, for example, heetettoek promoters and foe actin promoter,
'.foitiMnal ptoouc.s wtituit tn e, be o« utiesesl tn. hide, btH ate tun fowled tit sY-fo eaifo pu-mutiti «Beno-st aid t 'hambott, I05» i Mn'm-e 200.304-310); ('MV promoter BI itorttsert c/fo , i'fo-k B'o\ fob !;<,’<>' t' 3 1 x I -'·54~00? p «he promoter contained in the 3: long (etwinal tepe.0 ot fonts samoma v ens lYanumi-to ¢.' at, Bfob. < ; B 22 ?8?-~4Ή, hetpr* dt» ntlfotie ktnase pumtoi·. r BA apnet < r ufo 1431, rrm . \'nd. Acad. Se( (22 4 ?S. 144424-15). ptmttotet and tegitkituiy ’•eqaeae· •-Own the nti'Ufotihmnme nene Hfonsiet t’fok, jeo ·,») tfo ,d pw's, yene ?n me' * v,eh ,o me oca r ertmis: prorntye*· « Vila k- mamtl w fok, 1978» Fwr. 'for/. .-f.i.'iiB. foe. (25.3. 75:3727-37 U t, or (hofeic promoter.(DeBoer or<fo,, 1933, Woe, iforr. .·!<m2 .See (2524. 30;? I h > Also oi interest are foe follow inc animal mans, .'tpuuntii ennni leg-ms, which e'foot', its».t ’ sp a ilktR md for» e foee ntd'/e-l tn ttansuame nmmaB the rhstase 1 »aene control fewoit that is attise m paeetetite aeuwr cdis iSwift i r <B , 1934. i't/( fo fdo-n4»'., Οπηΐ/.’(,»'. Rfofo (fofokwwy /fo.-ow Atm/?, (foerr?' fo'·'··; fo) >99-400, MacDonald, fod,/kp'Bfotg, 2 425-5 fob foe msiuiti u-t>e eon-iel tccn-tt iltat a* :»eii\c nt ρ an.ream beta ceils (Hanahtn. Bfo5, fo?wv AS I fo 1221. the ininainoglohafot i.eue eunttoi tepton foal t,\ aetr» e tn. lymphoid ·. ells < Gross, bed! i i ok. 1034, i 1-.2 fo <''('('?>. .Adames er;i'/, ptity fo?«y3 2, ?3fo Mexander crfo, G!>fo kt 2 (<2 fo < ~ 14 >»,-1444), foe r.ottse maner'its *utuot »ii us emilioi ι,·»>;οη tinn'is a. liv· at lesbeniut, breast Bmphotti and mast eclB t kedet«? t> ! ‘fob, i SV 45 fo?-44s L utc athamni gette control region fo<n o active w 11· m iP'nke- >1 a’, bfor, B,.-^ » »>·</ Z>, «2 i ?os-'7e), the tlpfoi-fotopretetn esiis eo.nttol region that I* set;',., m he et iKruntlaut»/ <,n’,. *035, Vm. Ccd fook 5 BfoBiidS; Hammer w .oh S03ti eew/s 253:53-5^e foe alpha ;-swtfospsm gene i\un';\4 reform that is e.etase in live? (Kelsey cGa/., I0*?, o, et >, d ;.(,</ j.26B;~l t. foe bain-foubhi acne i.cttito. s n.ion t. u is ,<.,o<e n r.e, Je d - 21s {Moew.e u fo hhti fomn Ji? 3/4 t {«!, Koliias e( cd, (05(2 ( e(/4b'30-04). the tnyebn baste piotem gens' eompoi leeion that ss uetive in ohuedenfooeyii. edis in (he fomn {Keadheau <7»Β, 1037, Cell Jv 2'h 12), the npoxsin light dwri~2 germeonttol meiort that h ecdve.foskeletal mnsfos (Sant, 1985, ifouwe 31.4::283-28b);
128
2016244220 11 Oct 2016 anti the ί;(.ιΐΐ·υloin!p;-. ;eh-asim; hormone gene ,ηηΐίο! region Y ·,ΐ is unto e tn the hy'potiiakm»s (Meson nt <e . 1ΎΡ, St'<<??< ς 234 1372-137M \n enh tne-.-i -- q·:· w e nu\ he m-erted ntio the vector to on rease tenisei mtem of DNA encoding light chum -m hemv chain comp) istug a human ( GRP R t-m-dme ptolcsn Iv t te'. u euhnrwto, Enhancers arc e<->-aeiioe elements ot ONA, u«u.Yv ebon* 3 0-500 bn tn length, that act on the psomoter to -tn.tef.se iumxeriptton buhtneerx ate iJatfv.'k os -eutatioo tmrl poxition independent, h.e, n\e been found ,>t positions noth 5' anti 3' to the irunteriptiog uml Werai enhance· xvipteiRe-t available from mammalian genes an. known ivy,. glohm. ehoauw. albumin, alphaYto-protein anti insulin). I ypteulty, however, an enhancer Rom a \ iris,-- w uxcd.
H) Thf’W 4(t >':iu?i-the - ytemegn'io-nts .’any promoter etih.-n,ex Ye po-yo-na . twain <--wl aticaovhvts enhancers known in the art are exemplary·' enhancing element's &r Ye activation of. enkas voti-e promoters White ,ut etihamer may he positioned m the v-..etor either 5' or *' io a coding sequence, n is o pn ahy located at a vie 5' I tom Y·, ptomoler Λ sequence ene-dutg an apotopri.de name or heieto-o^ous signal sequene/ (l/atier sequence or stemn peptide) can he
IX ituorpomL'd ndo an e\pw *-stou veteer, te promote mhac<. tint a xcrtetion ot the ηηί»'<Μχ, Imchoice of signal peptide or leader depends on the type of host cells in which the antibody·' is to he produced, end a hcterologtitie Ntgrsti sequence cab replace Ye native aigntil sequence, .I.Aampks of .xnmal peptides that ate rtn.a.t.tonal m nvmun^iian host eJls mdnuc tit/ lotiovtne die sigii.il -vguetee tin (rifetk’ttkut- iii -} tie-· rti-ed ni I \ Patent No 4,Ύ5.195; the signal sequence fot interRur m-2 tce«, ptot desetthed m t ovums et id I’Yu, 312 76s. the inte-tieekm 1 receptor signal p<.piide tie--cribed m l· R Patent No 03o ' ?oo, fh/ type I tntei leulnn-1 «eceptet smutti peptide tl>. sei 4><\i m f S Patent No 4,Y>s,Y#~, the rt ρι· 11 imeY/iikm 1 receptor signal peptiti<, tiesteihed in b'P Patent No 4 R>4 s 16 i'lse ispiessmu xecti'is tinti .no pwwtded nno- he .οη-ηο·. ted tsom a siadme xeettc such as u eouviu/re tally avntlabk ,eetot Sneh vectors mav ot may not eontatn all ofthe vle.sired ilatu.sng x--q»‘ in es Whete on- ot mow- of Hu- 11 inkmg sequen·. do-.- -’bed herein are not a heads psexent m te/ vector, thev m.w te ntdiviti-tativ nteawevi anti ligated etio the v .uos Methods u-;>.-ti lot obtaining e «> n of ih.- ti.oiknig seqnene·.-· ate well known to o^e shYeti tn the ait.
Aftev Ihe ' wot h ts bc/ti eonxltt^ted ai>d a nucleic tetti mnSwtic wteodinc huht ehanv, a lt',.avy chain, or a light cham a.nd a heiory chant comprising a CteRP R asnsgcis binding xequene.,- has been inserted into tite proper site ofthe vector, tin.- completed vevtor nmy be st'sesii-.l nun a svniabh· host o.-R tor asuphtie-Unni >md os ρΥνοορί-Ο.- ./sow-ston Ur' tens,io.rmation. of an expression vci/tor for an imtigen-bintirng protem Into .a selected host cell
129
2016244220 11 Oct 2016 may be aeeomphshed by well known methods including innisfeetion, inGetioig calcium ehospbux uo-p eumbmo·,. teui-upoxiUO''·, 5 oeon'Ueeuu,. bpoluu.<m, 1 >1, \i -dcoun meduned tramHe. tton. or ether s-mwn leelm-qu-es The method sele·. led w Hi In pun he a function of the type of host cell to he used. These methods and other suitable methods ere well e known to ibe skdkd arttM'U, .mJ ere ->er forth, for ex-tmpk. in \imtbrook oZ, ?R01. wyvv
Λ Host ieii, when enhutod nnUet upp-opriate cot uh {tori'., synthesizes an antigen binding protein that can subsequently be collected item ibe culture medium (if the host cell secretes it turn the medium) ot dsrei.dy from fit-., host. ceil pfodin.ing -t iif n. ts not secreted). The se.teu.ion. of an appropriate host ceil wili depend upon var.om rhetors, such as desired cvptx-stoo levels,
1(1 polypeptide modification* that are de.-as -.Η-ό5 o -- cs.-an for aetw-U «such ns glyc<'»\futon or phosphors knots5 and -4¾ of Inkling tme a btologiudllv ,5eto-.e mokvole
Miomnahan cell hues available as hosts for expression are well known,in the art and mebide, nut ,ne t m hunted lo, mtraortah, · d eel' iries available ftom the \m< tuna, 1 q\ Cuhew Coli -enosi i A1C( b including Hu not limiKd M Chine-e hamster mar. ti'HOt eelk,
1.5 1 IvLn veil·;, baby {sums'et kidney till Ik t eelk. monkey kidney eelk ikOSt. human hepahnd lidar card noma eelk u 7 , Hep G.B, ,md a number of othet .,31 hues. In certain enibodnnents, e,’i{ ime\ mm, be ael-s ted through determmun; w huh eeb ime\ hate high express-on levels ano aon-tnuuvdy prodtsee antigen binding proteins wtih CkRR K binding pi-nperfuw hs another embodiment a eel; inn- b--uu the Is ,eh uncage that dom uu- make us own entihods hut has a eapae-k to make and see ck a heteroGg mis a.ittbodv e-an b-, selected Wsi llkSmOT|£AuWGaadMStdiGdd 1 Ik (hpemk .Purposes \nhgen Gndsng ptotetns me usolnl lot dele. UimiR.RP Γ 11 olovieu! samples and identic, at ion of sells or u->mxs tiro product, C'GR.P R lor mstunee, the CGRR R. ami gen tm in e pioVtpv eu be nsec m dtaprosne assavs,. 7 , G ds ,e ..-s 0 s to .Lsc.t <u Io quantum
CGRP R expressed in a. tissue or eeil. Antigen binding proteins that specifically bind m CGRF R can alftO he used in treatment of disease.- related to CORP R m a patient in steed, the?cof in addition,, CGRP R antigen binding proteins cun he used to inhibit CGRF R from forming a complex with its ligand t GRP. thereby modulating the biological aitRily of CORP R in a cell 05 ovate iAempLs of eet-Gim*·' that can be modulated include, but ate tint limited to, inhibiting vasodiabeion and or decrease neurogenic inflammation. Antigen binding proteins that bind to CGRP R tints can modulate and o- block mtetaetion a it b ot he. binding compounds and as such may have therapeutic use in, amulioratiugdiseasea related io CORP R,
130
2016244220 11 Oct 2016 indfoationdi-ea--e oi c-mdfoon as'-fomted with human ( oBR R mebtdes uu\ dt-ea-e: or condition who-,-oo-ei in a pan -m i- · aif-.’dbv, at le id η- part, the snt, unuon oft GRP P with it- be.-' d, ('GRP I u- -e-ci t\ of the - i-„a-„ m rend tmr co, -. «> !<«„ e.e't.J o; de-wa-ed ip. the imet.ietton oi ( GRP P wnh ('GBR, b'\amplcs of discuses and conditions that eon be treated wnh the antigen binding pietenr- ik-cribed ketch; include hcad.u.1 <. -. -uch a.- ». lu-tei headaeheig migraine, including migraine beadsohufo chronic pain,, type· 11 diabetes mellite, inil eiimatioa. e g, n.-mogesne 'ufhmurtatioi.,, atefowa-, ol e .h-owle*-, and bettiod- -anm. derangement a—oeuned with endofoxemsa ami <-cpsts.
Kt In part;', tea·' anogen binding p’oteln- doseribed hesein can in- n-etl to ire.u msgriune, eitliei a- an acute treatment eomsncnemg after a nugndne attack has comm-need, and or as a propio. ka in treatment idmniktcred. e g , 'holy w»,d;;y, biweekly, monthly, 1110100101-, biannuatb., foe i to pies cot oe*ednec the t'tequ.Ofo and or -cxertts ol -snipton-.s. e g , pum λ η:>ηι?, as-oei ned w uh rnignnn., tttaeks
I bdiTP-:te. bletlsods s he atrngcp hmdt-tg froi.-ios de-enbed hc<cm can be used for d'uenost'c mirpo >es to det-.-U, eb.ipno-'. w’ moutt-u diseases and o* „ ondfoon-,ι,—ts tat-d with CtiRPP Xl-o pi frtidcd are method- tor the detection ol the p:e--ence of ( GRR R in a -ample using eh.—ucvd uunnsnoie-fologu .0 methods knewn fo tho-e 01 skd> it; the <-r( ic e , Τη-sen, i’t-Ri, /fo;· 0. >
cmK Jbefofo /wwwussutm ¥ol IS (Eds Rdf. Burden and. P.H. van Rmppenberg, fcloc-wfo Asnste'dimi Zola Rfosfoupi fom;/ i hGmm-G foRfomfose--, nr 11’
IStGCRr Pre—. inc 1. h-dlomeu ,z m(. 1335..( (k/Λ Kfo( KB ^20-335: Ul-.wu.m . ,· o(. 1337. ,( Geo kfo( jO3-3(RR'-5t?Gfo The detefoton ol CGRP R can be performed in v/im or in wwp,
Diagnostic applications provided herein Include n-e oi tbe antigen binding, proteins io detect expression of < \jRP B mid biintme of the ligands to ί 'GRR B. L- m.p . - of methodu-. ltd ·η the d deepen of th - pie-em e ot < GRP R m hide -mt'un-oss-.0-, -in b Ge -1 ore i-.nked t-.ninnno-oibent a—,t\ U I IS\) and the ru.honnmtmoa-·-?.', iRl.Vi,
Roi diagnose- mpbt ations, the <-ntsgen bmdmi: protem i-p'e db wtb be Libel d whn 1 defoetabfo fobeut-g gjoup buttabfo iahehng group- eu hide, bfo ,ec not homed to, the following: radioisotopes or radiormcBdcs tfog., Ή. ’''(', f'N, Έ, M'Y> I'e, ’in, ’Ί. ‘ '!i}, ficotc-H cm : omp-1, igllK, I'sodemme. lanthanide pho-pi-or-), eu/-u\;p, gi-mn- R g , horseradish peimtd-tse ρ gataetosida-e, hi-Jumise alkaline phospha- t.-eb ehennlummesecm group·-, b.oPssyl g.ioup·-, or psedeformmed pobpepude epitope- recognized Iw a secondary reporter t, g,, leueme ripper pair --opnenee--. binding sir- foi -eeondarv .mtd-odse-, mGal } -v
2016244220 11 Oct 2016 binding domains, epOope tagst hi some embodiments, the labeling group k coupled to the' wigen binding ptounn rfo spacer aims ol wnoo\ length-to teducs' polentnd sferfo hindrance, Matron- molhods for 1-,0-,-1 mg protein- are knowti tn she and may be w-ed
In asanltei aspect an antigen bindsoe pjotent e.m l-c as„d to idetutk a <~„il os eelk mat 5 express CGRP R in a specific cinboduocnt, foe antigen btndma, ponem ts 1 rofoed witb it labeling group amt the l-rodmg of ?l c labeled antigen binding protein ίο ί t IEb‘ R k detected,, tn ,1 further specific embodiment, tlte binding of tlx -mticen binding prokin to CGRR R dete>, ted w co. In ,-. futfoet speed»' embodiment, the t\»RP R mstmen binding; pi-n, m is 00 aKn arc inc.eerree, ussng K'vdn.qnes snoso> in foe <ex \< ,bi evsrope, b’ro/>n romt-on
IAS, '!pr,\-;o<0 ”< I /ο,'ϊο,οΛ-'ί, V,.>«;/<,>( \e« Aofo ί old Sprm$:tfarbo1led RhM and pet iodic supplements), fofoz· if c G/iga.z, J, fo'fo, <e- »ro/? pr, >λ >< -fo A. Atoifiorofogn How York: John Wiley fo Sous .Another aspect provides for detecting the presence of a lest molecule that competes for binding to ('GRP P with die antigen binding proteins provided. An example of otic such essay would involve detecting the amount of free antigen binding protein in a solution containing an amount of (' GRR R m the preserve m absence ofthe test molecule. An increase In the amount of nee miigeti binding protein 0 < , the unig-..-n binding protein not bound to CGRR R) would indicate that for lest molecule is capable of competing torCGRP R, binding with the antigen bni>.iiug protein in one embodm» tn, the amigen binding prorem is labeled wuh a labeling gtoep Alteowi'v els, the lest rofocenk ts I foe led and tlte amount ι-ί free ie-ο mokane is monitored in the presence and absence of an antigen binding protein, Μ5Μ.|Μ^οίΊ0Υ4ΐ«ηηΡ2Η;Α^1ΜΥ^Ιί£<Ε..Ι;ΑΚη;.ύίΛθ<ηΐΑ^ΚΜΐΜΑ.ίΧ\Α^ηΑη^ιι;ηηρη.
Methods oi using the antigen bmdmg proteins <ne also provided. In some roedtods, tm 'antigen binding protein is provided to a patient Use antigen binding psotem nduhrts binding ofCGRP to human CORP R,
Ph.irmaecn-'A»1 compost nous thro compose a ihorapeun· dk effective iinot-ut ofmroos a phoidio, of the amneen binding proteins hud a phuinmcesnfoatiy acceptable diluent, earriet, solubilize?, enin-aifo r, pro-ervutiv e, and or >Μ|·ο, :ud .ire also proc tded In addition, methods of treatrr- a p went, s' g , lot mnjame, bv .idrotro-foimg such pharos ueuheal -.oroposifroi' ais' tnefodsd. The term “pttdest5' includes bttm.tm patients,
Aev'v'ptahie formulation materials ats' uoiitosn- to iceipieuls at the dosages and eora.enfo.mon- employed In specific embodiments, pharmaceutical compositions comprising a themp- teie.dl v elkifovs' amount of human ΐ t IEP K antigen binding proteins are prov ided > -n :·· ix
2016244220 11 Oct 2016 lu eerhim embotintiengs, a,eeptal *c Tuw .sladnn materials pimeruhlx ,ne nuuiueh to rcdpienis at toe dosages and co neerst rations employed, to certain embodiments, the ph<ernb\uoed cmnpossuuo max - ontom tornuuaisou muler'.rs for mocUtying, mnuttosuuig or ptcsetxn'it, Ευ example. the pH. osmolarm,, vfxeossix, dams. color isutonsetA, odor, iterfen, p stopllnx, sate of dissolution tn rel ,-axe, adsorption or ps,netrition of the composition ip such ·, mhtdtme'iis, suitable footinlubon nfateoals uidubs, but use no- boon d to. arunu acids uxu.h ts gixetoe. glutamine, axp.ux.gtoe, arginine or lysines: antismerobi tls: atmnxitomto (,-ueh a-, ass-os to, a. id. \odPiO', subtle os sodium h?,!rog>, u-sulfituh todieis ton h us horas... bfratbonaie,
I, s ht :. cskates, ortesphates to other organic ac'dto bn 'auu .meid' Hneh ? ? mesutool o, it) gly - me), s bd mng igents ssueh a- etox ieurdsantine tetraaeebe ecto i Γ DTP A)g complexing ay- nt-»tone i ,, s edieuic, pM\' -»t\'p\i'oj ,h<n.,, Oeia-excloeexnn'i o* hxd.O'xpmp·,-beta eyelod.'sn'm), oilers, monosaccharide,!, Oisucehxrides, and otb> r eaH'-ohydtaleo (such as glucose, mannose os dcstotis), pa<Ut'u.s touch as s,-mm dburnsu, gt-kum os immuhitolobithii-), coloring. flavoring and diluting agents, eon· tody uxg a gems, io toophthe pointers isneh a->
petoxmxlpxsiototone). low nioiecsda? weight puupepSsdes. sik-fetmseg counterions (such as sud'tuni, p-eserc tuxes sspelt a.s benodtoesnum Jilonde, beiizem <,dd. sakexhe ueid: thoncio-asi, plteutobx ί nkohok tnclto. Ip n\fto n, propy Ip tr J\m ehiurh.-xfdfrie -orbie acid or hxdtogen peso\jd.-h sotoents «such as Jxsetm, ρ>ορ->Luu ghee· o< poive.hxL-ie ybce.'}, sn^ai ateohets <,\U- h as in nunfel or sotoslol s, suspending agents, surfat t pas m- weftsng agents touch as pinrouic-. RbG. soitotan e-aer-. potosi-toutcs eneb as polxsosbate 2d potosmhat-, rmon irons.tburntne, ’eetihm, ..noleHeroi, tyloxun tig stetohu enbauting agm*· ouch HiCO'seoi sothdui?, hnm'itx enbau, uig agents (such as ai'sah suet;ί hah.ies, psdemtoy sodnnu ο* p-gassumt ehieruje, m.mmtol sorbitol'!, deuxere xchid.-s diluents, excipients tnd or ph.eniaeeuift ai adpixanis xd . Rf \ll\tl I'OVS Plh'xkM \i '11 IK ,\1 to h|'\< Vto lb '
Edition, ί λ R Gentmo, cell L'tol, Mack Rubbsbing ( ontpanx
In - ettafii embodiments, the uphold pharos ·,, euoeal ·. otnpositgut w di be determined by osu skilled us fee ast depending upon, lot e-s.-eupto. the intended rout», os'udnnmtoraiion, dpi!Ciy ioimto md tit or? d de-age eh. , i<a ,-tofmp\\ RI \H\iJ7O\'S
101 \RM Xtol'l TR ΛΙ SCUM i S, \ ,/w Ineestam embuduticnis, such t omptssUwms ma·.
tnlluenee die phxsival stone, stabilitc rats' of m cor release and e»s of to >v\u clearance of toe ar.tig.. ti binding pioteni·- sMcm-ed In cesium cmbu-.bm.'uts, tbc psuhaix \erode or carries in a pli.u'niaeeube ti com position nta> I'e suher aqueous or non aonvoiis to n nure For example, a
s. da n x - u k os < ο i m e I, wa.~ Set n t,, u t p'xsjohu !, a sa n c -' si et o in ί. I
c. „otesp r „ 'as. po->s dx , spp e tj.uted w d of e; m. e iaK seme on s cor -x'si sons ,o i toix
2016244220 11 Oct 2016 p-r> wemi Ww nAmnnm \etfttal btfl.'.'d sabne or sake.- nnsed wnb seonn dbinntn <r, furthcj exemplary vehicles. in specific embodiment.·', phatmaceuticul eompi isitloits comprise Tris bidfer of abow pH 7.0-8 5, or acetate bitfier of about pi I 4 0-5 ?, and nun. furthi.r Include sorbite! or a.satiable substitute, & certain embodiments, bnmnn CGRP R'antigen binding protein compositions may be prepared for storage by mixing the selected companion having the desired degree of parity vxith optional formulation agents iP.IPvH'xG ION'S I’H \R\tAt. Ft IK Al SOW I R the fern· of,. RoplnR.ed euU or,a. tpueous •oiwdou I'm fet, m cemim cmboilnaents, fee human LGK.P R antigen nmdmg pu Anr. naw In foimalatea as a lyopltihrafe using appropriate excipients such ,v; uicrose
H) Phe ph uv ate„w, <4 t emfv-Aom , in So sole» 'cd f- u patcifieml dc’ix iy
Mternatoelx. the eemposu onsm.e, be sekxied tbs whahmoo w lor tkiiscA tlnough the dtgestK c tract, such as orally Preparation of such pharmaceutically ae>'> ptaMe compositions is wslhm the skid of the mt ihe tunnulation components are present preferably in. concootratosns th rt mv a; eeptab, m die site id ^oa\n s s A on in >. ita u , rbodiwcnts. biokm me nsec to m at4a n tin composition ,n p6ysioleuK.il t'H or at a rimntR km-e* pis, ivpteallv orlnn a pH range of from about 5 to about 8.
W hen paomteml admsm-tsumw ss contemplated. the therapeutic compositions nta\ be provided m the foim Ol a pyloucn-tf, e pdemei JR av.cptalA' aqn< ons solution lowposwc.
the desited human < 'Gl\P R funding ptot.-m nt a pbumaecuiteuh', 'leeteptanl·. veh-e-'e \ puttetu n|y mutable \ duel.- lot n itenkral m-ect.on ό a .-rile dtstih.-d w ,uc· m >\ hteh th.· hiiimw ( t IK P R anm-eu bmdmg protein is lotmuhw J ns a sterile, iviiietfc solution, nioperR preserved In certain embodiments, Ox preparation ecu tmeKc the forotu.buon of the desired mificenie wnh m ,sgent. sn>. Is as wwetalA' rtnesosphew ·-. oto-etodtbic p^rnclex, polx’uette compounds much as poR lactic acid or poRgRe-da, audh bead's oi hposouses, that mas provide controlled or sustained release of the profiKt olu,h - an be del R emd rm depot iitis'ction In cenain embodiments, hyaiumme aesd rutty also be used, has mg the effect of promoting susbmn d dumoon m tee on viai.on In , erlam ,-nmo bwcnis, implwitabie drug delivery desSv.es may be used to tmioducc the tlcsued a-uig^ti binding ptoiem
Certain pharmaceutical emnpositions are formulated for inhalation In -aw embodiments,, human CGRP R. antigen binding proteins are formulated as a dry, inhabibie ponder In specific ..-mbodunems. human 1 ί ΪΚΓ R mt-gen b ndrng protein tnhal m'oo solutions may also be formulated w ith a propellant for aerosol delivery In certain embodiments, solutions mw be nebnlwcol. Rtslmonary udminlslmtiors and lormalutioR
J <1 Λ
2016244220 11 Oct 2016 method* therefore are further described hi hiternaifouin Patent Application No.
1*«' i ϊ SM GO'S a wh'vb ,-1 eo ponded b> i .te.enee am, desct.aes 'ulniei utx d„ i\ ei> o? ehemicailx modified proteins Rome sot inflations tan iv ndmliiistered oouly. Hitman CORP R. antigen bmdmg proteins that are sadism evicted in tin* fashion can be formulated with or without carrier·, eusfomarity used in the compounding of solid dosage forms such as tablets and sapMUA', hi renum emtio,t-n ruts, a capsule may be designed to release the active poromi ol the formulation at the pomt tu die gnorolnteshnal tract when btoavadabilnv w maximized and pir’*vstcmn dew utation r* intninii/eO Adnm-uiai agents -. an be in, hided to iw dilate absorption of the human ( GRP R antigen bindirm groteni Diluents. l’lu\onng* fow melting ip vepAeble od\, mb'A.n'o sUspr'Al'm’ ig nUA„bk\ di*t' AuiAwe agents and binders max also be employed.
Some plormui.eut.c«i iempo*Oon* .demise an effect”, e qminfoy -, u on. οι i plutainx of hemati CGRP R antigen binding ptotent* m a. unxime o tin non-tox.ie exeipietit.* that are suitable for the manufacture of tabRts Bx dissoix mg ihe tablets hi stenle o oar, or atiothei
1.5 uppoipri Re vehicle solutions nuy be ptepaa ad in miu-dose hum Suitable excipients include. I\n are not limited to. Inert diluents, such a* e.iRium earbomne, sodutm carbonate or bie,xrG'f'.tie. i.ietow, o- - aleww pho*pbat- , -v bmdmg igents such as si uelt, ge-utif' ot u> a. co or tubiteutmg agents -.ucit as magnesium steaiau., -oearie aetd. or tale.
-Vditfomn ph irmuccmicai lompoMUons xvUl in- ev idem :o those skilled m the art.
including foimuh.'.tion-' soxoix ing human CHRP R antigen binding proteins in susUitueb- or eonlroHed-delivesy formulations, Techniques far formulating a variety of oilier sustained- or eo-molf d-dehsen means, such us liposome euuiei*. b'ai-x.'xod't'fo-info.rQp^itfotoor porous I cad* «no depoi insertion*. ar. 11.-,0 known to foose skilled m the ar·, ow, for exnmph hittinations'Patent \ppluat mt No R< 1 I 0000. »νη>. h is 11.,.011105,Urd by wf trine and
2.5 describes eoniroiled, release of porous polymeric aiioropurtielea for delivery of pharmaoeotieal eomposmof's Susi nised- tense po paivimns m.o, wcbi.le s, iruperoieabh' pro, m. i 01 Ui-ees m the form of shaped tie-.es, turns, or mtcrovao-mL-, Sustained relcs-c matrices max us I de w'x am, 'sdt(.»p · s, poR ,<n t. tes ‘ i* ois ο* -lot A n 0, nt No ί “*K Oj 1 η I bniopeaii Patent Application Pnoh<. anon So, i.R 0554M. cads of 0Inch * meo-porated b) telercneeh -..ooolymers oft glmstmc uc-d and gimma dhxI I elui.tm.ne {Stdm.iu e! .«/ , R'G3, >m m 2 5u~-xxo), po!\ |2~hx diosyethvl-n-ffoaci v -ate} ti uniy*i - > it. NS I ) ¢0000 Z
Vm’A'. fo.\, Ip. ip and t anger, Ns?. t Uch. 1? ethylene xmp aech’te «I ai-gsi a >,>/, ί os |, .«ρ,-,ηνί poly~f>{-b)~b.;ji(,\ybutyrtc aeiri Hitiiopcan Patent Application Puhhcatton No, I R IdZNfobs bustatued teleuse comnoMtioo,-·; rnas also include liposomes that
135
2016244220 11 Oct 2016
- κη be prepared by any’ of several methods known in ths.: an 0\v. eg . Γρρ-tem <7 to. P^5. Biot bxs,' 7 > ί Λ I be .was to'A toeopeai Patent Application Peel vm,on \os to'
V?6,('7o, ΓΡ ‘Ksytoi. and I E I toto-to. smetporaiea by retmenev
Pharmaceutical, compositions used for in viva administration are typically provided as
Merile preparations Mcniizanost can be accomplished by tlhmfion through ste^ie nitration rtierforanes V, ben foi eomposmon is lyoplnh/evk -fcnh/^ijon tiS'Ugdiix mefood ma\ e-c eon ducted either poor to or following iyophiheatioti and reconstitution. Compositions for paienteial aihtsitnsttatimt can be stored nt lyophilized form os iu a solution. Parcntesai votnpox'tti'nx genemhv are placed mto a container having a -tertle access port lor exame'e. an ft) imravenou1· oibitioti bagen vial hav mg a stopper pierceable by a hypodetmi- iniee on < edle. lh eerfam enibo.dimsptSj cells.expressing a recombinant antigen binding protein as dm J-weo erne, is K t apM cce .-rt. e er\ mee. b >esi t tpb h dmol \ ts -G 'v n m 3002 and f’nxc. Nath .head. Sciences i05. tfoto-.θίθ), 200o)
In certain formulations, an antigen binding protein has a concentration of at letst 10 i 7 mg tub 20 me, nd. 50 nig ml, 40 me ml, mg mh P0 mg nd. 70 mg rah Ml me nil, 00 mg ml,
100 tngZ mJ or 150 ntg/ml. Gome formulations contain a buffer, siiemse and polysorbate, Ac .example of a fersru.httion is one contanung 50- i 00 mg mi of antigen binding poyieiti, 5-20 mM -atomm acci-ite, itito-w v sumo-e, anti 0 002 Opals ww $ pr-Rsotbats t'ertant, tin mnhitiww, tof uwtatifc, comam to-5 mg mi of et antigen bmfong piete-u m 0-i 1 mM sodnnn acetate Outlet totO'tow'v -merrwc and 0 ops,0,00ms. w v polv,sorbate fhepllef certain such ηητηυΙηΟοηχ ts in the range of 4.5-6. Other terrmtiatiens have a pH of $.0-5.5 I.' g , pH of 5.0, $.2 ot 5 45
Once the pbarmaeeaticai composition has been fortmtkned, it may he stored In sterile tods as a solution, suspem-on, get. e?rnd-mu. solid, crest,ti. ot a- a deity Orated ot lyophtiwed pew ties ouch formulations mat be stored Cither tn a rewR-io-nsr toon rs m a form (me , lyophihxedl that t.-> imeoustimted prior to adinmistixithm. KO- for prodm.ine a -mgie-dooe administration unit are also provided, (ertairs kits contain a first container having a dried ptitmin mid a second eoMamet it:-,vine an aipjcotis Otimyiaiieo bi rertnin embodiment-, bus containing single and mnhi-ehartibcrcii pre-tilled syringes R.g., begad syringes and lyosgi nxce-o are provided Ik therapeutical!} eftceto,.- .mx-oent of a bmtxan ( GRP k antigen binding proteiti-coutammg pharmaceutical composition to be employed will depend, for example, upon the tlieran-entie context and objectives. One skit led in the mi ά ill appreciate that the mp root safe dowga !, v,<ls w tit stnu t-t wd5 vaty depending. m pmt, upon the momento delivered, the indication for which the human CGRP R antigen binding protein »s heme e»- d,
136
2016244220 11 Oct 2016 *11 f> x ,C o* a if U ,’dth \ w dm 1' «t?i< U »Jt cn’OHVJ.nM { do» condition (the age and genetai health t of the patient. 1st certain embodiments, the e it scow 3!,r ο?-, r the do-ape ,wd nm-hb In,' wete of αίτηοο-ηνοοπ *o obt dn the xipnotnl thewpetdic \ typical do-see m.o range tro-nt about i ug kg to up to tbotn ??> mg ho or more, depending on the faetots οκηΡοη/Ο uunx' In -peGfic embodiments, the dosage may range from It? ng'kg up to about % mg kg, option die from f> > mg kg up to about ed mg kg xibctmu-oeiv now 0 > mg kg up to -,bout 20 ng kg sn smt-.e epplu awn-stoke dosage is Row 0,5 use kg tn 20 mg kg In some insiattecs, xtn antigen binding prutcni closed at 0 > mg kg.
0 5tng kg. I mg kg. ? mg kg, ?0 mg kg, or Ό sup hg. I be dosage schedule in some treatment regimes is at a dose of 03 nta, kg qfo. 03mg kg qW, I mp Lg qW, 4 nig ku qfo.. It; mg kg q'O, or 20 rug Lg x{ W
Dosing fiequettev st HI depend upon the phiawacekmctsc parameters ol the particsdat humen V (IRR R untsgett binding protein in the formulation used. Typically, a clinician
1.5 aditsanstef s the composition until a do-;me ts cached shut achieves the desired effect. The composition may· therefore be administered as a Rngic dow. or as two or mom do-w- (whseit may or may. not e»mt;un the -anse amount of th>, desued woE'cnn t o<et Ome, o? \s a continuous infusion <3 art tmpiantaiton dev see or catheter. Appsopnate dowac- may l»< as-eerffotixid through to-e of appropriate do'te-respon'te data In certain embodiment-, the antigen binding snubur- e»nt be admuii'iteted to patients itnofeumt an e\ten<ied time pe;io<t ( hrome edm;mstrau<ni of an mt.gen binding profem tmmmoe- we ad'-er-.- nnwuue ot ei'.eggtc tespouse eoiumousy associated with stsuigen bmdmg protein- that, at-' not Only human, for example an antibodx raised against a human antigen »u a non-human animal, ?'m example, u non-fully human antibody of iimi-hum m annbofo piodu-.ed as a isoo-lmmnn -pceies fhe mute of adoum-nation ol the pnatmucenurat eompo-nton ss $n ^torn w uh know st methods, t g , osuily, ihmngh wiauioft by intravenous, intrnpernyneak mu ace rubral isw'r.i·p eneh wdkhd ee-. ro-uutn alas nt i nw-dm ut a oet t ts co! mt tons o; imraiesiitnnl metes-, ny sststamrd release system'- or by implantation device- In tV’tsun -> mbottnncms, fhe 'aenposWoi-s us«y bx' .shmai s',co d bv bolus m.'ut.un o> .ontumoiisly by infts.wtR. or by inipluntaliou devise,
Ihx' composition afe may b<.. administered locally ska impkmtntion of a nninluaiu.', sponge ot another .ippfopn w„- msstertal onio which the dte.-in.-d molecule has been absorbed or ertCxip-nluted, In eerisln embodiments, w here an implantation device ts wed, the device may
2016244220 11 Oct 2016 t'c implanted >r-m ,uiy suitabO ossue ot m pan, and densely of die desired nydceme mas be >1.
dClusion, itmerCtelsaxs bolus, or continuous adminitOrarion,
It also may be Oitsiru-de lo is--.? human CORP P, antigen binding protesu pharmaceutical eompmutmnx m v;vo in such instances- cells, tissues or organs that base been s'emoxed from the patient are exposed to human CORP R antigen binding protein pbarrnaeeetieel
--ompusi turns abes ss htelt the -.-ells, i-vou *- and οι ο,ρ,ϊ w are -sib-,; qie/tu Is implant-, d twek ode the patient.
in pnrieiua 1mm m * 'GRP R mdgen binding, inotxin- , asi b·, riehs cied in i.mptammu ϊ-erum eMls Put base been petKiieaib engmeered, using' metltods such -as those dcserRcd
u.m-m io express and >ce,-*,' Re pob pepode in .'eitam embodiments, so- b eelN nun 9., animal oi 'finnan evils, and mas be autologous. h-tesologoux, >u xumgi. ueue in eedam embodiments the eel’s m.n I» mersoruh ed in -uhw' embodiment-, m oixh r to d, t ie ise the chance of an immunological iespouse, the ceils may be cncapodated to axoid intonation ot surrounding tissues, in further embodtnivuts, rli.,- encapsulation mntertab are typically i 5 bioeoirspatib5'*. semi -pen neaiue polymeric enclosures or membranes tiled allow the iciease of the protein pivdueris) but presen* the destruction of the -ells bs the ρ,ηΐχητ'- immune -sstesn ot b> -nti,* detsm ema' factors oom the suitonud.na tis-atw
I be following example-, meittdmg the experiment- conducted and the merit- aebtesed, are provided Im rihisir.tfixe psnpo,;,.:- only and are not to be cssn-inie-l as homing the scope of the appended claims.
A. MoReufer cioning of liuman CRIB and MAMFl
Human t' i\l il, l>\ \ 111*. i d he ik Accession No. 1' I 4 ” n Si G I ft Nt. t 11 and R A Ml'* I
2> el>NA RsenHatd AveesSson No AJOOiOU. M-G ID NO,sl s' esc cloned mn< the mammalian eel' ’\pr,W'iuu ky’o'o :u l)N A t 1 -/ v ,im1 pel)\ \ 1 I -1C ρ t no. ·ηο> :, V iris'- tri. { \\ msp>. noe’s, bn uac-leGion- of III K 2'Gl.bNA eeOs tire, otoecr-t as dose* shed below t be hVRI R - DN A and hP AMP! - i'JN A svere also cionM into the pIC-riGR i xeGo*' (Run. ΙΠ , t al, i Ins, Detru Symp, Psoe. COOTS 1.2 riX-ri't- lot nansieelioti- of AM-I Cl IO cells jC, S.
Patent Number o,21OriM11
B, StahR-TransfeeRii < 'eh 1 rite ilii.K 2fOCBN,A celts (avuilabR from A'i'C'G or bis urogen) ',vesc eded at a density of i.dxib' ceils per SOOmm dish. After 2-4 Imam, the cells wete uO-hansiccted with bigg
I3S
2016244220 11 Oct 2016
2Θ hneari.osi D\A- ol buR AMR! pcO'SAa I -He.g and huCIst R pt f)\ A- !-7eo with ΓυΗοηι,Τ * bn iiiogcn. ( arlsbad, CA) Follow mg m-unieiion- oippbed by bn mogen After tv o dav-e die cells w re tnpsmi/od. .nwl suK ultme.l mto growth medium eooiasnmg lOCyg mi hygromv m ' d5?fiig mt cement .Mier two weeks, the te-niftne drug resistant colonies vese Ren-nu?ed and combined into pools. The poets wvre subjected to four rounds of FACS sorting an Aleva 0--17labeled I'GRIG - peptide analog obe-ei dud below 1 Tbs' highest ΐ% otAxpiessmu ceils wete codec ted at each round,
VfidkAsXue^
AI 1 ί HO s„ Rut seaiiii *K„ ,/ομπ s ted>.- adep.ee \ - t,mt touts rei HO OHI H ,Mu tent cell hue dzscfiU d m t H.uib «ndi basm, -f7w, On/ !,.. / om 7, d?lo J9s0i, we-'e seeded at .1,5x10'' cells per 100mm dish. After 24 hours, the cells were eo-umtsteeted with linearized 4 pg DMAs each of pDSRt<24.-huR AMP I and pDSRn?-l Ind’Ri R with F'uGeneO (invitrogen, Carlsbad, CA) follow lug instructions supplied by invUrogen The transfected eel Iwere ovpsnuced 2 dam- after trutskemm atut seeded into OHO PHl R seR-uo c growth medium containing lOT, dialyzed FBS and without hypo sunt tunc ihymidiiu. supplement. Mmr ? weeks the rv-jhing nansfeeted eoknnc- were trop-miaed and pooled she pooG were sublet led to F \C\ sorting ;·ηαι\-ίχ ‘ Suihk eyptes-to-iofburjian adienomedtiljin jA\H i tp Hl R.....Τ,ΟΙΊΑΛ,celh ?fOb'H\ A celG we·'.- seeded sn 100mm d\she\ Ό 1 5\iV ceds dish m DMI M ibtgu glucose) M-iBS H1., Ml M non essential antsno aet<ts l1 < sodium pv nr.ne fhe loliow mg d p, the cells worn co ir.m,sf„-eted Using Ht st\F o imnsfection reagent (Roche! w uh p. DR ΐ renem huCRt R piu-, pefA V 1 dsvpnmisciu hub, \MP2 Both i)\ \ eu'tstiaets wete linearized w fib IGpt After G hums die cells were subcultures! into lOOmnt divite-ai e . . . . .. . . κ . . ,ς . . . .> .... . . . .
-...di Jen-ntes <SHu , ; 2x10 , R\iO i elG ih.xb) m growth medium i.onusuimg dOOun ml zeocm I hs medium να- rbanged twice weekly Atid one w ..ek the plates were led wfih medunn emm-aumg Mating ml h\g:om\> m - 200pg ml z -υ· :n Mvt two w eeks, <3- ,ol,mt.> were isolated with cloning rmgs Ihe t emantnu. colonies wete eolicetcd into a smgie poo!
> pi turn Flu· clone-- anil pools w>. re essayed mr tin. n respot -e to smuidaum by reeepim agoUis', or lor-kohn Sevens! <. tones showed - good tespouse, and one was seh, eied ha u-e m sub.-eqitem evpenntenis
Sfibh· sG.ffs\s-son of esno C URP R. m Hi.K \ eeik
2fi,’H:H\ eelR- were seeded in lOOmm dashes at I ,χχ 10' veils cash m HMI.M thigh J.u>se; K , s BS 1 Ml M on-ess t Pal mnoacn.s ' \odt. npvHvat the h'dow mg da\ the <,e!G were eo-uanstieh J usutg I uGl \Γ o w tth
139
2016244220 11 Oct 2016 pci')N V ί ?eo-·η - y mCRI R ρ! is ροΠΝ A i hy.-omy, .n - pnR V-dPI ffofo Ο'ΠΜηιιis were linearized w uh INpl, \lk-r 4K hours the cell·- wem 'stibetihured ntto growth medium eoni'iimm; ?O0pg ml zee·. ·η - lOOug ml by gton-y m e nkmow fo 1 '0 ί *·0. I 100, ;m,l I 200 The medium was elenimd tv- ice weeUv. Vtcr two weeks, to transG-et-.d eoiomes ? were isolated u*.mg cloning rugs 1 he - hones were as-,used for iheu response to sitmuhiiton by ('GRP hger-d. Several Gones shewed -fotnl n In-,Is kvcls ofsesr-n-.se .md one was sek-led fm use nt subsequent experiments·, <2, hnhsthm of high ww pressing f.'GRR receptor cells
Λ CGRH.e- eeptsde asiak.-g was synthesized Ovbbv-est Bio- leers hie, I Ahets. LM woh foe \equeme below
Ac-WViURl Aid 1 toSGuYk RONI VR fO\ GPi \i --, .- tS! 0) ID Vfe f he pern-lo v.jfebe5- d wnh \lcs,t (' fell1- follow mg die maim Lu f me? N if'-stmci-osis (Mok-cuku foobes, bs>. Cm λ 2Pt)P) Ihe Mesa M~-L'.heie-1 CGRP --showed »peetik stoning of CGRP receptor traasfec-od cells and not the non-rmnsfoeted parental cells ;u:ti -as used os th- l'\( x fcagent, hr hui 'GRR receptor tranmeeted 2'GEBN A .md AM I ( GO evil pofe -generated aabove) were sorted repeatedly up to four fees pools using with Alesa 647~lsbefod OGEife peptide Ilsch expressing culls were collected at each sorb expanded and after the feu srrtntg bo/. - ο-.- \iak Mk- AM-: OR) l-f('( jRP P .elk wew- used lot mwu-m/num as d-w, toe I resow asm th. 29R-RN \ huGGRR R eeiR - ,ae usee for titering tnouw sera aftet immunization and m Itodinc screens of the hybridorna supernaimtK
IX Generation nf soluble GGRR receptor
Soluble CGRP receptor polypeptides containing the N terminal extracellular domains y-( Ito of unman ( RI R tel U 1F> NO ot .md htmum R \MRI -St Q IP NO M wow jecemt-d by tran-sentIs co-trensfocustg 2°5 6b cells t Duroeher, rz M , .Mn'/em ,foto AL -. 30R0 ι2002t) with vectors roniainiug tbe corresponding eDNA*; t'SEQ ID NX):? or SP.Q If) ROM? as 0^--.110-,0 Ke (<'t is'tonN used tag-1 ml z|lis,; H \ - -J tv J <i we-c eumk-yed to t » ilhaw- so,-ebon ,md -m sub*eqnent pmtfie.niem \ .-«foible «..eoidsmziie f YsRR R hi D los ,.1 to I e was pier e< d by ^CR , S-umig n1 ?0 the appropriate primers mm me transient m.prm-stort' eetot pi 1 e dforoeher - * d , wwto The CKl. R N-terminal bCD~be consisted of the N-lettomd cxfracclhfot? domain off'RI R. tSEO 10 N0:6) Rt.sed to human IgG I Fc- I he RAMP! ECO-be contains the extracellular donums ot'R WIFI iSVQ 10 NO Xt fo-ed to hum m RO I be in Imfo e -.ses, th.-te -as , Imkei vf-tsist.ng >,l Pv v. si-'tsceat v. Gw betv- „en ίη„ 1.( 0 dm urns and I c
140
2016244220 11 Oct 2016
The soluble heterodimeric CGRP receptor was exptessed by eo-fi-jtixfecting the two emtstruetsa* fellows >G-<ri ceils at I \Id’ cells m» nt shake flasks were ouitsfeck-d with P 5mg I G\ \ foCRi Is \-fer f'C D-ί e nf Γ5 and fotR W1R1 Μ D-Γ, pfF.x; wfo- Cm Obi mg DBA tit 1 rccStvIe 2fo’ media t Iroitfogenh 1 eb* weie grown m suspension tn I teeStyh. 2^-» expression nt,:diuro supplemented with 0 PG Pluroroe Vbk and 50 ug ml Ceneiicm tor days and harvested for pnrifeafton.
Pnririeahons from conditioned media (GM”) were performed by buffering foe CM w Uh the addition of.eOmM I its, -»00ο-,Μ sodmm mlmde, «nd uriptslnig Ihe pH to s * 30-,. buffered CM was then passed over a Protein A affinity column equilibrated in 50rnM Tris.
gQfi'uM sodivin ehra'.e and pH .-.dj-isied to pH k 5 The Proiem A toforon was washed with Pho .raj me let., on piote-n Jmca wph 0 \ HG \e Hs: e'uted nea. eonumuv oom t RI R and fCAMPI components when tmted by western blot uong rodwideal uiti'u<idt--s spei die to either CRi R oi RAMP I, I'uifhe; I C-MS and \-terminal se.tuene-ng eomnroed foe preootieeof boih <'Pi R R.'xMPI hefet'odime* irodf PIJCCPLP homodime’ in approximately
I X «? 3» raho This 'sohfefo ( GRP m.cptor'' w <s shown to compete m M?x.m4~ kfoeled < GRIP j- binding u- f 'CRR receptor expressing meombm iro cells m the I'M \ 1' analyst,*, ilrbough it faded to brod ( GRP bound as defetmmed n.-ang Bra.ose »esfrog The mat, oai v, -.., used <n an immunogen as fosettled tn ^sample, despite, intet aba, ns hcterogcncits and lack of CGRP ligand, bfodfog,.
2b E. Generatiou of membrane wracK from ree-ombhrom CGRP raeepmr expressing Cells
Membrane extracts were psepated front CgRR seeeptm exps easing cells using a method described py Bos,->e, k. w ,u foGrowri m/fororow ,C.n 'x>7<-..wec, 3> H ?\x 2’C.pi-m» Briefly··, approximately grams ot eel! paste were pelleted nt 50 mi of PBS at 5,000 rpm lor 10 nun at T< and ic-stixpettdeil m 50 ml of cold b sis builet (25 ro.M Ht RlAk pi I 4,5 ro.M
MsCI phfs on, Ro,he protease ndubnoi eookf.nl tabb t 50nil ) Th - lysate wa* boroo,.x nr/e,I wdh Gia* Col t teflon glass homocem/sn with Mo strok-.*,;; >,00?) rpm and man m a 1 MI rotov <u. 20,000 rpm few 15 rnro A d'i This proems w mpe tied p*xv more and the rintd pellet, was re-snsp,eutie.l m - M no im-.l pebeC Onrie· i25 mM HERTS, pH a, t mM Mgt 5 , i0 A. gw x) ,suefo*,- phis one Poehe protease inhibim ·„οΗ:ι nl table» ?Otnl) i he membrane extra-, ts w-,.te situated bv passing, through It* G ami 25 tl needle* 2-i t-nte* Total membrane proamn concentration we,* determined v itb a Mwropkne BG \ Proiem Aswx iPwrec’
2016244220 11 Oct 2016
FXVMgLtj
S8Stt*:aa£.g£ AsaaaMBa TO.caw.»BcnanR
ImmnnieKmns wux. eondueu/xi esme the follow nw forms of ί 'GRP sceq-ΐοι antigens, .prepart d ts desen twd in Example R
o) YU-I ClP) iransl-ectmts expiessmg tub lengtis human t Rt.R and RAMP; at the cell surface, obtained by i,o-trau-,focttng CHO cells w hit human foil length GRLR cDNA ($S5Q ID NO I) encodes,.1, a pohpeptide h omm the sequence SEQ ID \i* 2, «ltd RAY1R1 d Rx A <SEQ ti.) to ei encoding a polx pepttde hax mg the sgqucju'C SI Q 10 \O,4 ini memhiane to tract fivtn foe ecus Oesi ιιΐχχί «η g, 5 «bexc, and t nil soluble CGRP tee/ptos obtained bx eo-expscssiug· ano peril· mg foe A-tetnintni
I ί Π of ί Rl R (SI Q if) RO 6? and the extra, dltslar domain (FC Ot of R WIFI tSPQ 0)
ΝΟΆ) as described tn ibatnpk? 1.
XFNOMOOSP tntntals were immunized with purified soluble CORP receptor protein to and pniAivd < GRP R meMhmncx pfeoate.l ftom WC1 < IP) .e'ds -,ΐαΐηχ cxpicssuw CC’RF R in the same manner using doses ot' 10 gg.'mouse end 150 pg mouse respectively CGR.R meruhrartea were prepared iwirtg toedtoda described above,.
Subsequent boosts were admits tsieted .0 desex of ten pg mouse of soluble ( GRP R os to η,;-'’ 0 if bed t GRP R m,'tomato's MAifoO't SF amm A w dxoimm ni-^d wsfo £() CGRP rccepior-expiessjug reds nsmg doses of 3,4 x to' (to IRP R tranvb ctcd edA mouse and subsequent boosts were of I x to' CGRP R tr.msseeAto e/its Plots/ inweuon toes as/fo wu'e combinahotfs oi subcutaneous I^-:-01-tail ;md itma-Atmme.d hsunum/amms w-,.rc petm-uned in accordance xxith methods disclosed m t'.S, Patent 'xumbe; totolw 1 b filed february to, 2002, the dtockiMire ei white is hewfoy meo-'roraletl Ip rcfeienee Adjuvants I'm?: Max (mid totgnia eu - I2otog \lumti M tot gent Pulp .md t. het mei v 0 Wutor. \.L c u ' to; 2 250s were p’epared according to mnnmh- mrcr-f mstruclions and mixed in a IΊ t ttlo os' adits •cant emulsion io antigen solution,
Sc> , ~ol\\ ted 4-d w,c\s r, ' .to? 'upnoo'» <md spo, to ole s wotc
-I.'V?mined 1·χ I xG- xtsa^sr ,o! i-.otrbtrant GGRP teecpha- sp^wsung 20 »1 PWA cGls
Msec w /re imtunnsccel xxuh cube; cells meothanes expressing sub length i'GRR R ceils os suiiti'ie< GRP R extra-, cfoslai doiwun, wsth a t -.nge ot 11 to untunim-aU-mso\.u -, period of approxtmately one to three and onefoalf worsfow Mice with the highesr sew titer wete .d.m'obcd ,-.nd snopared tot htendoma s;euer,stion The lOinmm mtoms xsetc pc.'foimed u2016244220 11 Oct 2016 groups ofmnhiple mice, t>ph ally ten Popliteal and iugnui-xl lymph node- and spleen tissues roere fxpictdtx pooled from each group for'generating felons,
B, Prepnnofon of Monoclonal Antibodies
Auiifrfe exhibiting suitable titers xxere identified, and Emphoeytes xvere obtained from.
draining lymph, nodes and, if necessary, pooled tor each cohort. Lymphocytes mere >l)\\o< infod t',<m' ixrop,' on,, s-m. a , s,nt ml, o < proto t'e. .sample 1>,!1« ,eo\ Mo Hied tropic Med'um; HMI M, obi,on hie from luxKronen, kb:Μ\,J, f \} to role tsc the eebs from ihe Us'-uex, ano siropeo led n· DMFM B veils xxete -eteeted an.'· ot espandvd usno a sn-uEx' method and htscd x\r,h sxuiuHe fusem p-Oinct, for example, irons .-csetoix' mveloma l(t ps’Xi,? \A o53 ,e’h iAni/ruan Typ, I uhmei ofreetton ( PI ESp kenrino et al 7 feroroE. 123, 1979, l54frMS30).
y mpiiocy n s mere nused oh trodon paimer t ell·-, <n a mOe of t 4 The · eh mixture wa- geuth pelleted by, cent ti frugal ton at 400 s, g tor 4 minutes, the Mtpejnatato decanted, and the cod tnixtroe gently mixed by using a I ml pipette, fusion was induced with PEG DMSO
E tpoBcfrt) lette glx < ot dim· lux' sulloxnle, obtained front Sigma-Mdo, h. Si IrouExlG ί ro! per million of lymphocytes) PFGOMSO was slowly added xx ith gentle agitation oves one mintite followed, by one minute ol'mixmg ID MEM (DMEM withoutgfrttanroie, 2 ml per million ol'B „eiiE ·> a- then added ox cr 2 minutes xx nh romPc agitation, ftΉοο<.d bx additional IDViF.Y! fo ml per tell I ion B-eeiEi vxiih'b was added oxer 3 m roiti--, fixe friscd exits xxetc gently pelleted tMlt) \ g t< minutes» and resuspended nt 20 ml x',e>.tion m.-dia Go- .sample, DMPM eon\un,ng V 'serine and, Hxpoxnrfren,-1 HA j ,ud o'her roppleroemal nt Ueiialxa*. nceessaix t per million B-eelo ( ehs w„o utC'd'atcd t-'t 20~fri minutes at 3'7 -md -hen re.-uspert ded tn 200 ml frebrodn’t media and cultured ter three te four -hys su f'l ?*> rfeks puot to Έ-xveb pEiing (Vhs xx esc msp ibuted n'4t< M - x- el ί phucs usuro standard frcnnuiues ro mroxroit.ro eronuhty, of the teaming eolonfe, Mier sex^ral days oi culture, dn- bybndotna ouperoatnnP» xxere eolteeud ano subjected to sxroermu assax - as denoted ro the esixmp'c-. u„low, rodeoing - ηηίΙηί’ίΐΡππ ot binding to human ( GRP re·, eptor. idenufri,uhm of bloekmg antibodies by a hg,wd binding xoropentiois assay and evaluation of eios·—re-a Pxro, with ntiio teecpro-is related to < 'GPP receptor ifor example, human A-drenomedudin receptor) Ρο,-dtix e relfr xx ere further selected ,,nd -ObjeUe.l te standard clenrou and subt lomng techniques I 'tonal hues xxere expanded in vitro, and the secreted human, antibodies obtained for analysis, t-M
2016244220 11 Oct 2016
Sequence Vutiysis of Selected Oonnelonut Antibodies
Selected snbcloned ιηουοΗοηο! antibodies wete «sequenced using standard R'l -RCR methods ΐ tide ?. \ shows the umino a< id xeqf5enee«· pt the tighi t hams of ·,?\',-ηιρ; try antibodies ib-<n«sod Login 1 able 2B -ag'-s s the annuo aetd sequences ot th„ neaw Uiano ot ? sS'cntpbny anhbodtes ifeetiiscq here tn
Amino fed xeqsumecs eonespondutg io ('DR teutons of sequenced antihotkes were aligned and the .ihgrtroents were t^ed io group the clones by stmiianfy.
Seqnetu.e ahgnme-rm ot light ehaut Cs >R\ from clones Lome kappa tight chains, and eenatu co.fosnombiig eenssttsus sequ-nues,«m shown m t tc- a.\ amt Of, it) Sequence dtgsneems of hnht - ham CHRs hoot, fees km mg titmb.tn tight th.uns, and certain corresponding consensus Sequences,, arc shown in Fig, 4,
Sequence alignments of hem. y chain CDRx of exemplary a-mfedfe disckssed herein, and emtina .ottesponutng -..ousensus seqnene’s, ate shown nt !\gs 5 51k 5C, ?D ano H f'enam cormmsus scotroces of gv crop fey heovv chant t 'DRs dts-fesed hemm are 15 shown in big 5b'
A, Selection of CGHP receptor specific binding antibodies by FMAT
Auer i -t Pays of culture, hytiriditma supernatants we?e screened tin C'ttiRP R-spcedh 20 moheelu',,! e,neetA< ,w 1 kotmtuu c M . o', t< one fm eehnolom, tt Μ V ; t 'cml eh
Bios', stems, Fo.xtcr t 'ny, (At, The supernatant·, were screened ma md either the AM I ( HO htj(\,«RR R, eetis ot wx otubmant 1 II K 2Ή cods One wete uant-'m ted mob hnitnot ( tiRR R and counter·screened oguttw pnemai HI K?9? >„elU tprepared as described t.n fcxample i),
Bnefiy, the cells in freestyle media Hnvitrogen, Canfeui, ( A) were seeded nmo A4~ 25 web I-Μ \ 1 pk?os nn a «.olurne of A0 ui wHl at,»density ot appioxunat/l. --150(1 cells wHl fet die stable uawf,h tang-, anti e a density o: appwmm'ateb, 16,000 e Ox w ti lor the oa'ental veil·; e.nd cells wew' incubated oxcrueeht at d'M J'bstt, 10 nt web ofsupefimt^it wu·, added and ptin>. « we’ ’ incubated On ,ιίγωυηυ’Λ tri ’bout ti c«'{ , <e tei winch 10 tft weRo* ,-^6hunt -,n Ig(s-( \ 5 seconder·, antibody t Lv..!„>on immnno'escaich, VMm ί lime, R \) was added at a concent!atieu of ? b ng ml (IdOne ml final <eneemr,mfe t fl.ucc, w ere then incubated for om.· hour nt 47 . and ilneteseencv wa- read using an ΓΜ \f m-a.rot.tmk'Cal seaune· lApplwd Biosy si ems, Foster City, CA),
Rb
2016244220 11 Oct 2016 ro, -mantes xueenx the p :r> nBl AM-! GBOe.’Oxot Bi X ? B ceils w reseeded \!ra as λ -nJ stmet',atat',s v reeue 11 \ ! \l\i res these -el * ι„ Λ-ea lei t' ri ri.re re he and elhnutat-,. hybndotnas binding to eebal.tr proteins, hut not to the CGRP receptor IX IdeatlHcaGon of blocking antibodies by ilgaml bimimg competition assay Ihenugh EM VT
A itgand hrodmg ,oropetu ton method was ti** etopee -o :ricnsh\ antibodies reu tin hybiidetoa ,-uperniiiarttxd that bind ( GRP receptor and Meeh CGRP ligand btnd-.ttg eh-bwslls plate·' t Got nntg Cosine. Cat. -ΌΊ 2} were prepared vuh 5,00() Wire InsCGRR R Poo; 2 eelk and 2(1,900 unit aits feetcd t BO-S celts to each welt, 2(htl of tron-CGRP P, hybridoma oupernat.mt wore iddred ts? eajo well. and the plains were roenb u>ed for ihr it tooto tcmpemhite ΙΟμΙ ot 2.hug its! Adexa04''-('< iRP- *- peptsib. w-re then oddest to each writ and the plates were utenb tree for a fnrt'ber 3 nonrs at ?ootn temperature The amontO of Alex m4~~ *N 1RO, - boreal ίο B=>. ee<!\ wa- a^stoed on a ! Μ \ f 6200 Hu! -: D,.teet.ton System t Vnphed Blo-osteiitsi Output dre:· wu'e broh a numre seal hi t sales' ot signal intensity ’higher bi 1 vdttes indicate Moore signal intensity) and also .tn image of the * ells
The experiments included negtstive control hybridotna supernatant,- The average Ftl value observed tn tn-e-e negative centre! expeojneuts wxxadophxl rerebe maximum poxoHe signal Dr ?he assto, L spertmetnat supernatants woe et-mparad to the* nrexsroitro signal and a per. ent uilniierot w.ts ealetthsiest fro each wed V’-, inhib-hon (J gf I 5 c1'the em-.-< GOP P ttyhridoma supernataut Maximum ELI signal ti.
An overview eg the data re *hov\n m trig o In this experiment, TOO? anteCGRl' R *opem Pants w.-re tested uxim> Ore roeephn he eid assay H.e lata w ere tank otdetesi using the average prevent inhibition, Ninety supernatants had ''25% average inhibition, 3! of these were >50% and 7 ere ' 70’’« average inhibition
An ahhrex tated data -et ts show si m Table !0. hemw Sample 03 Nos i -5 illustrate examples oGants-CGRP 0 hybrtdorea supernatant,- which inhibited thebmpinv AiesaO-'-”f'GRP,..- peptide to f'GRP receptor and Sample ID Txos ’< re 540 iIhtstsat.. examples of anttGtiRP P hybodome xupereaktntx winch Pot nsU tnhtbh Ore h ndme >a the Alexap4A tn-i\ peptide to tire ('< iRP reecpioi.
145
2016244220 11 Oct 2016
Bared on die binding crenpriititm as*;e. s, approximately 50 supernatants were selected for further char&cieftreMion.
ACmiTV OF CGftP RFAFFTOR SPFORC BLOCKING MONOCi.ONAt
A.yniM)PfES.i\.A eAMB rvvfnoAAi.,ASSAY A, (GRt* receptor atostonjb aeOvhy.
Selected C’ORP receptor antibodies were screened in an in vitro COR? receptor ntedreted , AMP ,re t> ie determine intrinsic potency 1 Ire re e??.i eAMH re-say empire eel a
140
2016244220 11 Oct 2016 hurt \ ne, ’ob'.'sfoma-eef ve-Ked u ? tXKAAK ' >1ο et a :l,r'd d'di obtained from ATCC (ATCC Number 11 1BMP. J11 B-liKells' ι ΠI BdO eelis espresI Rt R and SAWlPRvvmchfomJ GRP?ec-p\trO A! MJ mine et J, I'’ Μι A’GEBYA v.J I n„ \n vvt!i ,ev<m on » * ovi m aus ( ids! K was i\v tUd ts ee-v' Kd n ' * np s e 1, .md a rj I '’ eel! hra expressing mi i GRP receptor w >-obtained from the AI Ci iC kt 145K).
1 h.J Wfb e AMP <>s>> ty kit B\wutblmer Boston MA'> wa- m-ad m Pro sc’cenmg, fhe assays weie pet Ibtmed tn w hue ob-w eh plates -,n a trual volume ot bO nt . Bt scih, oil the day of the assav, tK Iro/eit ΚΙ BBO v „ ils wete thawed at ,W V, sells wete washed once with <»s.s> hnd'et ar-o :? »1 of cell ‘uspen-fon torflamnig Η)ΟΟΠ »'JBmixed wuh kkse-dabjed auR-eAMP antsGids was added into °6 half-area white plates ARu addmg Kid (’ IBP iee-cff-or anubvJy, the mixune was incubated tor 5R tmti at room temperature Then 1 ?nl ! GRP see- nfor igomst hum-m O GRP <J nM fund tonvemrataoni w.ro added and ttrntb-. r incubated lor 15 min at. room temperature. After human oi'GPP stimulation, 51 ul„ ot s dete- iron mo was added and roenhat-.d for o(t t'lUVites at remit t-.mpetatnro' and me Jat-w we--. ied η» t. n\ isio.i mstrument t Perkin! dnroro Boston, \|.\t at I rnooeo.M 15.da wete processed and analyzed iw Pn?m iGtspltPad XoRw ov In, tor Veto m, B,we JDB> t.
Fig, 7A shows exemplary data obtained as described above using the It! !'.1P,P reeeptorex pressing ceil iiucMTB-IO for three antibodies -- .TfR, foHeand iF.I 1 Too data are plotted as pete-,.ntaee ove- . out-.ol f Pi K'”4 ns a luuction ofantmody « R b, I el 12 m | |'|{ j i owvenmttion, and are fiRed w oh stand rd nonhnaar regression curves to yield the B 5R \ Joes dhovoft. at the: bottom of the figure,
II Lack of antibody activity Is related receptors, t e'l-. spie-saig < ateu. leeey'o's BP till R ?fwv ,s cvptexson fo'Ri E '-R WB'2
D R Poyner, et al, Pharrntteo logs eat rev row, MJ55-5Ί0, ZOBJ, WI5ti I IO cells expressing hCkf R uRAktP?, f) Is Ffoyoer, ,1 u, Rhsrmji<5oi>ie,il tev>. w, - : ? Wm , ?R(P' s or human arov ir \M\tee,pk»t pvH I -; ecds p< IP,-hRxMPI AAei h r Iron, e'al, AR-eenlat phdtmneuios’y, 5? I B-dJ 175, ί Po~ I weie used to determine 'foe xeux tony of the tested anubod».- Phe Λ XI i-erpi'cs-mg I lb'lx 5Q1 eeli lute w-,s romera'icd as vlest rtbed in broample L alrow e 1 fro AAI? ,Λpre-sine ! GO eJl Rue w j- pureh.>-c»d from rureSereen <,oow
Pv'ilvinl hue?, ha and tiro human amyltn ΛΜΧ 5 ieseplvu-esprossu--, X1C! -7 <. eP luro (Zumnerroann et al. Journal of Endocrinology, 125-151, I RR'J, was obtained from the ATCG
ΒΓΓΒ-'Ή P\ mp-a y ;e,- Its pfott s', ts des, itbed .foov ,»e shown nt fwy· ~B ;b Wli-Bfk velht. ' *;h \M5-GB(»ecilsi and D (hAMY-MCI cells). Note that none of the tested
147
2016244220 11 Oct 2016 antibodies had significant inhibitory activity against b AM I, hAM2 or h AM V I receptors over the range tested.
Vw'k; ,'\p,”'pne its were υ -rn.?rm..A.t tt-ftn- re,on'b-n -an ΗΓΚ t elk expwxsimt eynomoietr- CGRP receptors and rat 1 6 cells expressing rat CGRP receptor »A 1( t3, Date.
> from these -indies, is wed as additional K e-0 j,ua -'bt,fined desentxd ip pen A of this
Esjtnple. ate shown in die ' cAMP” columns m Table I 5, below Note that the K'50 '·. aloes tgam-t the human md ..vue CGRP recephns .a; nt the wmonxslur mnge, wnvrets-utusfies agamst rid (.'GRP txn.eptm. and human AMI, ΛΜ2 and WIYI teeeptois. as well as MCE? cells expressing calcitonin tdate not shown s are all create? than I rmcrmnnkir, The difference in IC50 between human (. ifiRP receptor and human -ΆΙΙ, AM? wny ho ind i.ih itonin recento;s illnsbteas the Infos s„leet?wh of tne these antibodies {05 the (’. IRE r<c„ntor <».es relnted receptors formed, in part of fob anme receptor components, JCSO bhtahmd, «sing: bdmau and eyttomolg.ns ( GRE receptor.'·; wme similar, whesea- the tested imsibotbe.x did not appetu to cross· react with mt CORE receptor.
1.5 Table M
Clone | c.A.toP way | J -'i U'S.IV | |||||
hCGRF R If 50 fo.M) | Cyno CGRP R 1(75-9 fn\l} | Ifoi CGRP R K'5P uAD | hAmyhn I IC50 (nM i | St AMI K 50 inM't | KAM2 1C50 tnM) | ifinnan CGRP K.t iaM; | |
01 π i 1.2 | 1,77 | 2.79 | />1000 | >1000 | >1000 | >1000 | 0.030 |
one 2 | 3.27 | 4.74 | 1000 | >1000 | >1000 | >1000 | 0.079 |
02A10,I | I 1.81 | 17.6 | 1000 | >1000 | >1000 | >1000 | 0.291 |
02 b 7 2 | 6.30 | 5.51 | >1000 | >1000 | > 1000 | >1600 | 0,117 |
03A5.1 | 9.89 | 28,9 | >1000 | >1000 | >1000 | >1000 | 0,093 |
03B61 | 2.74 | >1000 | >1000 | >1000 | >1000 | 0,033 | |
08C8.2 | 0.66 | 5.32 | >1000 | >1000 | >1000 | >1000 | 0,044 |
OEtlh.2 | 10,84 | 10,0 | >1000 | >1000 | M000 | >1000 | 0,.11.1 |
04 R4 2 | 2.38 | 8:,52 | >1000 | >1.000 | >1000 | >1000 | 0,015 |
04116.1 | 3,78 | ' sO | >1000 | >1000 | >1000 | >1000 | 0,052 |
O5F5.1 | 4.79 | 4 X | >1000 | ' Ovo | >1000 | >1000 | 0.147 |
07/12.1 | 8,96 | >1000 | ' ooo | M00O | >1000 | 0,1 lo | |
0033 I | 10,2 | I 1 ' | >1000 | - non | >1000 | > 1000 | 0 127 |
ICE I 1 | 8381 | 10.5 | >1000 | '' 000 | >1000 | >1000 | 0,140 |
OSBI1.2 | 10,7 | 17.() | >1000 | -1 OOo | >1000 | >1000 | 0,118 |
148
2016244220 11 Oct 2016
09042 | i.4b | 2.46 | >1000 | >1000 | >1000 | >1000 | 0.023 |
09I7.2 | 3.06 | 4,44 | >1000 | >1000 | >1000 | >1000 | 0.043 |
I0E4.2 | 3,00 | 3.23 | >1000 | >1000 | >1000 | >1000 | 0.100 |
11Λ0.1 | 10. Γ | 477 | >1000 | >1000 | >1000 | >1.000 | 03.57 |
11 DILI | 4,93 | 375 | >1000 | >1000 | - 0500 | >1000 | 0.044 |
11B9J | 4.56 | 3,0? | >1000 | >1000 | >1000 | >1.000 | 0,0.57 |
1217 2 | 2 93 | 4,13 | '000 | >1,000 | --1000 | >1000 | 0.097 |
i 2Gs 2 | 2 14 | 2.74 | i >1000 | >1000 | >1000 | >1000 | 0.01? |
1300,2 | 03 | 117 | >1000 | >1000 | 1000 | >1000 | 0,055 |
1362,2 | IO | -19,2 | >1000 | >1000 | >1000 | >1000 | 0.12S |
1302,2 | I 95 | Ol | >1000 | >1000 | >4000 | >1000 | 0.033 |
3207 1G | 1.93 | >1000 | >1000 | >1000 |
EXAMPLE 5
ΒΆαιαπ<^^
BECEriORBLOCKiMLANTIBOjHES .5 ! Ί-labeied CGP.P tAntersifam Biosefetj. es, Piscataway, MJ) and ecll membranes bom ffTB»l 0 cells (PerkhvElnter Inc,, Walfh;am, Massaehnsetts) were used fe radioligand binding e\nefi«m m w the pi·, seixe of ν a sous , om entmtioos o' the ΐ.-χ- mmhtnb.'x to A, iej ,?nm the corresponding Ki values, The CORP tending assay was set up at room tenrperatnre.in 96-well plates etmtaeune, 1 05 p! htndtng Iwffe; < '9 m fi I'tx-i Η I, pIG 5, $ F m\) \b'M)4, tt * B\ \ iMgmat. I tablet oft omelet; fVI'50 ml butter ta protease inhuman!: 20 Hi test compound ί 10X0 20 td 'T-haCGRP ( Amersham Rkweiem'es', iPM t; and 50 td human m.-m'ohl<o-amt<i cd BUB 10) nxmbtms. \,>>ρ<ιΜ>η «;0'tc 'Xt we I Pctkwi ti ten I tx t'Satcx w„,e ex fi ,xed a; room temperature tor T hours with shaking at 60 rpru, and then the contents of each well were loieteti o\ ,a ON*, nob, · tm, \ neritwe tFldbtse end (to- ' hate -we hunt) Cd G no-w elf iPtef > t'latex 1 he CF ί' fiber pbtes were v t,\bed six times unit tee eted ?0 m.M 1 ns pH ' ? ,md dtx'ti m ,tn ο',ό at 55 V fot 1 h-m- { he bottoms ,o *h * td < pfatk* 1- weie then seated 4ί5 ,f Voetowntn*'' 20 wax added a- each wCi, tlx' topx ofthe f ih' ί plates were wadco h tth fopSeal xi-.\ pi pnss~on adhesive seating film}, ami itiv Cd' C plates woe eomued vvith I opt outti A \ I t Pmt.exB I he data wese mtalv/ed nxttm Pttem tGfapbPa.l SY'tw'ue hx 1
2,0 Eseu'pi.s-'y data nth Kt vfingx <Y Λ txd using nntUaxlnx 3Ch, G'lV a?xl :PG are x'mmtt ι η ϊ o’ S
149
2016244220 11 Oct 2016
The nghkmo-rt , churn in T dde i I above, lists the RI value-- of the indicated ntAbs tn the radiolabeled ' 'l-{ GRpeompURiottbinding ass.iv to 11IB-i0 cell rnembtr.ns's Ihedata de novt< te f tt the < 'GRP teeepio' antd'om s were It' >h'y . 00-0 ttttve 2 2' sab-waro’roG:
range) agam-t CGRP bind mg
EXAMPLE b £MSJHM>nsiASSWJt<M^
BiajCHSG ANTIBOMBS
I he allIt5: ties of nnt-i \iRP R nt Xb-s fie f '< IR P teccptor- r \ ge -, *-sed on 1 ells w e;e determined using a I ,VS method. BrtetB. A.,Xb1 v IR) htR'GPR R-espmsstng eeik, prepatud j- dt-v,, idbed -.t'ove, were plated ui 96-wed plates 0 densities v1' fc.000 of BOj'nlO u-;i- pet we;l nt GXILXi medium (.otitatnmg RX'-bBS. Si PS, L Glut, SGA'r .end 0 05% sodntm azide 1 GRP feoepuir ;otiibodses w’v-re titrated tn die suite ine-duno from ς0 tt\l to 1 pXI and tnenhated with -..elk Xfter <m ov e.mtght uxubulion at 4 Y nt y tt rial volume ot 120 pi, on a plate -h.-k/·, fix ejls were w tslxd ?\ wuh :>BS BS, eenfidfrarg tad chacerdtnu supernatant each time, 100 μI weli ofu unR~t Inlet 'y 5 < 5ng mi , Jackson JwftttvinoRcscareh I nbomtones 'me , XX e-f t it.ne, P-X, I S X1 com mme 'Λ XI) t >pl wen tw ts inm tdded and tnenhated ,tt T X fin R) m n i'be v'e:k wetc w tsh,-d 2S with PBS' ?%FBS, e,-mt iftsgntg and dtseardtng the supernatant each time. IRQ nl PBS 2'*-a-BS i'u tier was tlxu added and nuuk/ed by P \{’Rto defertrnnen die hm.img geomean, 'Fhr Re wa<-lahvGtv’d g-mi,- ΥΥΧ-Χ software: by taking the negative geomeaa at each antibody eoneoovhan as the amount of five Ab present RMhwaswamt ei aL Biochemical end A/eyZnwk'ciZ AeawreA OvtmftefimRePs 334 <20d5) 1004 BP ) Π-e data obtained at the fveo ddfeiu-t Cv R roue. mmRors were analy. < ,1 by n-.urve -maly-ds to determine the Rd and fix 95% runhdetXi, interval a< described m Ruhiaua.swami,; %?/., Bn.· hcmicct and Bioph^wi: R/'ceex h Ci momma acorn 334 {2005}
1004-1013.
Feempiai v ,t>na w nh t ottespoodiog ·, nn e ft's ov show n m log t0 for annl'oRy 12tY 2 1 h. vi oa o' /lek wlnYrng anttPe»if.- e.nemted m stmpett of dx pjesvot ib-e'gsuje are shown hi 131%, - 1 3 Ore of the antibodies t XBro was am-iy/ed or two dtllerenf days 1 he f mo 0' Γ’ o obt-aned tot trv. espetutsent w tttt 11>R <, elk mdseat-, ·- turn the anttpen tom emsamn is predicted an 0.0.X the Kd and hence the curve obtained by dt% eqxrimem ts a Kd <oruroiled curve It c..·,η be -eppteeiatvd that the Kd values obtain-,4 tn de-, in mner wem nt die low stngledmit uetxmtoiat mngefof dl k-a/d totdvdx?
2016244220 11 Oct 2016 η
N curve analysis | ||||
W) | Kd tnw | Kd High (uM) [ (.n.M) | % error | Ratio I OK | |
1H7 | 1.9 | 1.5 3 | :3,5 | 0-001 |
l· <2EA ' | 1.5 | 0,7' j 3.4 | 6 3 | 0,19 |
1 3B6 La) | 4.2 | U 1 '-2,7 | 5,3 | 0,060 |
; 38ft (bi | 2,0 | 1.6 | 2.6 | 3,2 | 0,21 |
| 4E4 | 1.3 | 0,.9 2.05 | 3.9 | 0,1 ft |
4H6 | 2.4 | 1.73 -1 5ft | 3,3 | 0,970 |
| 9D4 | 2.5 | 1.6 I 4.39 | 4,3 | 0,060 |
I 12E6 | 2.3 | R53 1 3,30 | 3,7 | 0.55 |
| 12G8 ; | 1.4 | n m 1 z> *?] *.λ:?.μ.· s 4a..d,.i :: | 3.6 | 0,94 |
uKP RECEP 1OR BEOCKESG
ΒΪΜ71Μ3 ΕΟΜΒΕΪΤΠΟΑ
8«.,eo:e . nlss<m, R e' al, ίίί.>/>«λΛ ί C ·>/ι/\η >\> V<. ?/?,',A <«'
6' Ή- BO t H04) e,,,?<* (atned «.«η· as follows In-mobth/ tbosi of nnb-CGRP teeeples antibod-cs to the < 'M5 senses chip -on face a a-- p.-tferned aeroi'tong te masnstocinsef h'sirnedons us>n$:a tonsso.iou<> Ocxx of i-tonM HE'PFS, si 1 ?\l \a( 1, 4 4ηΛ! EDVA, d to»?ι\.
Odd, nl 1 ? 4 (HBS-EP bullet t (.'at boss 1 vi'iMps on *he s;-n-,ni vhip surfaces w ere activated t\v istieetu-tg Λίι pi of a rns\ts,tA' eoreeniuy,1 o ? \1 \ entx-J \' ien'KtfxlaminorrooxiK«rbo<iier'de (1 IX ) and U O'~< \f Vhx «busy so-. eunnu ,ie g\t ISt Spot die mu e^e-· xxeseobtained by inteefinn MO μ! to anti-OGRE receptor tnobo-ly diluted in to mM acetate, nG 1 0 at s - o' s, uitatiu', to' kt t s u'f I s< ,ss 'M, t)\s p ears >,\ fe sedaes \ wets' xkae+'x^wt: I \ ntieeinit bd μΙ of I M ethanobamitu-, Fsu.d nniutodued lex els lords; suur dual ustobcdies w\re as ft «flews.
Antibody Rexoonncs I 'lists f RI; t
1119 to -5,900
Lift -7,200
4H6 --GO0O
151
2016244220 11 Oct 2016
PGb GfOO
9E5 6/.00
34B3 -3,700
A blank, mock-coupled reference surface w us also prepared on the sensor chip. Soluble 5 huCGR P receptor nt a -oncemmtion ol 1 OOnM was captured on sensor chips having one o! Ore sis'tmnobbi/ed at ubodtes fere'· med .GweGlD-i, BStgdpp, PGRofsot Gi 1,5 ( .<J ol the 20 test imtt-CGRF R antibodies was then injected over the captured huCG'RP receptor. If the injected antibody recogn.tzed a distiuei epitope relative to that recognized. by the immobtltzed. wonbody, a second binding: event would be observed. If the antibodi es tecogntee tire same or very zonular epitopes, only tbs' binding of the huCGRP r,reeptor would be observed.
Fsrenpnny data obtained nreng .1 -eusor ehm co tt- d w sth nntnobdized antibody arc damn ut Pre iJ 3 Tbs' bun daces an data, obi oued using until<odie- 11,1 I, dbd, 21 and 12Gb in the injected solunon IB cuts during ihe experiment are represented by letters, with ' V , re respondent V uu.i taut id link GPP R-I'e. 'B' , onespondutg to end id lbs ret. GkP Kbc osjecnou, C. corresoonumg to tntvemm of second mAb. and ’Ό' corresponding to end sreond m*b uipzt lion and s-are ol tbs' buffer wash Note dun there is no mdbatiosi of any binding stgttel frf'tri am of the uneeted antibody utt the immobilized antibody surface, redst anew that tbs' fore uue- red anuhodres ,·,ρρ.η zitoy se- οι nure tire same sir veiy suwskn epdopci re as the immobilized antibody. 1 srentieliv the same results were observed with ail tested blocking antibodies washed over esch the five tmmohtlued neutralizing antibody sUft.tees indicating that ad tested amv-luR GRP «cscptur btoeknigt antibodies recognize the otUUc or very reimiai and strongly overlappingepitotretsk hi corniest, as shown n- pare m Figs tog or and to), the low tested turn-blocking, ( GRP tctepiorspecto; auttoodtes 12HR GBe, 551-d and MIG faded to compete with I IP! I relap·, not shown), 3fh> ι fig GB), I 3Gk {fig toft and GFy (dat.·, not shown) although 5-11 ?< was able to coitspste with -IHo u ig toto and weakly with GIG (data not show id, 521 lb laded to souipote woh 3p,o,dB:P, Pus, to 5 ,κ the non duo. k mg anybody s.'d's g,lt ν<β> 5ϋ'4 uinhl compete w uh die non-blocking antibody Mb. 1 1 he data tor ail blocking and non30 blocking anuhodres arc sntmn ndztd hi fable 13, below \B'! indicates no modmg' indicates significant binding, and ' Weak null, ate- weak binding
152
2016244220 11 Oct 2016
Table 13
hunanbilOed Antibodies | ||||||
\b In SobOfon | non | 306 | 4H6 | no | 9E5 | 34E3 |
ΙΕΠ | MB | MB | MB | MB | MB | |
m? | MB | MB | MB | MB | MB | A....... |
2E7 | MB | MB | MB | MB | MB | -M - |
3R6 | MB | MB | MB | MB | MB | Η· ; |
3C3 | MB | MB | MB | MB | MB | ··:· |
4E4 | MB | MB | MB | MB | MB | < ·? |
4H6 | MB | MB | MB: | MB | MB | MB |
SFS | MB | MB | MB | MB | MB | A |
904 | MB | MB | MB | MB | MB | A |
W5 | MB | MB | MB | MB | MB | A |
W E4 | MB | MB | MB | MB | MB | A |
11011 | MB | : MB | MB | MB | MB | |
1109 | MB | MB | MB | MB | MB | A : |
i® | MB | MB | MB | MB | NB | A |
ncs | MB | MB | MB | MB | MB | A: |
1302 | MB | MB | MB | MB | NB | ;:.y: : Λ Λ |
32.07 | MB | MB | MB | mb | NB | Weak |
5208 | w’f | : *r :< | Ύ | 'V | 1' | e |
33BS | A ..... | a- | (Η' | 4' | NB | |
35E4 | M-y | ..,., y | -j- ...... i | B-: : | e | MB |
As can ne apoteentted from the data, ,«h thg ?>>wd hloefonu or ncnttithrtng autibodis's bind to the same region as the fixe imtnobtifA'd blos'king antsbodn.s. ι e , nil ni the tested iteuitah/itte antibodies fond du same reeion of ihe t GRP K moieenL Gn theolbet hand me non-blocking antibodies dnl not generdly compete w nh ihe immobilized bkn f mg embodies, indicating that die non-blocking antibodies pttmariM fond a different region of ( GKP K,
EMAMOTES
RECEPTOR IN WES I ERA BLOT thiee ivpivM-utidoel GRPieeepti»? blocking antibodies were tested using Western foot* bn fondim; io a soluble CGRP iceci'tin-Ord'e lusto'· piotem
153
2016244220 11 Oct 2016
RfOn u p ifoi’Ui'TR-f t!i\ ip vj.e, jtu mu k> ι-d,- tl,d w ο .K ( GRd* R-hnK e-e<„p* the m-*u-c le wa- us-.d and the linker between RAMRI or ('Rl R K’D are r td e w.o hrf'; tt to AAAA Α)\ IXAA AA»\ (SI Q ID \<> * 151) w.-- dibit d tr PR's with PAi IP -ample buffot wnh (red-te-di or wtthom snonweduced) Fcia-mereuploettumo!
r|AII t nt 15,5% vOiweniTiision, The -uranic connraitng pMF was then Aided fo? 4 tnin Re hte\i are mr~>.ou,e 1 wavde- w ra'o.i, doislo-. lawth 4~?ο’, h--~gRe te e,— (feviirogen) with alteraattng bites of CGRP R-Fe protein and wolecelhr weight raorirars i luxitrogeu; GM- wete eieehobloked onm O.Mou nmoeeikdo-e whet- (kwiitogen) Ί heblots wer».u-h-d w tlis 1 rfs-hutfored -aura. < Ph- I ween 2R r i RS 1t and then Flocked with CBS I <
t(? 5A> pow emd dry milk for ?0irmi The Idol- were >.td rate strip*- along hu- mofoetnaf xeendn market fonc-, Otic Http each wnh seduced atid n<>n-reduced ( GRR R-mul'e wete incubated ν,ιιηριηιϋ dhuC'GRR R .tntfkt. he- B : Oj v v5 iffora -pp M-mon n s'BSi - '% red-t, goat jiUt-huRAYlRi X-20 ί1:.500: Santa Crtrz Bmtcenuoioex, ute). rabbit anif-nitmse kAs-T-..f IRR 11 :0.000 s tRietee ( or gout eras human IgC 1 :- e 1 t R R 11' 1R 000) Rieiw ι Blots w ere itunkaled xsd.-i the ankbodie- for one note followed lw G Imran w >,-he- wdb Ί BM 1 * milk. The blots treated w tilt the kuf GR P R anttbod'-es w ere then incubated w kh goat anti mouse IgG-Fc-HRP {1 -10.000 in TEST - 1Ά milk) trad die blots treated w 1th anii-titsRAMP 1 <\-2u anti-RAMRl ,„<.iat poRebmat MttiFodx. Aetna Cwt/ Biotech, ( \t wer: nuulsded with rabbit md-goat kA'fofo-i iRp $ | 10,000! for dOsntn Bit ft- were washed e\ i cmin with IRST
2(i I lie hfo'GRR R Mid anlt-ht-R AMRt uuitbodx blots were treated with Ihetec Xupc rsigmd (Vest Iheo Defouion r/aeent a-td th; -etri mouse and anti human IgG 1 e BRR Mots were treated wski ihete-. -tamtam Draw imp Reuueul t ί tutu s Blot- w cm uic, ,-xpe-ed wnh Rod ,.- fFomaMw S r,e, film .All of the tluec (GRR reecplot tuinkodtc-. 4R4, 01 and IBP were aide to detect the soluble CGRR IGrauFe {corsiamtug RAMRI-I CD ano 1 Rl R l-('D) undet non-redueed condition Fid not trader reduced condition indit .niim that die k-irsdim; epdope ofthe-w: CGRP R antjhodte- wt-„- etralorms.tional and -cu-itwe to the di-tdfide linkage- t * pan'- m RAMRI -1-( D and * pub's in ( Rl R A-;?- F'CD? In cooti'a-t, foe conanew rd ,rao-R AMR! nmbodx \-?0 tMma i'rue Ben-1 hi hout.u R AMR1 uneet Fob seduced and no seduc-d eo-'-draon- mem .utne that the binding site for N-20 antibody wa,- primarily linear and not sensitive to dfotdiide Imkaggs,
2016244220 11 Oct 2016
EXAMPLE 9
........ iiss»
CGRF receptors fonrto of either «.tin e RAMFI with chimeric CRLR, or native CR'LR p w ith x him, rie R-\ ΜΗ I, w e«e used to ukntslN ('GRP r.veptor sequences m\ oh cd in antibody binding S nee ail of the human i'( iRP r-eecntos blocking antibodies tested faded to show funettondl activity to ihe rat (' < «RF receptor, the chimeric components contained regions of rat won-, nt e in a hnnam sequen.e ba. k.uooad Hu- mihux me ,?hnneias sxeie yen-, rated h« biudiw .«naosis !w f ACv
RAMP? dmacmM tQ2f m AM); SEQ.ID NOG ?7 \;nmo aem i .-odne- Q2h to AeI m tee naroan Is k x’Fi weie senkved w ito the corresponding sequence* * from ia« RAMP! ibis siren h included ihe amino at id residue,* that are different between human and rat RAMP!
RA>nQjdfGeiaKjQj32ql?MMIdli[LNQ?B
Amino acid residues ()4.4 to 1:)5.4 in the.human R \MP' wow replaesd with..the co-· espeudve seqcerbv* (asm mt RAMPI 1 nts stwkb included m\ ammo ’ctd wsidves tn it are ddieiem Veto - en huoi.-n and iat R AMP i
Antuiii ae«d revalues Rn’’ to Ev m the human R V4Pi were w-pbeed xsuh the cc-· responding sequences from mt RAOsIPI this stretch nteluded seven ammo acid residues that are ddferetn between human and rat RA.MFE £ΈΙ:Ε.Χ!ΐη)ηΜ?.1..ίΙ24. to.Qgei.SEQjQ.Ntt.r,)
Ammo acid residue* ϊ 2 ; to Qee so die human (.RtR we«e replaced with «faun Ospon.lnuj sequences saim mt ( Ri R i'bis stmo b mein,led e-yin .onnto ae-d re«siGe·' th.u are differed between humas and: mt CRL-R,
Fig 11 show* an uhgnmef ot P.AMPi ammo .a-nj sequene-,κ horn ,ynowvlgu* monks iS|,Q iQ NO 21?--). human iSLQ iD NO It, »at tbi-Q ID NO 2 ί It and, ihems monkes <M Q ID NO ?'bt, foo>'the witn * i.q ” -, e* o-'R WIP1 Dime , * {M Q ID NO 21 'a *2 tM'O ID NOGIN) mid rirmc λ {SEQ IO NO 2bb $ -g* 12 \ and 121$ -h-wx an alignment of CP.LP. amino aekl -,..-qwm<e* from human (SEQ ID NOG), eynornolgus monkey iSl Q ID NO 22 ί), fm-ws monkes (SI Q ID NO 223), i«i uM O ID NO 220) οι I, as well as th-, amino m.d ,*equenec of € RI R dinners - I tSEQ ID \OG23)
2° Dei red* \*c-e imjistendy m-jisfected, wdb CORP Ruhimera DN \ constructs 0 Ri R wi · RAMP) Q2S-A5-I f RI R sxt RAMP) Q-Q-105. ( RI R xst < RAMPl Ro%
155
2016244220 11 Oct 2016
Γ'ΧΡΡΙ R I 24 Q.fo E AMP wt, GE! E - RAMRi -.ο^Π,Μιχίο· ,οΜπ,Ι) 1 elkwere harvested after 72hr, washed with BBS · 0.5% BSA. and emimed Each iramdected ceil line wa- resuspended m a -jilttdon of % Id' xelk pet t)0u.l ΡβΑ'!Ρχ A ί 0(tu 1 of evil snspetw.on was ahquot pet w dt m a ‘ M- welt e'end bottom plate d e.Icoui fhe eetk were pelleted at r< t ?oprpm fo? > nun fhe set’s.πι,η,ον s a-> r -moved and reelaeed w oh tOPgl conbindnu 0 Mie pm died hut '< ,RP R mini'odies IIP, J,. Bto. df5, 41fo, 12(-8, EX ItiU, 111)1!, GDS, m 3385, Control wells were treated with sutbDMR htflgG* (O.SttgX Alexa64?-€GRP peptide < O.dug). or PBS BSA alone, ( ells wetu mt ubatc-1 on see lot 1 ht and then '-wished tw ,et. svnh PBS BS w iheeeik wen. iesu-pended -n lOOul well PBS BSA eoinanijiq. antt-hng-Hd IK {Oxtgt te\e·..pt tor \Ιο\>Μ-ΓΒ GRP ir, afed , elk) t ell·; were hieth.noed on ice in the dark for thr and ih-.ts wu-hed twue with PB\ BS \ ( ell- wetc resuspended in 200ul PBS BSA and ui.tlyeed nsmg n !- AC'S Caitbur lee tepies.mtatke koekfug am-t'-ebes t 'Be, 'P A 4Ih>, :2G\ E s, 10P4, 12! 17. 4R4.
11D11 and 1H ' ι and two non block mp antibody < 3 2! lb and 3385? w er,- toatod. Representative to d ,'a A*R5 antibody'> a.ta shown m Py- 1 t\ PB e d 1 E Gg P \-hew s tinstinn io foe w ltd-type ('GRP receptor big !5B show binding te- ('GR!1 receptors cm training the ( EL R 1 2 t-oB - toiler -, -et 1 ('- let show ‘m df\ to ( ¢. 4'P '-a e?s>'x commi'me die P AtoPi Q2X A3 5 chnnern. I iu P \Cs anal'- sis showed, that ail 12 antibodies bate w it-d ivpr human CGE.P i’-eeeptin - owti'td .--s espe, led Alt ;2 antibodies showed sigmftejntiy reditee-d binding its an> oi the tntee R \MP t chimera R AM Pt iQ2S AMb-tQ-Dd tot and (Rn“ tG'Si fins eould ι.χ',ιΐί from ί 11 the expression lev el of the ehnnera meeptor was much tow ·;?1 the RA MPI chimera impair <d ttts' folding with human CR! R mid idi-md the . onformuPon of die receptor eomptes, and or (.MOkwc three sek\fed regions on R \MPt arc dhwfo- invoked In the binding of these antibodies to CGRP ieecrna·.
(Vlut) me 1A< 'S iiacftsg wso. can. 31-' include t-nlv the '- er- -ιη-ιΐΐ 'espres-nig ' cct I populations, the nonfotockhtg antibodies 55B7 and 321 ?b nppe.neti to -otwuweidty bind less well dower Geo ''-leans'* η- the RAMP1 <Me 1 53 elnm-.r ι e-s u-mpmed to the Plot,I? toy antibodies, suggesting h-ud-ng to Me RAMP: ().ρ,.Γ'Μ teg mt may be more nnpoii-mt fin- the non-etoeking antibodies t tn ihe et het h.-.nd, 1 »B5 and 12! IS eonoBfeutly hound hotter to the ed R (Mpf Rn' PM dtimem th tn tp bfoei-omanttlv-dic% stingcstuto the P.AMPI Rp *' I 'd xeipwia e nay- be mote fittpo: tout hu th-c bio-, l-oun antitto-.h-. *AH Cl iRP re·,eptor antibodies tested bound reasonably wdi to the G'RIE ohntoertt tL24-Q.Gi. suggesting this site is not essential tb’ binding of blocking .ifitibodR--.
156
2016244220 11 Oct 2016
In \-uumsry, the data Mow ihai three dRemdinoous regions nn RAMPi — (QGR-AT!). (G-G P53) and iBM-l-'·;) -- could he invoked m ('GRP reeaptot antibody bmehov, with (Po -f Mi mete unpo1 tent G''he bio, Amp uot'bo.oes The N-ν 'm'n.d - <;U-u ,w il ? MUG of CPU P, did not appeat to hecrutetriR invoked in binding fot the CGRP teeeptm antibodies as analyzed by this method This approach dees net rule out additional binding site- that share uliuitteji ei sm-das sequences hetxv et- hnmei .e-d hit CGRP leeepiotx winch w en not tasgeud hi the analysts,
.....
Kt NEUTRALIZING ANTIBODIES BA’ PROTEASE. PROTECTION ASSAY
The CRLR portion in the mature fern of the CRER-Fe fusion molecule (with signal peptide removed; disclosed he-mni as SPQ if) NG; iOi contains 1 Κ» amino acids iprecednig the gRemc hnhc*) and has th-ce hire- loop sUuet-ues t icarttl bv unmanon of uuee disulfide bonds 1 ne three dtrtriodc bonds in CRLR ere <. yU at -equzncv poshing > tali ('PI P
1A sequence ρο’-Ριοη- iisied n- ba- pumvtaph 'ee vit ! icspeet m ttie ntutuie sequence piesetned us SEQ ||) NO: 10} linked to Cys3 at sequence position 52 {referred to as f Ri. R ( I -Of Cys2 -u see's'tsi, e p-'siuon-P Hiked m r yM at x. qu m-e ροοοοπ M iiet'e-vd to.isCRl kf?-( Ά Cys-1 td sequence position oo linked to Cysb at sequence position i(G treieoed to us CR1.R C-f ('pt RAMP I pom,so us m,diuv foo.i ,n RAMP’4 e 'h-uut melceuh' eoutumx B muno acid- tSl-0 ll> NO' 111 preceding the glycine linker, winch also forms three iniosmrdeenlur disulfide bends 1 Its' three dfrrriode oond- in R M1P; am Cm I -d sequence position t ml; RAMP! sequence portions listed m tins pamgtaph a-e w-th lespeef to the mature sequemx nrmented ts SbO ID NG t ihus/d to Cys? tt s.,git nee pqsmm< ?o p'efet'ted to o R MV·*!
C MU, < vs2 ,U sequence position 14 linked to < >\4 at sequence nosUion 4ο uefened to ,is
RAMPI < MA Ό (Me ,n scquens'e postlton e t hnke<l to<Mo ut sequence po-dtou Ά (reietn ri to a- P, AMP! Ce-T M
Reetonsof the human ( gRP receptor pmtvtn b<'und by utttt-f'GRR oenuahrmg mminclonu' embodies were GeruttL-d by hupmeunnuh ( gRP R ;mo p.-phdes wuh speed'sc piotea-es, and ric-'crmmhig the sequence of tbv lesuh-ng 9 CGRP R peptides ft c , both dtsui'dde and not· ih-erind?-tom«ining pepbds' fragments for CR1 R .ad R AMP? pomens! A ptotease ήτοι-, emm a-say was tiwn performed to dete-mme the pioieobrtie dige-hon of h( GRP
R to the presence of binding monoclonal antibodies. The, general prtuetplc of rids assay is that
Of* dnig of a tu.\b t'o t. < IRP R i ao lesuh m 'piotci don ot , ettum sp.-erin proiea-e eieu', ay. site2016244220 11 Oct 2016 <tnd dos mtofmrorors can be used h, deuronroc the i croon or porta m oi CORP R when- the nt \h binds to,
R.tefh, I pepude ebgesis wcie v bjeroeo fo HP! C n...rfo<le mappmg, t , π,ΡχΜη d peaks w, etc collected, and the peptides nknhrtcd and mapped by on-ltnc ekctro<iprav ionicittion I( -Mb PSI ί f MSt muly-,es and or by N -torminai sequencing ΛII HP!. C anal-s', *- fo; these studies wetc pm-boned nsme ,·. natron Irosc tcsCfs'e-pbeec t 'IS eoiuntn td 1 ntm rod, ’< 15 cot length; Xortros 1Q0SB. ? urn, Agtk-nt leehnoiogiest for iiff line analysis and irorog a -..apdlen iexesse phase Cl* column (Iffrom t.d. s 25 esu Yydav CIS MS, 5 aim The Sepasairost Group* feu 1 i -MS HPLG peptide map-pure ’va< performed xx ith a Itoem· gradient
Ip Horn 0 05'*, u.Hoorn -,>, ei,e amp <pssron>, phase X'· to 'M! < <-.eero’uitti>,' ut ts 0ςΉ if rbioroaeeiic aetd t oluntns xxer„ developed oxer °0 minutes ai ,-, flow sate of 0 25 nil mm for nanoxx bore HP11 lerxdf-upeoi osoifu 1 y-MS aralysvs and 0 OlP ml mm bm t aptllatx HPH for online 1 t -MS .niafxses
Mature iorm human f HRP R w<gs digested xx ;tb Mp\ (which elea-es tiler tsgarttc
1.5 acid and some glutamic add residues at die amino end) by incubating about .100 g.g of GGR.P b' a ΐ I 0 nm nb in 0 1M sodium phosphate tpH 6 e > for ,b· hrs at 3 Z 3' with ? qg <7 AspX
HPI ί ehi-'-ntatogrecl'o.' of Pro \spS digests generated a peptide prolde »>-> -,hex' n in I tg M ;cich sample >C!ug injecteds. eluent utoemro labeled Ά fo; HGRP R alnm {concentration i mg'ntl 5, wt-foe a ooufrol digestrot xx tilt.-- surular amount of < Xakb R i’0 neuifnb/ing arohbodx, clone 1 ?t sf, ,-drox' s that the antibody, ro ese-nn illy testsurot to Ύ·ρ\ cneoptokmusv. tdeoniutoin nn fobcicd H; PajRF Ifoautibodx race, 100 2. I Oil ?,
100:20,xx'elght bx weight, respectively? Sequent e analyses χχ·,ην eonduek-χΐ by on-nne I t Mb MS and Px I dinar: sequencing on the peptide peaks teeoseted from HP! t Ou-hne PS!
I C MS eegRys^s of the p„pm!c faces! were p^rfotm-O to dete-mme the precise mas,- wd segU'.nt a ot the pvphdes th U w etc sep;,· eed by 111Ί C 1'he identities of seset d pepnd-, pro,cm tn the peptide pmfe from the \sp\ dive «lion were thus determined Hndix.tud us rounbew d peaks ,n fog I -H 1 able 14, below , shows -he foeaiions of the-ro peptidx’s-, quf· ru es nt the eerie spending component o: 'Rl R or k \ Mb 11 of me .hC.X.,R.P R, A capital lette: ( lb'lox'.ed bx c numoe: or \ '/p;, s >m- a peptide fj, rhib d as a CP 1 P perm-le, >i ,apo< 1 texfet R ex) follow („d be a unrobe? or X a RA.Mbi peptide and H e' represents the lat ue, undigested 1 e fragment released from the CRLR-Fc and RAMP 1 -be feion meleeulo;
158
Table H
2016244220 11 Oct 2016
CR LR and RAMFt oepiidef identified .fey peptide 'mapping of CGRP K AspH digefokm | ||||
Peptide | Seq nonce DButlide (#> location | Intact mas- | Origin | |
(.4 | h! 11A 122 | 0 | 1(359 | CRLR |
a | D5.GA58 | 0 | 670 | CRLR |
C5 | □55-505 | O | 880 | CRLR |
C4 | DOXQ71 | Q | 571 | CR I. R |
C5 | D55-P6?.· 080043:10 | n d. | CRLR | |
C6 | D8~Y74 | 0 | 19A | CRLR |
C7 | E25-O32/D48A54 | 1 | 3955 | CRLR |
CA | 3 | tut. | CRLR | |
Rl | 052- \44 | 0 | 3622 | R AllO |
R2 | L 12~A ?.P D4S-,X51 | 3 | 1939 | RAMPS |
P-X | G3-RB6 | 1 | 113049 | RAMSO |
S:c | 2(i$t)0 | RAMRCCRLR |
rig, 15 shews u comparison oi an A-pX digestion experiment teach sample SOgg noeeh,-J) with < GEL* R «lone oJ:nmiaiogruw labeled A) w?ih one pe:lbim-.-d in du. ptesc^ee of neuh'aSt/uw anttfoxl- 12( If iehtowaingiam Libeled B) I Ik v> eight raito id'OGRP R antibuds wa- 1 ! $>, \eiid peek- ;C\ ( t\ ntd CM -ho'- a de- teased -n peak lienda o thtrnna ogiaru B reBti-c to eitrematogiam \, white too edict p>„,ik»(i\\ eno P. ?<*> shew co sncieas. at peak height ai ehretnatnginni B wlanse to -'hainiaiesmam A A similar peptide snap piste,-η: -να- also obs.av ed d a different lieidruL.-iitg antj-C GRP E antibody 11 Ot 4, /Be, .<< h m 4s 4} ,-j a ed similar qa met- tea- pre-ent ut the dfge-hen sample as seen m the chroma ingmot labeled C Both t b ..aid C7 ate tb-nlisde Snd-ed neplfd- - whis'h . ev et a m yo: petiton ot the ( Ri R •ntaSeeu!'· whiteC5 ts a 1 'PIP non ds-ullide -omamune peptide residing .it fhe X terminal end oi the oioOeuk and e petnu lunate io the disulfide pi glide, P. ak < A contain- thi.-e CRl R disulfide bonds w uh multiple sCdtienees, indicating at least two io three peptides are hrtl-ed
I59
2016244220 11 Oct 2016 rogribet by dretutfdo bonds. i'be hut fh<« peak CA ba*; increased peak height nt a CreRP P digest re tire- presence of ('GRF neurreih/tog anttbedy nviudtes that the mtbbods has protected ί GRP k'tout \sp\ In *»Ροη at *< \etri Gee,a< e s<, w η .me-GsCmt I \*ps I antibody dees net appear to hate a xtgntttmnit piokstixe cffec* on A-tpe * and Asp?2 as peak intensity for peptides € 3 and f '4 did nm de*reuse at all fbereiore the antibody appears to bind io a region of ( R( R w Inch includes tire CRLR Cl ~C5 and ( Rl R ί 4-C'Oibstdlide region together with fire loop region between Gy see and <.\s66, the Asp.\ mapping of h( reRP P also -deuttfied « R WIRI dretdf-de peptide (R2) and a RAMPi non-disit’fide pep-trie tRG (see tank id and I n. id) in the presence of any of the above-mentioned tree Ma I:,η n<; antibodies 112GN Idl'd, 4b'4s 5Rp os 5( S n peptide R A rests t ex erected at a -sgmfu-antb, htgbet pcA retenstiy than rebat reas obtained horn the ibee-roon with no antibody in the sample. Mass and seqnefine analysesshowed that R.-x contains a stogie poly peptide ebam eot responding to tire RAMPI seemenee between Cyst and Argbo. These xApcrimengs indie ito dre! CGRP R n/ntralreing antibody can pm-met a significant region of
1.5 RAMP I from A*-pN prcteolytu digestion ϊ o assess w hetoer fire protective effeet of ί l iRP R Vp\ mvieoly sis ,-reetoe io
CORF Rote «Rabat ng (blocking) soRhodteMkR coin pared redid and-CGRiP R nouAiGtoreTiGng arttood e-k an \xp\ dre'et-ore- o* t GRP R was pereowned re tou re'ere-me et an untelated - otitrrti ntnnoeknnd antibody winch does not nentutiox-1 'GRP R at to hre The resulre ,ne
2(1 shown in fig. 15 in chromatogram D. fhe non-neuiodizing antibody (does not show any srenme.mt blocking effere sin (ASPR R As»A preteoAsts, indeed the peptide reap preftR f, hrematogrenn ft s re neatly rodretineroxhal-ro m the teles ant aspects m the ptoble det r, ,-4 Here digs store off GRP R «'.one Anrom,noeram A'
The proteolyses protection effect reus dependent on the eonecntration added to fhe digestion sample, As seen nt f to. 16, a fixed CGRP R quantify in the sample :1OOng) with rent -,He nnonnis ot ann-CGRP R neutralizing antibody »l'-i R GPP R'untibody ratio tn rnterogrttnts, 100.2; lObre; 100:20,weight by weight, respectively '> was performed tor Aspen pml.-oRs-s Tn<- preUeenou ptofde can be Greened and toe prole- tto'·» re tuit:ho4y co i: ee n fra t i o- t-depei i de- ti.
Taken together, these dare demoftstrate that blocking or nereruHGng anti-C GRP R antreodu th'-. breed hetero ran Go-G*. f'GRP R son both CRT R and R WIFI corepoueres} Ootn AspN proteolysis, suggesting that the hkukinv anti bodies bind to both CRLR and RAMFI whew M- 'CartfooL ·, koto, m to. ( GRP ret epto-- froth, tribe inor,, t-roi. to.-et ts.mitoous160
2016244220 11 Oct 2016 ϊ on- etomtiuh dependeiU These resuhs dsoindK.it mh-a'CGRP R neetmlDmg .mhboibes bind h« common reweiis on hn-tna's C'GIsR R which me Uix the As? \ clem-age -he....... SOlJb ίΜΜίικ
Ci me i set u , R-a-a Lbie antibodies directed aeamst one oi theothet sotnponein<R AMPI or i 'R i R ί ei the htanmt CGRP rxeptnr wem serwned m the ('GRP receptor mediated -, AMP a-say using I fTB-li) eeiC as described w Fsantpie 4, atowc. te determine wbethet tits' amd-ndie- had btotog-eA ton tty, ; he dm.-, ate pse-ented et i able J 5, toJow ϊ he aphbodies Had either no Octet tahC f'ND'd, very we A t AAV't or w eah ι'ΑΑ’Ί i'ltdegn at aide be e\ era concentration I'anee where the exentphuv antd-t’dfes dts<Jo-a cl herent had stiom,· bi ologt eat -activity.
Tti hie 15 ( -mmiv tv iaby -a\ adaPto atoihede net- - itv
Name | Source | ot epitope | Vendor | HI BAR aettollv |
CRLR anhhedy I 'th 18164 5 | Rahhh. polyclonal Ab | \~teia- -η,,! I t, f) nt h( Is! Is | Abewn toe , Cambridge. MA | ND |
CAlCRi antibody | Rabbit pobelonni \b | N-tcrminnl PCD ofhCRi.R | (ienY> ay Biotech, toe,, San Diego, ( A | NS.) |
CRT R i M- i $} | Goat·'polyclonal Ab | epoch-,, mapping near terminus ofhCRLR | Santo Cruz Biotech | yw |
CRLR (H-42) | Rabbb polyclonal Ab | a«2.G64 of ItCRLR | Santo Com Biotech | ND |
CAI..CR1. .Antibody (A01) | Mouse poly etonal Ah | mC5-!33 of hCRIJ? | A o\ us Biologicals, toe. | vw |
RAM PI (N'6 20} | Goat polyclonal Ab | epochs mapping at AWcmbnns of hCRl. R | Santa t ni? Biotech | NO |
RAMP1 Antibody | Mouse polyclonal Ab | mA 7-118 of hRAMP) | town- Binh<gjeals, | i : w. |
16!
2016244220 11 Oct 2016
(MO!) | Inc., Littleton, CO | ||||
RAMP) An- foody {I h 11 | Mouse monoclonal Ab | aa.fel If hRAMP) | of | Nov ax RioiogteaN, hie | NO |
RAMP1 antibody (abb? 15.1) | Mouse poh,.Iona! \h | foil length hRAMPi | of | Abeam, )no. | W |
LAMP! (Π,~ 148), | Rabbit polyclonal Ab· | ft·)! hRAMPi | length | Santa Cruz Lsetech, Santa Cm/.. CA | NO |
2-4\iff cells wete tnfseted pet eella plug Uatcgra I ftiebeieoves Co , RUinsboro. \b
Coha plugs wc?e embedded m 0( Ϊ medium {Sekuta PineiM kb.'., Torrinti e. C Iro/eu at Ji'C and ui! into 20 μηι sections esnw a ervostat Sections were lived wuh 4C pnralbit'ttaidehydc for I hoar at room temperature HCI) and subsequently washed m phosphatcOuleieti salute «vPI>S* Fadvg mons p-iw.d.ixe wa<- bloeke I wtib 7', Ο O Piis lot ί' nan and vcuehs were incubated nt blocking «nbittou (PHO with fe norrn.h gnat scrum foeeu.r Labs, Surhngarne, CA) and 0,3¾ triton XMOQ) for ) boar, Subsequently, sections were na abated nt human auit-t. ORR ie>. uptot p*tntar, am.isxc fo2)i”,iO}’ - 0.....1 i.ig tin} at. 4' ( nv,r night, washed hi RBS anti incubated m seenndaty antibody ibiottio kned go.it snh-hurnan tgC hv tmgmvjtr, t Sf-fo Jackson hnmui'ior.weeri.h, -eoifowe, P-M ft< fe notmO eo.e semm PBS fo for i bon: at R) hnmnaoreaeti.ity was amplified using die Vector Fhte Re aeeoobng n? the inanufaetnrer's instruct ions i Vector Labs, Burlingame, (At and stamina was de’, efopen using hVM^'-nnebe''1 ^dme-mi. kei <e ebounogen (Sigmafeidn· b fo. Louts, MO) Semiona wmv Ceased with feem. and ee.et slipped with Ret mount (l-'tslter Chesrufes i so lawn, Nj'., linmunoreaettvity was analyzed using a Nikon P-AQQ microscope util issou.it>. d software feikon. Melville, A λ ,
Beta front cells ,,-spressmt. dtherent iCveptor ><otn?onmix Os identified befool usme at obe.h, Oil a.s devo led above esc,led presm me co statute fet I Ifo ia.,L ..xptess ay recombinant human CGRP rerepter (CKLRs-B AMP I; CHCCGRP R cells} ,«nd weakes Ousnusg ol SR~N~\1C cells that endogenouh, express t'GRp iceeptots {,|ne to much lowet
LA
2016244220 11 Oct 2016 ’t.no ie'-sUv ΐ \o sta m S ύό·Κ m\) life's, t'JIO t Γ'u e srraxs'ro;
an unrelated recombinant piotero ίΊΕΡΜΜ (iRH'GKP R eeife attet prea bviuptiot, wuii foe era responding 3?dl antigen, GIO cell·: expressing seenntbrnani human ulreitonieduiiin mec'fo-' 2 C R! R ΕΜΙΡΗ. WI ’ wis eud<acno„d' espros.ma a n> an racemes. HI k cells exprcscing iceofobincnt human adrenomedulbu. receptor 1 (CMJMRAMPd), or the p e> m HI k .eh* fhe d tra from these expeomems ,-, e sonets,,? rove, m I Cide Its helms Table Ib Imrouuohtstochcmic»! sfetnlug intensity of indicated cells
Cell line | Staining intensity (vUoal scare) |
lGRPCHO | •Ή |
kfek-MC | C |
CHG | 0 |
TRPMfeCHO | e |
CGRP 'CHO pmndsorbed | 0 |
am:oho | 6 |
MCI·'-? | 0 |
Mil Hhk | 0 |
BEK |
Mi patents and other publications identified are exprosslv met epos ated hetent bx
I 0 mdet'enee for the purpose o{ dascnbtng end draeiosmg, tor example, the methodologies deset’K-tl tn such pnbikxufons that nnijbi be iraed in cm meet ton with the safeero matter disclosed herein 1 hcsc pubbrauems .tra- prox ided c-olefe for then' d'-selosura’ prior to the fdmg dine of foe pteseut eppb.aften kotitme in do* ι.-gatd should be construed as an adinm-On that the no eiders ate no? entdied to antedate sneli dtselosnic by onia. of prim' iro foiion o; fo? am f ' fora i season Al5 s'' 'Cements <n io ?H Can, o< ; p> ’xentano-i a* io fo e-um-ut* of these document* ts based .'tt the foira'idatson available to the applicants ami doe* .not constitute any a, n *sot >ts g> i e toio. messo fo. d a*o ,omef m Irast o<,i in it*
I be
2016244220 16 Dec 2016
Claims (17)
1. A recombinant antibody that specifically binds to human calcitonin gene-related peptide (CGRP) receptor comprising a heavy chain and a light chain, wherein the antibody is isolated from a host cell that expresses a heavy chain nucleic acid comprising a sequence selected from SEQ. ID NOs: 242-258 and a light chain nucleic acid comprising a sequence selected from SEQ ID NOs: 224-241.
2. The recombinant antibody of claim 1, wherein the host cell secretes the antibody and the antibody is isolated from the culture medium of the host cell.
3. The recombinant antibody of claim 1 or claim 2, wherein:
(a) the heavy chain nucleic acid comprises the sequence of SEQ ID NO: 244 and the light chain nucleic acid comprises the sequence of SEQ ID NO: 226;
(b) the heavy chain nucleic acid comprises the sequence of SEQ ID NO: 257 and the light chain nucleic acid comprises the sequence of SEQ ID NO: 239;
(c) the heavy chain nucleic acid comprises the sequence of SEQ ID NO: 248 and the light chain nucleic acid comprises the sequence of SEQ ID NO: 230;
(d) the heavy chain nucleic acid comprises the sequence of SEQ ID NO: 246 and the light chain nucleic acid comprises the sequence of SEQ ID NO: 228;
(e) the heavy chain nucleic acid comprises the sequence of SEQ ID NO: 249 and the light chain nucleic acid comprises the sequence of SEQ ID NO: 231;
(f) the heavy chain nucleic acid comprises the sequence of SEQ ID NO: 255 and the light chain nucleic acid comprises the sequence of SEQ ID NO: 237;
(g) the heavy chain nucleic acid comprises the sequence of SEQ ID NO: 242 and the light chain nucleic acid comprises the sequence of SEQ ID NO: 224;
(h) the heavy chain nucleic acid comprises the sequence of SEQ ID NO: 247 and the light chain nucleic acid comprises the sequence of SEQ ID NO: 229;
(i) the heavy chain nucleic acid comprises the sequence of SEQ ID NO: 250 and the light chain nucleic acid comprises the sequence of SEQ ID NO: 232;
(j) the heavy chain nucleic acid comprises the sequence of SEQ ID NO: 256 and the light chain nucleic acid comprises the sequence of SEQ ID NO: 238;
(k) the heavy chain nucleic acid comprises the sequence of SEQ ID NO: 252 and the light chain nucleic acid comprises the sequence of SEQ ID NO: 234;
(l) the heavy chain nucleic acid comprises the sequence of SEQ ID NO: 253 and the light chain nucleic acid comprises the sequence of SEQ ID NO: 235;
164
2016244220 23 Apr 2018 (m) the heavy chain nucleic acid comprises the sequence of SEQ ID NO: 254 and the light chain nucleic acid comprises the sequence of SEQ ID NO: 236;
(n) the heavy chain nucleic acid comprises the sequence of SEQ ID NO: 243 and the light chain nucleic acid comprises the sequence of SEQ ID NO: 225;
5 (o) the heavy chain nucleic acid comprises the sequence of SEQ ID NO: 251 and the light chain nucleic acid comprises the sequence of SEQ ID NO: 233;
(p) the heavy chain nucleic acid comprises the sequence of SEQ ID NO: 245 and the light chain nucleic acid comprises the sequence of SEQ ID NO: 227;
(q) the heavy chain nucleic acid comprises the sequence of SEQ ID NO: 258 and the 0 light chain nucleic acid comprises the sequence of SEQ ID NO: 240; or (r) the heavy chain nucleic acid comprises the sequence of SEQ ID NO: 258 and the light chain nucleic acid comprises the sequence of SEQ ID NO: 241.
4. The recombinant antibody of claim 3, wherein the heavy chain nucleic acid comprises .5 the sequence of SEQ ID NO: 247 and the light chain nucleic acid comprises the sequence of
SEQ ID NO: 229.
5. The recombinant antibody of claim 3, wherein the heavy chain nucleic acid comprises the sequence of SEQ ID NO: 251 and the light chain nucleic acid comprises the sequence of
0 SEQ ID NO: 233.
6. A pharmaceutical composition comprising the antibody of any one of claims 1 to 5 and a pharmaceutically acceptable excipient.
25 7. A pharmaceutical composition comprising the antibody of claim 4 and a pharmaceutically acceptable excipient.
8. Use of the antibody of any one of claims 1 to 5 in the manufacture of a medicament for treating a condition associated with CGRP receptor-mediated vasodilation or neurogenic
30 inflammation in a patient in need thereof.
9. The use of claim 8, wherein the condition is headache.
165
2016244220 23 Apr 2018
10. The use of claim 8, wherein the condition is migraine.
11. The use of any one of claims 8 to 10, wherein the treating comprises prophylactic 5 treatment.
12. A method for treating or preventing headache in a patient in need thereof comprising administering to the patient an effective amount of the antibody of any one of claims 1 to 5 or the pharmaceutical composition of claim 6 or claim 7.
13. A method for treating or preventing migraine in a patient in need thereof comprising administering to the patient an effective amount of the antibody of any one of claims 1 to 5 or the pharmaceutical composition of claim 6 or claim 7.
.5 14. A method of making an antibody that specifically binds to human CGRP receptor comprising:
culturing a host cell comprising a first nucleic acid encoding an antibody heavy chain and a second nucleic acid encoding an antibody light chain under conditions that allow expression of the antibody heavy chain and antibody light chain, wherein the first nucleic acid
0 comprises a nucleotide sequence selected from SEQ ID NOs: 242-258, and the second nucleic acid comprises a nucleotide sequence selected from SEQ ID NOs: 224-241; and isolating the antibody formed by the heavy and light chains from the host cell, wherein the antibody specifically binds to the human CGRP receptor.
25 15. The method of claim 14, wherein:
(a) the first nucleic acid comprises a sequence of SEQ ID NO: 244 and the second nucleic acid comprises a sequence of SEQ ID NO: 226;
(b) the first nucleic acid comprises a sequence of SEQ ID NO: 257 and the second nucleic acid comprises a sequence of SEQ ID NO: 239;
30 (c) the first nucleic acid comprises a sequence of SEQ ID NO: 248 and the second nucleic acid comprises a sequence of SEQ ID NO: 230;
166
2016244220 23 Apr 2018 (d) the first nucleic acid comprises a sequence of SEQ ID NO: 246 and the second nucleic acid comprises a sequence of SEQ ID NO: 228;
(e) the first nucleic acid comprises a sequence of SEQ ID NO: 249 and the second nucleic acid comprises a sequence of SEQ ID NO: 231;
5 (f) the first nucleic acid comprises a sequence of SEQ ID NO: 255 and the second nucleic acid comprises a sequence of SEQ ID NO: 237;
(g) the first nucleic acid comprises a sequence of SEQ ID NO: 242 and the second nucleic acid comprises a sequence of SEQ ID NO: 224;
(h) the first nucleic acid comprises a sequence of SEQ ID NO: 247 and the second 0 nucleic acid comprises a sequence of SEQ ID NO: 229;
(i) the first nucleic acid comprises a sequence of SEQ ID NO: 250 and the second nucleic acid comprises a sequence of SEQ ID NO: 232;
(j) the first nucleic acid comprises a sequence of SEQ ID NO: 256 and the second nucleic acid comprises a sequence of SEQ ID NO: 238;
.5 (k) the first nucleic acid comprises a sequence of SEQ ID NO: 252 and the second nucleic acid comprises a sequence of SEQ ID NO: 234;
(l) the first nucleic acid comprises a sequence of SEQ ID NO: 253 and the second nucleic acid comprises a sequence of SEQ ID NO: 235;
(m) the first nucleic acid comprises a sequence of SEQ ID NO: 254 and the second 0 nucleic acid comprises a sequence of SEQ ID NO: 236;
(n) the first nucleic acid comprises a sequence of SEQ ID NO: 243 and the second nucleic acid comprises a sequence of SEQ ID NO: 225;
(o) the first nucleic acid comprises a sequence of SEQ ID NO: 251 and the second nucleic acid comprises a sequence of SEQ ID NO: 233;
25 (p) the first nucleic acid comprises a sequence of SEQ ID NO: 245 and the second nucleic acid comprises a sequence of SEQ ID NO: 227;
(q) the first nucleic acid comprises a sequence of SEQ ID NO: 258 and the second nucleic acid comprises a sequence of SEQ ID NO: 240; or (r) the first nucleic acid comprises a sequence of SEQ ID NO: 258 and the second 30 nucleic acid comprises a sequence of SEQ ID NO: 241.
167
2016244220 23 Apr 2018
16. The method of claim 15, wherein the first nucleic acid comprises a sequence of SEQ ID NO: 247 and the second nucleic acid comprises a sequence of SEQ ID NO: 229.
17. The method of claim 15, wherein the first nucleic acid comprises a sequence of SEQ ID 5 NO: 251 and the second nucleic acid comprises a sequence of SEQ ID NO: 233.
18. The method of any one of claims 14 to 17, wherein the host cell secretes the antibody and the antibody is isolated from the culture medium of the host cell.
0 19. An antibody when prepared according to the method of any one of claims 14 to 18.
20. An antibody when prepared according to the method of claim 16.
21. A pharmaceutical composition comprising an antibody of claim 20 and a .5 pharmaceutically acceptable excipient.
168
1/17
2016244220 11 Oct 2016
1 10
20 30 40
MARAIjCRLPQRGLWLLLAHHLFMATACQEAKYGALLQEIiCI.TQFQVDMEAVGET t4ARALCRLPRRGLKL.LL?iHHLRHTTACQEASYG?iiLRBlCLTQFQVDMSAVGET
MAPGLRGLPRRGLWLLI.AHHLFMVTACRDPDYGTLIQELCLSRFKEDMETXGKT
SO 70 80 90 100
LWCDWGRTIGS'XREIADCTWKMAEKLGCFWPKABVDRFFLAVHGHYFHACPISG
LWCDWGRTXRSYREIADCTWKMAEKLGCFWPNAEVDRFFLAVHGRYFRSCPISG
LWCDWGKTIGSyGSLTHCTKLVANKrGCWPNPSVDXPPIAVHHRYFSKCPVSG
110 120 130 140
RAVRDP PGSVLYP FIWPITVTLLVTAL WWQS KRTEGIV RAVRDPPGSILYPFIVVPITVTLLVTALVVWQSKRTEGIV RALS.DP PNS1LCP FI VLPITVTLLMTALWWRS KRTEGIV
2/17
2016244220 11 Oct 2016
1 IQ 20 30 40 50
-MBKKCTLYFLVLLPPFMIFVTAELEESPSDS1QLGVTRNKIMTAQYECYQKIMQDP -MEKKCTLYFLVLLPFFMILVTAELEESPSDSIQLGVTRNKXMTAQYECYQKIMQDP MMDKKCTLCFLFLLLLNMALIAAESEEGANQT-DLGVTRNKIMTAQYECYQKIMQDP
SO 70 80 90 100 110
IQQASGVYCNRTMDGULCWNNVAAGTESMQLC PDYFQD FDPSEKVTKICDQDGNWFR TQQAEGVYCNRTWDGNLCWNDVAAGTESMOLCPDYFQDFDPSEKVTKICDQDGNWFR XQQGEGLYCafRTWDGWLCWNDVAAGTESMQYCPDYFQDFDPSEKVTKICDQDGNWFR
120 130 140 150 ISO 170
HPASNRTWTNYTQCNVNTHE KVKTALNLFYLTI1GHGLSIAS LLISLGIFFYFKSLS HPASNRTWTNYTQCNVNTHE KVKTALNLFYLTII GHGLS IASLLISLGIFFYFKSLS HPDSNRTNTNYTLCNNSTHE KVKTALNLF YLT1I GHGLS XASL1I SL 1X FFYFKSLS
180 190 .200 210 22 0
CQRITLHBNLFFSFVCNSWTIXHLTAVANNQALVATNPVSCKVSQPXHLYLMGCNY
CQRXTLHKNXiFFSFVCNSWTIIHLTAVANNQALVATNPVSCKVSQFXHLYLMGCNY
CQRXTLHKNLFFSFVCNSXVTIIHLTAVANNQALVATNPVSCKVSQFIHLYLMGCNY
230 240 250 260 270 250
FWMLCEGIYLHTLXWAVFAEIQHLMNYYFLGWGFPLIPACIHAIARSLYYNDNCWI
FWLCEGIYLHTLXWAVFAEKQHLMWYYFLGWGFPLXPACIHAIARSLYYNDNCWI
FWMLCEGXYLHTLIWAVFAEKQHLMWYYFLGWGFPLLPACXKAXARSLYYNDNCWI
290 300 310 320 330 340
SSDTHLLYIIHGPICAALLWLFFLLNIVRVLITKLKVTHQASSNLYMKAVRATLXL SSDTHLLYIXHGPXCAALLVNLFFLLNXVRVLXTKLKVTHQASSNLYMKAVRATLIL SSDTHLLYIXHGPICAALLVNLPFLLNIVRVLXTKLKVTHQABSNLYMKAVRATLXL
350 3SG 370 380 390
VPLLGXEFVLIPWRPEGKIAEEVYDYXMHXUiHFQGLLVSTXFCFFNGEVQAXLRRN VPLLGISFVLXPWRPEGKXAEEVYDYXMiiXLMKFQGLLVSTXFCFFNGEVQAXLRRN VPLLGISFVLFPWRPEGKVAEEVYDYVMHILMHYQGLLVSTIFCFFNGEVQAILRRN
400 410 420 430 440 450
CYNOCRLR ί 3 99 j WNQYKIQFGNSFSNSEALRSASYTVSTISDGPGYSHDCPSEIiLNGKSIHDXEN'WLK HUCRLR ί 3 9 9) WNQYKIQFGNSFSNSEALRSASYTVSTXSDGFGYSHDCPSEHLNGKS XHDXENVLLK RATCRLR (399) WNQYKXQFGNGFSKSDALRSASYTVSTISDVQGYSHDCPTEHX^GKSIQDISNVALK
CYNOCRLR(456)
HUCRLR (456) RATCRLR (4 56)
460
PENLYN--PENLYN--PEKMYDLVM
3/17
2016244220 11 Oct 2016
K F S
A K
4/17
2016244220 11 Oct 2016
R
5/17
Ο (Μ
Ο ο
(Μ (Μ <Ν
Ο (Μ > > >
□ αο
2 2 £ ο © © > < > >>> > > > α,ζα ο. ω a. U. >~ Ω > -J > ϋ e © or. ι a at ©
σ
Ω
I -J < 2 > Ο © ® >- S ο σ ο Ω ο Ο 55 σ ο σ
X U. U. X X X σ σ σ < < < > > > Ζ Ζ Ζ Η ί- ΙΟ Ο ί3 © ο ο © to © ζ ζ ζ α. Ο. X σ
© χ
«3 >
<
>
ίο ©
<
«3 d
g Ζ © Ζ © Ω “ ” ”
USSS cm
CM σ;
οο
V χ
>
>
© >
>>
Ω >
>
S3 Ω σ ο χ ζ 0» Ω >
(Ο ££ ο 2 © X & Ω
X Ω Ω χ σ g us ” to a x
Ω < Ω Ζ
jft iff c
4ί m
in βσ>
LL
5 ο
6 S' X Ω to ©
1£3 «5 »
ίή
C «
«
C ο
ο © Τ’ □
CS
X Ο £ X ΐ*>
ο
X ©ο ΐϋ Ζ © Ω r— ifi W !Λ ί»~ !»I» ,CO CQ
Β§
Ρ!
££
to ο S σ> to 55
ΛΤ xf <Ο Μ- Κ Κ CO
CM £
Ω σό ?Λ “s>
X
Ο ο
« □
Vi
C φ
ί»
C ο
£ f « I »
□
S £
ο τ* «5 33 $ Q Λ □ <Μ U- ί\ί 9
Ο *“ £f> *“ X
Ο ιη ο
LL
6/17 kO
Ο (Ν gi to ο
(Ν (Ν <Ν kO
Ο (Ν ο
LU σ
Ω !β ω
V) ο
F
Ο g
£3>
<
<
Μ ©
α ο
ο
C2 ©
0>
CO co
Si
Ω ©
£ ©
F
F
F
F —ι Ο < < <
ο
Ο <
© ν;
>
□ £
©
F >
>
Ω <
S ...S ©
F <
to <
<
f ί±!
χ ω
«3 £2 >
<
£Ζ
CO s: ^Ω ~ Ο X
Ο Ζ » SU - ®
Οί ζ
Ω
Ω
Ο ν:
>
£0 α
<
f >
s;
ζ ©
Ω
F
5>
>
5C
G Ζ US Q co S
Ο!
SC
Ω
Ω
X >
GR ί£
SO
Ω
X
Ο
Ο σ ζ Κ ω ο F «ο 9
Ο ο -& 5 LU «3 to css
Ο
X £
©
F (fi
ΟΧ £Χ!
co £
Τ sc © Ω < ύ ζ
ο ο
ο χ
C ο
ο ο
X
7/17
Ο (Μ ο
(Μ (Μ ^Ι- ^Ι- (Μ
Ο (Μ ©
©
3.
*ο £
KS a
S «
ο >
S3 α
© ο
©
0£
Ή ©
ffi
Έ ο
S |χ.
« i
εκ a, &
Ο re c
SS
SX ©>
ο
U0iH£Ssyuj%’ rgtdxg co
□) w mm
8/17
2016244220 11 Oct 2016 cAMP content m cels expressing hCGRP R stimulated with 1nM hCGRP 125I»CGRP binding to human CGRP receptor
Fig 8
9/17
2016244220 11 Oct 2016
120' cAhIR content in foAMl-HEK ceils
100n y
P 801 θ SO· c
40·
20· ! ί '--“4—.....
3 -12 -11 -10 -9
T“
T” concentration, log M
3C8
13H2
1E11
Fig 7B cAMP content In hAI$2-CHQ cells
3C8
13H2
1E11
Fig 7C
CAMP content in MCF-7 ceils (expressing homan amylin receptors)
120 η $ °-13 -12.....-11.....-10.....-9 ?8.......-7.......-0.....-5 concentration, log M
Fia 7D
10/17
2016244220 11 Oct 2016
Time (sec) £
Ω a
ω ©
£g
14QQ
386 Surface
Time (sec)
11/17
2016244220 11 Oct 2016 'aiup* fc δ
a, sfl «3
12G8 Surface
S'
200 400 600 800 1000 1200 1400
Time (sec)
Time (sec)
12/17
2016244220 11 Oct 201
FACS Kd determination mAh 12GS
Log concentration of mAh (M)
Fig 10
CRLR: RA^P1 Wild Type FtQ 1 3 A
CRLR L24-G33: RAMPt
CRLR: RAMPt Q28-A34
Fig 13C
13/17
2016244220 11 Oct 2016 cyno._RAliFl hurnaiwRAYsP 1 huRAMPl(Q23-A34)) huRAMPl{Q4 3-E5 3} huRAMPliS6?~E73} rat_RAMPl rh <3 s u s._RAM P1 cyno_RAHPl huraan_RAMPl huRAMPlί Q23-A34)} huRAMPl(Q43-S53) huRAMPl(SS7-S78) rat_RAMPl rhesus RA5»JP1 cyno_RAM?i human__RAMPl huRAMPl(Q28-A34)} huRAMPl{Q43-E53) huRAMPliR67-E78) rat_RAMPl rhesus_RAMPl
1 SO
MARALCRLPQ RGLWLLLAHH LFMATACQSA KYGALLQ3LC LTQFQVDMEA MARALCRLPR RGLWLLLAHH LFMTTACQBA NYGALLRSLC LTQFQVDMSA MARALCRLPR RGLWLLLAHH LFMTTACRDP DYGTLLR2LC LTQFQVDMEA MARALCRLPR RGLWLLLAHH LFMTTACQBA NYGALLRSLC LTRFKSDMET MARALCRLPR RGLWLLLAHH LFMT7ACQEA NYGALLRELC LTQFQVDMSA MAPGLRGLPR RGLWLLLAHH LFMVTACRDP DYGTLIQSLC LSRFKEDMET MARALCRLPQ RGLWLLLAHH LFMATACQEA NYGALLQELC LTQFQVDMEA
Si 100
VGETLWCDWG RTIGSYRBLA DCTWHMAEKL GCFWPNASVD RFFLAVHGHY VGETLWCDWG RTIRSYRBLA DCTWHMAEKL GCFWPNAEVD RFFLAVHGRY VGETLWCDWG RTIRSYRELA DCTWHMAEKL GCFWPMAEVD RFFLAVHGRY IGKTLWCDWG RTIRSYRELA DCTWHMAEKL GCFWPMAEVD RFFLAVHGRY VGETLWCDWG RTIRSYGELT HCTKLVANKL GCFWPMAEVD RFFLAVHGRY IGKTLWCDWG KTIOSYGELT HCTKLVANKI GCFWPNPEVD KFFIAVHHRY VGETLWCDWG RTIGSYRSLA DCTWHMAEKL GCFWPMAEVD RFFLAVHGHY
101 148
FRACPISGRA VRDPPGSVLY PFIWPITVT LLVTALWWQ SKKTEGIV FRSCPISGRA VRDPPGSILY PFIWPITVT LLVTALWWQ SKRTEGIV FRSCPISGRA VRDPPGSILY PFIWPITVT LLVTALWWQ SKRTEGIV FRSCPISGRA VRBPPGSILY PFIWPITVT LLVTALWWQ SKRTEGIV FRSCPISGRA VRDPPGSILY PFIWPITVT LLVTALWWQ SKRTEGIV FSKCPVSGRA LRDPPNSILC PFIVLPITVT LLMTALWWR SKRTEGIV FRACPISGRA VRDPPGSVLY PFIWPITVT LLVTALWWQ SKHTESIV
14/17
2016244220 11 Oct 2016 huCRLR cynoCRLR rhesusCRLR rafcCRLR huCRLR(L24-Q33)
Consensus huCRLR CynoCRLR rhesusCRLR ratCRLR huCRLR (1.24-033)
Consensus huCRLR cynoCRLR rhesusCRLR rafcCRLR huCRLR(L24-Q335
Consensus huCRLR cynoCRLR rhesusCRLR rafcCRLR huCRLR(L24-Q33)
Consensus huCRLR cynoCRLR rhesusCRLR rafcCRLR huCSLR{L24-Q33)
Consensus
1 50
MEKKCTLYF LVLLPFFMXL VTAELEBSPB DSXQLGVTRB KIMTAQYECY MEKKCTLYF LVLLPFFMIF VTAELEBSPB DSXQLGVTRK KIMTAQYECY MEKKCTLYF LVLLPFFMIF VTAELBBSPE DSXQLGVTRB KXMTAQYECY
MMDKKCTLCF LFLLLLSMAL IA&ESEEGAN QT-DLGVTR.K KXMTAQYECY MEKKCTLYF LVLLPFFMXL VTAESBBGAN QT-DLGVTSN KIMTAQYECY MeKKCTLyF LvLLpffMil -tAE-BE--- ----LGVTRN KXMTAQYECY
51 100
QKIMQDPIQQ ABGVYCMRTW DGKLCKNDVA AGTESMQLC? DYFQDFDPSE QKIMQDPIQQ AEGVYCMRTK DGWLCWNVA AGTESMQLCP DYFQDFDPSE QKIMQDPIQQ ABGVYCNSTK DGWLCKNNVA AGTESMQLCP DYFQDFDPSE QKIMQDPIQQ GSGLYCHRTW DGMLCWNDVA AOTSSKQYCP DYFQDFDPSE QKIMQDPIQQ AEGVYCNRTW DGMLCWDVA AGTESMQLCP DYFQDFDPSE QKIMQDPIQQ aBG-YCNRTM DGWLCMM-VA AGTESMQ1CP DYFQDFDPSE
101 150
KVTKICDQDG WFRHPASKR TWTMYTQCKV MTHEKVKTAL NLFYLTIIGH KVTKICDQDG WFRKPASKR TMTMYTQCKV NTHBKVXTAL NLFYLTIIGH KVTKICDQDG WFRHPASNR TWTMYTQCNV NTHBKVKTAL NLFYLTIIGH KVTKICDQDG WFRKPDSKR TKTNYTLCKN STHEKVXTAL NLFYLTIIGH KVTKICDQDG NWFRHPASNR TWTNYTQCKV NTHBKVKTAL NLFYLTIIGH KVTKICDQDG WFRKPaSNR TWTNYTqCNv nTHBKVKTAL NLFYLTIIGH
151 200
GLSIASLLIS LGIFFYFKSL SCQRITLHKN LFFSFVCNSV VTIIHLTAVA GLSIASLLIS LGIFFYFKSL SCQRITLHKN LFFSFVCNSV VTIXHLTAVA GLSIASLLIS LGIFFYFKSL SCQRITLHKN LFFSFVCNSV VTIXHLTAVA GLSXASLIIS LIIFFYFKSL SCQRITLHKN LFFSFVCKSI VTIXHLTAVA GLSIASLLIS LGIFFYFKSL SCQRTTLKKN LFFSFVCNSV VTIXHLTAVA GLSIASL-IS LgIFFYFKSL SCQRITLKXN LFFSFVCKS- VTIIKLTAVA
201 250
NNQALVATNP VSCKVSQFIH l.YLMGCNYFW MLCEGIYLHT LXWAVFAEK NNQALVATNP VSCKVSQFIH LYLMGCNYFW MLCEGIYLHT LXWAVFAEK NNQALVATNP VSCKVSQFIH LYLMGCNYFW MLCEGIYLHT LXWAVFAEK NNQALVATNP VSCKVSQFIH LYLMGCNYFW MLCBGXYLHT LXWAVFAEK NNQALVATNP VSCKVSQFIH LYLMGCNYFW MLCBGXYLHT LXWAVFAEK NNQALVATNP VSCKVSQFIH LYLMGCNYFW MLCBGXYLHT LXWAVFAEK huCRLR cynoCRLR rhesusCRLR rafcCRLR huCRLR(L24-Q335
Consensus
251
QHLMWYYFLG
QHLMWYYFliG
QHLMWYYFLG
QKLMWYYFLG
QHLMWYYFLG
QHLMWYYFLG
WGFPLIPACI WGFPLXPACX WGFPLLPACI WGFPLLPACI WGFPLIPACX WGFPL-PACI
HAIARSLYYN
HAIARSLYYN
HAIARSLYYN
HAIARSLYYN
HAIARSLYYN
HAIARSLYYN
DNCWISSDTH
DHCWISSDTH
DNCWISSDTH
DNCWISSDTH
DNCWISSDTH
DNCWISSDTH
300
L-LYIIHGPIC
LLYIIHGPIC
LLYIIHGPIC
LLYIIHGPIC
LLYIIHGPIC
LLYIIHGPIC
15/17
2016244220 11 Oct 2016
301 350 fcuCRLR AALLWLFFb WXVRVLXTK LKVTHQASSN LYMKAVRATL ILVPLLGISF
16/17
2016244220 11 Oct 2016 lis sis 20 4Ϊ $si £ta ra ftcs lhiic
17/17
2016244220 11 Oct 2016
2016244220 11 Oct 2016
A1472PCT. t xt SEQUENCE LI STI NG <11 0> AM3EN I NC.
<120> HUIVAN CGRP RECEPTOR BI NDI NG PRQTEI NS <130> A- 1472- W> PCT <140>
<141 >
<1 50> 61/264, 622 <151> 2009-11-25 <1 50> 61/203, 569 <151 > 2008- 12-23 <1 60> 261 <170> Pat ent I n version 3.5 <210> 1 <211> 1419 <212> DNA <213> Homo sapi ens <400> 1
A1472PCT. t xt
2016244220 11 Oct 2016
1111 ccaact cagaagct ct t cgt agt gcg t ct t acacag t gt caacaat cagt gat ggt ccaggt t at a gt cat gact g t cct agt gaa cact t aaat g gaaaaagcat ccat gat at t gaaaat gt t c t ct t aaaacc agaaaat 11 a t at aat t ga
1320
1380
1419 <210> 2 <211> 472 <212> PRT <213> Homo sapi ens <400> 2
210 215 220
Page 2
A1472PCT. t xt
2016244220 11 Oct 2016
465 470 <210> 3 <211> 447
Page 3
A1472PCT. t xt
2016244220 11 Oct 2016 <212> DNA <213> Homo sapi ens <400> 3 at ggcccggg ccct gt gccg cct cccgcgg cgcggcct ct ggct get cct ggcccat cac 60 et ct t cat ga ccact gcct g ccaggaggct aact aeggt g ccct cct ccg ggaget ct gc 120 ctcacccagt tccaggtaga catggaggee gtcggggaga egetgtggtg tgactggggc 180 aggaccatca ggagetacag ggagetggee gactgcacct ggcacatggc ggagaagetg 240 ggct get t ct ggcccaat gc agaggt ggac aggt t ct t cc t ggcagt gca t ggeeget ac 300
11 caggagct gccccat ct c aggcagggcc gt gcgggacc cgcccggcag cat cct ct ac 360 ccct t cat eg t ggt ccccat cacggt gacc ct get ggt ga cggcact ggt ggt ct ggcag 420 ageaagegea ct gagggcat t gt gt ag 447 <210> 4 <211> 148 <212> PRT <213> Homo sapi ens
<210> 5
Page 4
A1472PCT. t xt
2016244220 11 Oct 2016 <211> 414 <212> DNA <213> Homo sapi ens <400> 5 at ggagaaaa agt gt accct gt at 111 ct g gt t ct ct t gc ct 111111 at gat t ct t gt t 60 acagcagaat t agaagagag t cct gaggac t caat t cagt t gggagt t ac t agaaat aaa 120 at cat gacag ct caat at ga at gt t accaa aagat t at gc aagaccccat tcaacaagca 180 gaaggcgttt actgcaacag aacctgggat ggatggctct getggaacga tgttgcagca 240 ggaact gaat caat gcagct ct gccct gat t act 11 cagg act 11 gat cc at cagaaaaa 300 gttacaaaga tctgtgacca agatggaaac tggtttagac atccagcaag caacagaaca 360 tggacaaatt atacccagtg taatgttaac acccacgaga aagtgaagac tgca 414 <210> 6 <211> 138 <212> PRT <213> Homo sapi ens <400> 6
130 135
Page 5
2016244220 11 Oct 2016
A1472PCT. t xt at ggcccggg ccct gt gccg cct cccgcgg cgcggcct ct ggct get cct ggcccat cac 60 et ct t cat ga ccact gcct g ccaggaggct aact aeggt g ccct cct ccg ggaget ct gc 120 ctcacccagt tccaggtaga catggaggee gtcggggaga egetgtggtg tgactggggc 180 aggaccatca ggagetacag ggagetggee gactgcacct ggcacatggc ggagaagetg 240 ggct get t ct ggcccaat gc agaggt ggac aggt t ct t cc t ggcagt gca t ggeeget ac 300 ttcaggagct gccccatctc aggcagggcc gtgcgggacc cgcccggcag c 351 <210> 8 <211> 117 <212> PRT <213> Homo sapi ens <400> 8
Asp Pr o Pr o Gl y Ser 115
<210> 10 <211> 116 <212> PRT
Page 6
A1472PCT. t xt
2016244220 11 Oct 2016 <213> Homo sapi ens <400> 10
115 <210> 11 <211> 91 <212> PRT <213> Homo sapi ens <400> 11
<210> 12 <211> 238 <212> PRT
Page 7
A1472PCT. t xt
2016244220 11 Oct 2016 <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 12
225 230 235
Page 8
A1472PCT. t xt
2016244220 11 Oct 2016 <210> 13 <211> 238 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 13
2016244220 11 Oct 2016
A1472PCT. t xt
225 230 235 <210> 14 <211> 236 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 14
Page 10
A1472PCT. t xt
2016244220 11 Oct 2016
<220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 15
195 200 205
Page 11
A1472PCT. t xt
2016244220 11 Oct 2016
225 230 235 <210> 16 <211> 241 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 16
Page 12
A1472PCT. t xt
2016244220 11 Oct 2016
<210> 17 <211> 238 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de
Page 13
A1472PCT. t xt
2016244220 11 Oct 2016
225 230 235 <210> 18 <211> 241 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de
Page 14
A1472PCT. t xt
2016244220 11 Oct 2016
235 240 <220>
<221> source <223> I not e= Descr i pt i on of Arti
1 ί zdz-l
f i ci al Sequence: Synt het i c
Page 15
A1472PCT. t xt
2016244220 11 Oct 2016
<220>
<221> source <223> I not e= Descr i pt i on of Arti pol ypept i de <400> 20 f i ci al Sequence: Synt het i c
Page 16
A1472PCT. t xt
2016244220 11 Oct 2016
A1472PCT. t xt
2016244220 11 Oct 2016
A1472PCT. t xt
2016244220 11 Oct 2016
Page 19
A1472PCT. t xt
2016244220 11 Oct 2016
225 230 235 <210> 24 <211> 241 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 24
Page 20
2016244220 11 Oct 2016
A1472PCT. t xt
2016244220 11 Oct 2016
225 230 235 <210> 26 <211> 236 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 26
IVht Asp IVht Arg Val Pro Al a On Leu Leu Q y Leu Leu Leu Leu Trp 15 10 15
Page 22
A1472PCT. t xt
2016244220 11 Oct 2016
225 230 235 <210> 27 <211> 235 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de
Page 23
A1472PCT. t xt
2016244220 11 Oct 2016
<210> 28 <211> 235 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source
Page 24
2016244220 11 Oct 2016
A1472PCT. t xt <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 28
Page 25
A1472PCT. t xt
2016244220 11 Oct 2016 <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 29
Page 26
A1472PCT. t xt
2016244220 11 Oct 2016
<210> 30 <211> 479 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de
Page 27
A1472PCT. t xt
2016244220 11 Oct 2016
265 270
260
Page 28
A1472PCT. t xt
2016244220 11 Oct 2016
465 470 475 <210> 31 <211> 478 <212> PRT
Page 29
A1472PCT. t xt
2016244220 11 Oct 2016
Page 30
A1472PCT. t xt
2016244220 11 Oct 2016
20 25 30
Page 31
2016244220 11 Oct 2016
Val Lys
Tyr Thr 50
G n G y 65
Asn Tyr
Ser I I e
Thr Al a
Arg G y 130
G y Thr 145
Phe Pro
Leu Q y
Tr p Asn
Leu Q n 210
Ser Ser 225
Pro Ser
Q u Cys
Leu Phe
G u Val 290
Lys Pr o 35
Phe Thr
Leu Q u
Al a G n
Ser Thr 100
Val Tyr 115
Val Phe
Thr Val
Leu Al a
Cys Leu 180
Ser G y 195
Ser Ser
Asn Phe
Asn Thr
Pro Pro 260
Pro Pro 275
Thr Cys
G y Al a
G y Tyr
Trp IVfet 70
Lys Phe 85
Al a Tyr
Phe Cys
Pro Pro
Thr Val 150
Pr o Cys 165
Val Lys
Al a Leu
Q y Leu
G y Thr 230
Lys Val 245
Cys Pr o
Lys Pr o
Val Val
Ser Val 40
Tyr IVfet 55
G y Tr p
G n G y
IVbt Q u
Al a Ar g 120
Tyr Tyr 135
Ser Ser
Ser Arg
Asp Tyr
Thr Ser 200
Tyr Ser 215
G n Thr
Asp Lys
Al a Pr o
Lys Asp 280
Val Asp 295
A1472PCT. t xt Lys Val Ser Cys
Hi s Tr p
I I e Asn
Arg Val 90
Leu Ser 105
Asp Q n
Tyr G y
Al a Ser
Ser Thr 170
Phe Pro 185
G y Val
Leu Ser
Tyr Thr
Thr Val 250
Pr o Val 265
Thr Leu
Val Ser
Val Arg 60
Pro Asn 75
Thr IVbt
Arg Leu
IVbt Ser
IVbt Asp 140
Thr Lys 155
Ser Q u
G u Pro
Hi s Thr
Ser Val 220
Cys Asn 235
G u Arg
Al a G y
IVbt lie
Hi s Q u 300
Lys Al a 45
G n Al a
Ser G y
Thr Ar g
Arg Ser 110 lie lie 125
Val Trp
G y Pr o
Ser Thr
Val Thr 190
Phe Pro 205
Val Thr
Val Asp
Lys Cys
Pro Ser 270
Ser Arg 285
Asp Pr o
Ser G y
Pr o G y
G y Thr 80
Asp Thr 95
Asp Asp
IVbt Leu
G y G n
Ser Val 160
Al a Al a 175
Val Ser
Al a Val
Val Pr o
Hi s Lys 240
Cys Val 255
Val Phe
Thr Pro
G u Val
Page 32
A1472PCT. t xt
2016244220 11 Oct 2016
2016244220 11 Oct 2016
A1472PCT. t xt
50 55 60
Page 34
A1472PCT. t xt
2016244220 11 Oct 2016
A1472PCT. t xt
2016244220 11 Oct 2016
340 345 350
Page 36
A1472PCT. t xt
2016244220 11 Oct 2016
465 <210> 35 <211> 479 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de
Page 37
A1472PCT. t xt
2016244220 11 Oct 2016
355 360 365
Page 38
A1472PCT. t xt
2016244220 11 Oct 2016
465 470 475 <210> 36 <211> 475 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 36
100 105 110
Page 39
2016244220 11 Oct 2016
Thr Al a
Leu Tyr 130
Val Thr 145
Al a Pr o
Leu Val
G y Al a
Ser G y 210
Phe G y 225
Thr Lys
Pr o Cys
Pr o Lys
Cys Val 290
Trp Tyr 305
G u G u
Val Hi s
Asn Lys
G y G n 370
Val Tyr 115
Ser Hi s
Val Ser
Cys Ser
Lys Asp 180
Leu Thr 195
Leu Tyr
Thr G n
Val Asp
Pr o Al a 260
Pr o Lys 275
Val Val
Val Asp
Q n Phe
Q n Asp 340
Q y Leu 355
Pr o Ar g
Tyr Cys
Tyr Tyr
Ser Al a 150
Arg Ser 165
Tyr Phe
Ser G y
Ser Leu
Thr Tyr 230
Lys Thr 245
Pro Pro
Asp Thr
Asp Val
G y Val 310
Asn Ser 325
Trp Leu
Pr o Al a
G u Pro
Val Arg 120
Q y K/fet 135
Ser Thr
Thr Ser
Pro G u
Val Hi s 200
Ser Ser 215
Thr Cys
Val G u
Val Al a
Leu K/fet 280
Ser Hi s 295
G u Val
Thr Phe
Asn Q y
Pr o lie 360
G n Val 375
A1472PCT. t xt Gy Gy Tyr Ser
Asp Val
Lys Q y
Q u Ser 170
Pr o Val 185
Thr Phe
Val Val
Asn Val
Ar g Lys 250
G y Pr o 265
I I e Ser
Q u Asp
Hi s Asn
Arg Val 330
Lys Q u 345
Q u Lys
Tyr Thr
Tr p G y 140
Pro Ser 155
Thr Al a
Thr Val
Pr o Al a
Thr Val 220
Asp Hi s 235
Cys Cys
Ser Val
Ar g Thr
Pro G u 300
Al a Lys 315
Val Ser
Tyr Lys
Thr lie
Leu Pro 380
G y Tyr 125
G n G y
Val Phe
Al a Leu
Ser Trp 190
Val Leu 205
Pro Ser
Lys Pr o
Val G u
Phe Leu 270
Pro G u 285
Val G n
Thr Lys
Val Leu
Cys Lys 350
Ser Lys 365
Pro Ser
Al a G y
Thr Thr
Pro Leu 160
Q y Cys 175
Asn Ser
Q n Ser
Ser Asn
Ser Asn 240
Cys Pr o 255
Phe Pro
Val Thr
Phe Asn
Pr o Ar g 320
Thr Val 335
Val Ser
Thr Lys
Arg G u
Page 40
A1472PCT. t xt
2016244220 11 Oct 2016
465 470 475 <210> 37 <211> 479 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 37
2016244220 11 Oct 2016
A1472PCT. t xt
130 135 140
Page 42
2016244220 11 Oct 2016
465 470
<210> 38 <211> 479 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Arti
1 ί zdz-l
A1472PCT. t xt
2016244220 11 Oct 2016
420 425 430
Page 44
A1472PCT. t xt
2016244220 11 Oct 2016
465 470 475 <210> 39 <211> 478 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 39
Page 45
A1472PCT. t xt
2016244220 11 Oct 2016
435 440 445
Page 46
A1472PCT. t xt
2016244220 11 Oct 2016
<210> 40 <211> 479 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 40
Page 47
2016244220 11 Oct 2016
Page 48
2016244220 11 Oct 2016
Hi s Asn Hi s Tyr Thr 465
Q n Lys Ser 470
A1472PCT. t xt Leu Ser Leu Ser
475
Pro Q y Lys <210> 41 <211> 474 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 41
Page 49
2016244220 11 Oct 2016
<210> 42
Page 50
A1472PCT. t xt
2016244220 11 Oct 2016 <211> 13 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of pept i de <400> 42
Ser Q y Ser Ser Ser Asn lie 1 5
Artificial Sequence: Synthetic
Q y Asn Asn Tyr Val Ser 10 <210> 43 <211> 7 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of pept i de <400> 43
Asp Asn Asn Lys Arg Pro Ser 1 5
Artificial Sequence: Synthetic <210> 44 <211> 11 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of pept i de <400> 44
Gy Thr Trp Asp Ser Arg Leu 1 5 <210> 45 <211> 13 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of pept i de <400> 45
Ser Q y Ser Ser Ser Asn lie 1 5
Artificial Sequence: Synthetic
Ser Al a Val Val 10
Artificial Sequence: Synthetic
Q y Ser Asn Tyr Val Tyr 10 <210> 46 <211> 7 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of pept i de
Artificial Sequence: Synthetic
Page 51
A1472PCT. t xt
2016244220 11 Oct 2016 <400> 46
Arg Ser Asn Gl n Arg Pro Ser 1 5
Artificial Sequence: Synthetic
Ser G y Tr p Val 10
Artificial Sequence: Synthetic
Asn Asp Leu Q y 10
Artificial Sequence: Synthetic
Artificial Sequence: Synthetic
Trp Thr
Page 52
A1472PCT. t xt
2016244220 11 Oct 2016 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of pept i de <400> 51
Qn Qy Asp Ser Leu Arg Ser 1 5
Artificial Sequence: Synthetic
Phe Tyr Al a Ser 10 <210> 52 <211> 7 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of pept i de <400> 52
Qy Lys Asn Asn Arg Pro Ser 1 5
Artificial Sequence: Synthetic <210> 53 <211> 11 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of pept i de <400> 53
Asn Ser Arg Asp Ser Ser Val 1 5 <210> 54 <211> 16 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of pept i de <400> 54
Lys Ser Ser Q n Ser Leu Leu 1 5
Artificial Sequence: Synthetic
Tyr Hi s Leu Val 10
Artificial Sequence: Synthetic
Hi s Ser Al a Q y Lys Thr Tyr Leu Tyr 10 15 <210> 55 <211> 7 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of pept i de
Artificial Sequence: Synthetic
Page 53
A1472PCT. t xt
2016244220 11 Oct 2016 <400> 55
Q u Val Ser Asn Arg Phe Ser 1 5 <210> 56 <211> 9 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <400> 56
IVbt Q n Ser Phe Pro Leu Pro Leu Thr
1 5 <210> 57 <211> 16 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <400> 57
Arg Ser Ser GI n Ser Leu Leu Hi s Ser Phe Q y Tyr Asn Tyr Leu Asp 15 10 15 <210> 58 <211> 7 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <400> 58
Leu Q y Ser Asn Arg Al a Ser
1 5 <210> 59 <211> 9 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <400> 59
IVbt Q n Al a Leu Q n Thr Pro Phe Thr 1 5 <210> 60 <211> 16 <212> PRT
Page 54
A1472PCT. t xt
2016244220 11 Oct 2016 <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of pept i de <400> 60
Lys Ser Ser Gl n Ser Leu Leu 1 5
Artificial Sequence: Synthetic
Hi s Ser Asp Q y Lys Thr Tyr Leu Tyr 10 15 <210> 61 <211> 7 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of pept i de <400> 61
Arg Asn Asn Q n Arg Pro Ser 1 5
Artificial Sequence: Synthetic <210> 62 <211> 13 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of pept i de <400> 62
Ser Q y Ser Ser Ser Asn lie 1 5
Artificial Sequence: Synthetic
Q y Ser Asn Thr Val Asn 10 <210> 63 <211> 7 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of pept i de <400> 63
Thr Asn Asn Q n Arg Pro Ser 1 5
Artificial Sequence: Synthetic <400> 64 <210> 64 <211> 11 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of pept i de
Artificial Sequence: Synthetic
Page 55
A1472PCT. t xt
2016244220 11 Oct 2016
Synt het i c
Asn Tyr Leu Tyr 15
Synt het i c
Synt het i c
Synt het i c
Page 56
A1472PCT. t xt
2016244220 11 Oct 2016 <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: pept i de <400> 69
Arg Al a Ser Gl n Ser Val Ser Ser Q y Tyr Leu Thr 1 5 10
Synt het i c <210> 70 <211> 7 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: pept i de <400> 70
Q y Al a Ser Ser Arg Al a Thr
1 5
Synt het i c <210> 71 <211> 9 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: pept i de <400> 71
Q n Q n Tyr Q y Asn Ser Leu Cys Arg
1 5 <210> 72 <211> 9 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: pept i de <400> 72
G n G n Tyr Gy Asn Ser Leu Ser Arg
1 5
Synt het i c
Synt het i c <210> 73 <211> 5 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: pept i de <400> 73
Ser Phe Q y IVfet Hi s
Synt het i c
Page 57
A1472PCT. t xt
2016244220 11 Oct 2016 <210> 74 <211> 17 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <400> 74
Val lie Ser Phe Asp Q y Ser I I e Lys Tyr Ser Val Asp Ser Val Lys 15 10 15
Gy <210> 75 <211> 21 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <400> 75
Asp Arg Leu Asn Tyr Tyr Asp Ser Ser Gy Tyr Tyr His Tyr Lys Tyr 15 10 15
Tyr Q y IVbt Al a Val 20 <210> 76 <211> 5 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <400> 76
Asn Al a Tr p IVbt Ser
1 5 <210> 77 <211> 19 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <400> 77
Arg lie Lys Ser Thr Thr Asp Gy Gy Thr Thr Asp Tyr Al a Al a Pro Page 58
2016244220 11 Oct 2016
Val Lys Q y <210> 78 <211> 20 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of pept i de <400> 78
Asp Arg Thr Gl y Tyr Ser lie 1 5
Q y IVbt Asp Val 20 <210> 79 <211> 5 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of pept i de <400> 79
Ser Tyr Al a K/bt Ser 1 5
<223> / not e= Descr i pt i on of
A1472PCT. t xt
10 15
Artificial Sequence: Synthetic
Ser Trp Ser Ser Tyr Tyr Tyr Tyr Tyr 10 15
Artificial Sequence: Synthetic
Artificial Sequence: Synthetic
Arg Thr Tyr Tyr Ala Asp Ser Val Lys 10 15
Artificial Sequence: Synthetic Page 59
A1472PCT. t xt
2016244220 11 Oct 2016 pept i de <400> 81
Asp On Arg Glu Val Q y Pro Tyr Ser Ser Q y Trp Tyr Asp Tyr Tyr 15 10 15
Tyr Q y IVfet Asp Val 20 <210> 82 <211> 5 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <400> 82
Q y Tyr Tyr K/bt Hi s
1 5 <210> 83 <211> 17 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <400> 83
Trp lie Asn Pro Asn Ser Q y Q y Thr Asn Tyr Al a Q n Lys Phe Q n 15 10 15
Gy <210> 84 <211> 21 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <400> 84
Asp Q n IVfet Ser lie lie IVbt Leu Arg Q y Val Phe Pro Pro Tyr Tyr 15 10 15
Tyr Q y IVfet Asp Val 20 <210> 85 <211> 5 <212> PRT <213> Ar t i f i ci al Sequence
Page 60
A1472PCT. t xt <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <400> 85
Ser Tyr Q y Vht Hi s
1 5
2016244220 11 Oct 2016 <210> 86 <211> 17 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <400> 86
Val lie Ser Tyr Asp Q y Ser Hi s Q u Ser Tyr Al a Asp Ser Val Lys 15 10 15
Qy <210> 87 <211> 20 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <400> 87
Q u Arg Lys Arg Val Thr IVfet Ser Thr Leu Tyr Tyr Tyr Phe Tyr Tyr 15 10 15
Q y IVbt Asp Val 20 <210> 88 <211> 5 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <400> 88
Asp Tyr Al a Vht Ser
1 5 <210> 89 <211> 19 <212> PRT <213> Ar t i f i ci al Sequence
Page 61
A1472PCT. t xt <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <400> 89
Phe I I e Arg Ser Arg Al a Tyr G y G y Thr Pro G u Tyr Al a Al a Ser 15 10 15
2016244220 11 Oct 2016
Val Lys Q y <210> 90 <211> 10 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <400> 90
G y Arg G y I I e Al a Al a Ar g Tr p Asp Tyr
1 5 10 <210> 91 <211> 19 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <400> 91
Arg lie Lys Ser Lys Thr Asp Gy Gy Thr Thr Asp Tyr Thr Ala Pro 15 10 15
Val Lys Q y <210> 92 <211> 5 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <400> 92
Asp Tyr Tyr IVfet Tyr
1 5 <210> 93 <211> 17 <212> PRT <213> Ar t i f i ci al Sequence
Page 62
A1472PCT. t xt <220>
<221> source <223> I not e= Descr i pt i on of pept i de <400> 93
Trp lie Ser Pro Asn Ser Q y 1 5
2016244220 11 Oct 2016
Gy <210> 94 <211> 18 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of pept i de <400> 94
G y G y Tyr Ser Gy Tyr Al a 1 5
Asp Val <210> 95 <211> 19 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of pept i de <400> 95
Arg lie Lys Ser Lys Thr Asp 1 5
Val Lys Q y <210> 96 <211> 21 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of pept i de <400> 96
Asp Arg Leu Asn Tyr Tyr Asp 1 5
Artificial Sequence: Synthetic
Q y Thr Asn Tyr Al a Q n Lys Phe Q n 10 15
Artificial Sequence: Synthetic
Q y Leu Tyr Ser Hi s Tyr Tyr Q y IVht 10 15
Artificial Sequence: Synthetic
Gy Gy Thr Thr Asp Tyr Al a Al a Pro 10 15
Artificial Sequence: Synthetic
Ser Ser Q y Tyr Tyr Hi s Tyr Lys Tyr 10 15
Page 63
A1472PCT. t xt
2016244220 11 Oct 2016
Tyr Q y Leu Al a Val 20 <210> 97 <211> 5 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <400> 97
Thr Tyr Ser IVbt Asn
1 5 <210> 98 <211> 17 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <400> 98
Ser I I e Ser Ser Ser Ser Ser Tyr Arg Tyr Tyr Al a Asp Ser Val Lys 15 10 15
Gy <210> 99 <211> 22 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <400> 99
G u G y Val Ser Gy Ser Ser Pro Tyr Ser lie Ser Trp Tyr Asp Tyr 15 10 15
Tyr Tyr Q y IVfet Asp Val 20 <210> 100 <211> 5 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <400> 100
Page 64
A1472PCT. t xt
2016244220 11 Oct 2016
Ser Tyr Q y IVht Hi s 1 5 <210> 101 <211> 17 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <400> 101
Val I I e Trp Tyr Asp Q y Ser Asn Lys Tyr Tyr Al a Asp Ser Val Lys 15 10 15
Gy <210> 102 <211> 17 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <400> 102
Ala Qy Gy I I e Al a Al a Al a Q y Leu Tyr Tyr Tyr Tyr Q y Lfet Asp 15 10 15
Val <210> 103 <211> 11 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <220>
<221 > VARIANT <222> (8) . . (8) <223> / r epi ace=Lys <220>
<221 > rri sc_f eat ur e <222> (8) . . (8) <223> I not e= Resi due given i n t he sequence has no preference with respect to that i n t he annotation for said position <400> 103
Arg Al a Ser Q n Q y lie Arg Asn Asp Leu Q y
1 5 10
Page 65
A1472PCT. t xt
2016244220 11 Oct 2016 <210> 104 <211> 7 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <220>
<221 > VARIANT <222> (1)..(1) <223> / repl ace=G y <220>
<221 > rri sc_f eat ur e <222> (1)..(1) <223> I not e= Resi due given i n t he sequence has no preference with respect to that i n t he annotation for said position <400> 104
Al a Al a Ser Ser Leu Q n Ser
1 5 <210> 105 <211> 9 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <220>
<221 > VARI ANT <222> (5) . . (5) <223> / repl ace=Ser <220>
<221 > VARI ANT <222> (6) . . (6) <223> / repl ace= Phe <220>
<221 > rri sc_f eat ur e <222> (5) . . (6) <223> / not e= Resi dues given i n t he sequence have no preference with respect to those i n t he annotations for said positions <400> 105
Leu Q n Tyr Asn I I e Tyr Pro Trp Thr
1 5 <210> 106 <211> 9 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic
Page 66
A1472PCT. t xt
2016244220 11 Oct 2016 pept i de <220>
<221 > VARIANT <222> (8) . . (8) <223> / repl ace=Cys <220>
<221 > rri sc_f eat ur e <222> (8) . . (8) <223> I not e= Resi due given i n t he sequence has no preference with respect to that i n t he annotation for said position <400> 106
G n G n Tyr Gy Asn Ser Leu Ser Arg
1 5 <210> 107 <211> 12 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <220>
<221 > VARI ANT <222> (5) . . (5) <223> / repl ace=Q y <220>
<221 > VARI ANT <222> (6) . . (6) <223> / repl ace= I I e <220>
<221 > VARI ANT <222> (7). . (7) <223> / repl ace=Arg <220>
<221 > VARI ANT <222> (8) . . (8) <223> / r epi ace= Asn or Lys <220>
<221 > rri sc_f eat ur e <222> (5) . . (8) <223> I not e= Resi dues given i n t he sequence have no preference with respect to those i n t he annotations for said positions <220>
<221 > VARI ANT <222> ( 10) . . ( 10) <223> I r epi ace= Asp <220>
<221 > rri sc_f eat ur e <222> ( 10) . . ( 10) <223> / not e= Resi due given i n t he sequence has no preference with respect to that i n t he annotation for said position <220>
Page 67
A1472PCT. t xt
2016244220 11 Oct 2016 <221 > VARIANT <222> ( 12) . . ( 12) <223> / repi ace=G y <220>
<221 > rri sc_f eat ur e <222> ( 12) . . ( 12) <223> / not e= Resi due given i n t he sequence has no preference with respect to that i n t he annotation for said position <400> 107
Arg Al a Ser Gl n Ser Val Ser Ser Q y Tyr Leu Thr
1 5 10 <210> 108 <211> 7 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <220>
<221 > VARI ANT <222> (1)..(1) <223> / repi ace=AI a <220>
<221 > rri sc_f eat ur e <222> (1)..(1) <223> I not e= Resi due given i n t he sequence has no preference with respect to that i n t he annotation for said position <220>
<221 > VARI ANT <222> (5) . . (5) <223> / repi ace=Leu <220>
<221 > VARI ANT <222> (6) . . (6) <223> / repi ace=G n <220>
<221 > VARI ANT <222> (7). . (7) <223> / repi ace=Ser <220>
<221 > rri sc_f eat ur e <222> (5). . (7) <223> I not e= Resi dues given i n t he sequence have no preference with respect to those i n t he annotations for said positions <400> 108
Q y Al a Ser Ser Arg Al a Thr
1 5 <210> 109 <211> 9 <212> PRT <213> Ar t i f i ci al Sequence
Page 68
A1472PCT. t xt
2016244220 11 Oct 2016 <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <220>
<221 > VARIANT <222> (1)..(1) <223> / r epi ace=Leu <220>
<221 > rri sc_f eat ur e <222> (1)..(1) <223> I not e= Resi due given i n t he sequence has no preference with respect to that i n t he annotation for said position <220>
<221 > VARI AhTT <222> (4) . . (4) <223> I r epi ace= Asn <220>
<221 > VARI AlsTT <222> (5) . . (5) <223> / repl ace=Thr <220>
<221 > VARI AlsTT <222> (6) . . (6) <223> / repl ace= Tyr or Phe <220>
<221 > VARI AlsTT <222> (7). . (7) <223> / repl ace= Pro <220>
<221 > VARI AlsTT <222> (8) . . (8) <223> / repl ace=Trp or Ser <220>
<221 > VARI AlsTT <222> (9) . . (9) <223> / repl ace=Thr <220>
<221 > rri sc_f eat ur e <222> (4) . . (9) <223> / not e= Resi dues given i n t he sequence have no preference with respect to those i n t he annotations for said positions <400> 109
Q n Q n Tyr Gl y Asn Ser Leu Cys Arg
1 5 <210> 110 <211> 16 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de
Page 69
A1472PCT. t xt
2016244220 11 Oct 2016 <220>
<221 > VARI ANT <222> ( 10) . . ( 10) <223> / repl ace=AI a <220>
<221 > rri sc_f eat ur e <222> ( 10) . . ( 10) <223> I not e= Resi due given i n t he sequence has no preference with respect to that i n t he annotation for said position <220>
<221 > VARI ANT <222> ( 12) . . ( 12) <223> / repl ace=Lys <220>
<221 > VARI ANT <222> ( 13) . . ( 13) <223> / repl ace=Thr <220>
<221 > rri sc_f eat ur e <222> ( 12) . . ( 13) <223> / not e= Resi dues given i n t he sequence have no preference with respect to those i n t he annotations for said positions <400> 110
Lys Ser Ser Gl n Ser Leu Leu Hi s Ser Asp Q y Arg Asn Tyr Leu Tyr 15 10 15 <210> 111 <211> 16 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <220>
<221 > VARI ANT <222> (1)..(1) <223> / repl ace=Lys <220>
<221 > rri sc_f eat ur e <222> (1)..(1) <223> I not e= Resi due given i n t he sequence has no preference with respect to that i n t he annotation for said position <220>
<221 > VARI ANT <222> ( 10) . . ( 10) <223> / repl ace= Asp or Ala <220>
<221 > rri sc_f eat ur e <222> ( 10) . . ( 10) <223> I not e= Resi due given i n t he sequence has no preference with respect to those i n t he annotations for said position <220>
<221 > VARI ANT
Page 70
A1472PCT. t xt
2016244220 11 Oct 2016 <222> ( 12) . . ( 12) <223> / repl ace= Arg or Lys <220>
<221 > VARIANT <222> ( 13) . . ( 13) <223> / repl ace=Thr <220>
<221 > rri sc_f eat ur e <222> ( 12) . . ( 13) <223> / not e= Resi dues given i n t he sequence have no preference with respect to those i n t he annotations for said positions <220>
<221 > VARI ANT <222> ( 16) . . ( 16) <223> / repl ace=Tyr <220>
<221 > rri sc_f eat ur e <222> ( 16) . . ( 16) <223> / not e= Resi due given i n t he sequence has no preference with respect to that i n t he annotation for said position <400> 111
Arg Ser Ser Gl n Ser Leu Leu Hi s Ser Phe Q y Tyr Asn Tyr Leu Asp 15 10 15 <210> 112 <211> 7 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <220>
<221 > VARI ANT <222> (1)..(1) <223> / repl ace=Q u <220>
<221 > VARI ANT <222> (2) . . (2) <223> / repl ace= Val <220>
<221 > rri sc_f eat ur e <222> (1)..(2) <223> / not e= Resi dues given i n t he sequence have no preference with respect to those i n t he annotations for said positions <220>
<221 > VARI ANT <222> (6) . . (6) <223> / repl ace= Phe <220>
<221 > rri sc_f eat ur e <222> (6) . . (6) <223> I not e= Resi due given i n t he sequence has no preference with respect to that i n t he annotation for said position
Page 71
A1472PCT. t xt
2016244220 11 Oct 2016 <400> 112
Leu Q y Ser Asn Arg Al a Ser 1 5 <210> 113 <211> 9 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <220>
<221 > VARIANT <222> (3) . . (3) <223> / repl ace=Ser <220>
<221 > VARI ANT <222> (4) . . (4) <223> / repl ace= Phe <220>
<221 > VARI ANT <222> (5) . . (5) <223> / repl ace= Pro <220>
<221 > VARI ANT <222> (6) . . (6) <223> / repl ace=Leu <220>
<221 > rri sc_f eat ur e <222> (3) . . (6) <223> I not e= Resi dues given i n t he sequence have no preference with respect to those i n t he annotations for said positions <220>
<221 > VARI ANT <222> (8) . . (8) <223> / repl ace=Leu <220>
<221 > rri sc_f eat ur e <222> (8) . . (8) <223> / not e= Resi due given i n t he sequence has no preference with respect to that i n t he annotation for said position <400> 113
K/bt Q n Al a Leu Q n Thr Pro Phe Thr
1 5 <210> 114 <211> 7 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de
Page 72
A1472PCT. t xt
2016244220 11 Oct 2016 <220>
<221 > VARIANT <222> (2) . . (2) <223> / repl ace=Ser <220>
<221 > rri sc_f eat ur e <222> (2) . . (2) <223> / not e= Resi due given i n t he sequence has no preference with respect to that i n t he annotation for said position <400> 114
Arg Asn Asn Gl n Arg Pro Ser
1 5 <210> 115 <211> 13 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <220>
<221 > VARI ANT <222> (9) . . (9) <223> / repl ace=Ser <220>
<221 > rri sc_f eat ur e <222> (9) . . (9) <223> / not e= Resi due given i n t he sequence has no preference with respect to that i n t he annotation for said position <220>
<221 > VARI ANT <222> (11)..(11) <223> / repl ace=Thr <220>
<221 > rri sc_f eat ur e <222> (11)..(11) <223> / not e= Resi due given i n t he sequence has no preference with respect to that i n t he annotation for said position <220>
<221 > VARI ANT <222> ( 13) . . ( 13) <223> / r epi ace= Asn or Tyr <220>
<221 > rri sc_f eat ur e <222> ( 13) . . ( 13) <223> / not e= Resi due given i n t he sequence has no preference with respect to those i n t he annotation for said position <400> 115
Ser Q y Ser Ser Ser Asn I I e Q y Asn Asn Tyr Val Ser
1 5 10 <210> 116 <211> 7
Page 73
A1472PCT. t xt
2016244220 11 Oct 2016 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <220>
<221 > VARIANT <222> (1)..(1) <223> / repl ace= Thr or Arg <220>
<221 > VARI ANT <222> (2) . . (2) <223> / repl ace=Ser <220>
<221 > rri sc_f eat ur e <222> (1)..(2) <223> / not e= Resi dues given i n t he sequence have no preference with respect to those i n t he annotations for said positions <220>
<221 > VARI ANT <222> (4) . . (4) <223> / repl ace=G n <220>
<221 > rri sc_f eat ur e <222> (4) . . (4) <223> / not e= Resi due given i n t he sequence has no preference with respect to that i n t he annotation for said position <400> 116
Asp Asn Asn Lys Arg Pro Ser
1 5 <210> 117 <211> 11 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <220>
<221 > VARI ANT <222> (1)..(2) <223> / repl ace=AI a <220>
<221 > VARI ANT <222> (3) . . (3) <223> / repl ace=Arg <220>
<221 > rri sc_f eat ur e <222> (1)..(3) <223> I not e= Resi dues given i n t he sequence have no preference with respect to those i n t he annotations for said positions
Page 74
A1472PCT. t xt
2016244220 11 Oct 2016 <220>
<221 > VARIANT <222> (5) . . (5) <223> I r epi ace= Asp <220>
<221 > VARI ANT <222> (6) . . (6) <223> / repl ace=Ser <220>
<221 > rri sc_f eat ur e <222> (5) . . (6) <223> I not e= Resi dues given i n t he sequence have no preference with respect to those i n t he annotations for said positions <220>
<221 > VARI ANT <222> (8) . . (8) <223> I r epi ace= Asn <220>
<221 > VARI ANT <222> (9) . . (9) <223> / repl ace=G y <220>
<221 > rri sc_f eat ur e <222> (8) . . (9) <223> I not e= Resi dues given i n t he sequence have no preference with respect to those i n t he annotations for said positions <400> 117
Q y Thr Trp Asp Ser Arg Leu Ser Al a Val Val
1 5 10 <210> 118 <211> 13 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <220>
<221 > VARI ANT <222> (1)..(1) <223> / repl ace=Q n <220>
<221 > rri sc_f eat ur e <222> (1)..(1) <223> I not e= Resi due given i n t he sequence has no preference with respect to that i n t he annotation for said position <220>
<221 > VARI ANT <222> (3) . . (3) <223> / repl ace= <220>
<221 > VARI ANT <222> (4) . . (4) <223> / r epi ace= Asp
Page 75
A1472PCT. t xt
2016244220 11 Oct 2016
Page 76
A1472PCT. t xt
2016244220 11 Oct 2016 <220>
<221 > VARIANT <222> (1)..(1) <223> / r epi ace= Q y or Thr or Arg <220>
<221 > VARI ANT <222> (2) . . (2) <223> / r epi ace= Lys or Ser <220>
<221 > rri sc_f eat ur e <222> (1)..(2) <223> / not e= Resi dues given i n t he sequence have no preference with respect to those i n t he annotations for said positions <220>
<221 > VARI ANT <222> (4) . . (4) <223> / repl ace= Asn or Gn <220>
<221 > rri sc_f eat ur e <222> (4) . . (4) <223> / not e= Resi due given i n t he sequence has no preference with respect to those i n t he annotations for said position <400> 119
Asp Asn Asn Lys Arg Pro Ser
1 5 <210> 120 <211> 11 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <220>
<221 > VARI ANT <222> (1)..(1) <223> / repl ace= Asn or Ala <220>
<221 > VARI ANT <222> (2) . . (2) <223> / repl ace= Ser or Ala <220>
<221 > VARI ANT <222> (3) . . (3) <223> / repl ace=Arg <220>
<221 > rri sc_f eat ur e <222> (1)..(3) <223> / not e= Resi dues given i n t he sequence have no preference with respect to those i n t he annotations for said positions <220>
<221 > VARI ANT <222> (5) . . (5)
Page 77
A1472PCT. t xt
2016244220 11 Oct 2016 <223> I r epi ace= Asp <220>
<221 > VARIANT <222> (6) . . (6) <223> / repl ace=Ser <220>
<221 > VARI ANT <222> (7). . (7) <223> / repl ace= Val <220>
<221 > VARI ANT <222> (8) . . (8) <223> / repl ace= Tyr or Asn <220>
<221 > VARI ANT <222> (9) . . (9) <223> / r epi ace= Hi s or Qy <220>
<221 > VARI ANT <222> ( 10) . . ( 10) <223> / repl ace=Leu <220>
<221 > rri sc_f eat ur e <222> (5) . . ( 10) <223> / not e= Resi dues given i n t he sequence have no preference with respect to those i n t he annotations for said positions <400> 120
Q y Thr Trp Asp Ser Arg Leu Ser Al a Val Val
1 5 10 <210> 121 <211> 5 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <220>
<221 > VARI ANT <222> (1)..(1) <223> / r epi ace= Asp <220>
<221 > rri sc_f eat ur e <222> (1)..(1) <223> I not e= Resi due given i n t he sequence has no preference with respect to that i n t he annotation for said position <220>
<221 > VARI ANT <222> (5) . . (5) <223> / repl ace=Tyr <220>
<221 > rri sc_f eat ur e <222> (5) . . (5)
Page 78
2016244220 11 Oct 2016
A1472PCT. t xt <223> I not e= Resi due given i n t he sequence has no preference with respect to that i n t he annotation for said position <400> 121
Q y Tyr Tyr IVfet Hi s
1 5 <210> 122 <211> 17 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <220>
<221 > VARIANT <222> (3) . . (3) <223> / repl ace=Ser <220>
<221 > rri sc_f eat ur e <222> (3) . . (3) <223> I not e= Resi due given i n t he sequence has no preference with respect to that i n t he annotation for said position <400> 122
Trp lie Asn Pro Asn Ser Qy Qy Thr Asn Tyr Ala Qn Lys Phe Q n 15 10 15
Gy <210> 123 <211> 21 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <220>
<221 > VARI ANT <222> (1)..(2) <223> / repl ace=Q y <220>
<221 > VARI ANT <222> (3) . . (3) <223> / repl ace=Tyr <220>
<221 > rri sc_f eat ur e <222> (1)..(3) <223> I not e= Resi dues given i n t he sequence have no preference with respect to those i n t he annotations for said positions <220>
<221 > VARI ANT
Page 79
A1472PCT. t xt
2016244220 11 Oct 2016 <222> (5) . . (5) <223> / repl ace=Q y <220>
<221 > VARIANT <222> (6) . . (6) <223> / repl ace=Tyr <220>
<221 > VARI ANT <222> (7). . (7) <223> / repl ace=AI a <220>
<221 > VARI ANT <222> (8) . . (9) <223> / repl ace= <220>
<221 > rri sc_f eat ur e <222> (5) . . (9) <223> I not e= Resi dues given i n t he sequence have no preference with respect to those i n t he annotations for said positions <220>
<221 > VARI ANT <222> (11)..(11) <223> / repl ace=Leu <220>
<221 > VARI ANT <222> ( 12) . . ( 12) <223> / repl ace=Tyr <220>
<221 > VARI ANT <222> ( 13) . . ( 13) <223> / repl ace=Ser <220>
<221 > VARI ANT <222> ( 14) . . ( 14) <223> / repl ace=Hi s <220>
<221 > rri sc_f eat ur e <222> (11)..(14) <223> / not e= Resi dues given i n t he sequence have no preference with respect to those i n t he annotations for said positions <220>
<221 > VARI ANT <222> ( 17) . . ( 17) <223> / repl ace= <220>
<221 > rri sc_f eat ur e <222> ( 17) . . ( 17) <223> / not e= Resi due given i n t he sequence has no preference with respect to that i n t he annotation for said position <400> 123
Page 80
A1472PCT. t xt
2016244220 11 Oct 2016 <210> 124 <211> 19 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <220>
<221 > VARIANT <222> (5) . . (5) <223> / repl ace=Thr <220>
<221 > rri sc_f eat ur e <222> (5) . . (5) <223> I not e= Resi due given i n t he sequence has no preference with respect to that i n t he annotation for said position <220>
<221 > VARIANT <222> ( 14) . . ( 14) <223> / repl ace=AI a <220>
<221 > rri sc_f eat ur e <222> ( 14) . . ( 14) <223> / not e= Resi due given i n t he sequence has no preference with respect to that i n t he annotation for said position <400> 124
Arg lie Lys Ser Lys Thr Asp Gy Gy Thr Thr Asp Tyr Thr Ala Pro 15 10 15
Val Lys Q y <210> 125 <211> 5 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <220>
<221 > VARIANT <222> (1)..(1) <223> / repl ace=Ser <220>
<221 > rri sc_f eat ur e <222> (1)..(1) <223> I not e= Resi due given i n t he sequence has no preference with respect to that i n t he annotation for said position <220>
<221 > VARIANT
Page 81
A1472PCT. t xt
2016244220 11 Oct 2016 <222> (3) . . (3) <223> / repl ace=AI a <220>
<221 > rri sc_f eat ur e <222> (3) . . (3) <223> / not e= Resi due given i n t he sequence has no preference with respect to that i n t he annotation for said position <220>
<221 > VARIANT <222> (5) . . (5) <223> / repl ace=Ser <220>
<221 > rri sc_f eat ur e <222> (5) . . (5) <223> I not e= Resi due given i n t he sequence has no preference with respect to that i n t he annotation for said position <400> 125
Thr Tyr Ser IVht Asn
1 5 <210> 126 <211> 17 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <220>
<221 > VARI ANT <222> (1)..(1) <223> / repl ace=AI a <220>
<221 > rri sc_f eat ur e <222> (1)..(1) <223> I not e= Resi due given i n t he sequence has no preference with respect to that i n t he annotation for said position <220>
<221 > VARI ANT <222> (4) . . (4) <223> / repl ace=G y <220>
<221 > rri sc_f eat ur e <222> (4) . . (4) <223> / not e= Resi due given i n t he sequence has no preference with respect to that i n t he annotation for said position <220>
<221 > VARI ANT <222> (6) . . (7) <223> / repl ace=G y <220>
<221 > VARI ANT <222> (8) . . (8) <223> / repl ace=Arg
Page 82
A1472PCT. t xt
2016244220 11 Oct 2016 <220>
<221 > VARIANT <222> (9) . . (9) <223> / repl ace=Thr <220>
<221 > rri sc_f eat ur e <222> (6) . . (9) <223> / not e= Resi dues given i n t he sequence have no preference with respect to those i n t he annotations for said positions <400> 126
Ser I I e Ser Ser Ser Ser Ser Tyr Arg Tyr Tyr Al a Asp Ser Val Lys 15 10 15
Gy <210> 127 <211> 22 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <220>
<221 > VARIANT <222> (1)..(1) <223> / r epi ace= Asp <220>
<221 > VARIANT <222> (2) . . (2) <223> / repl ace=G n <220>
<221 > VARIANT <222> (3) . . (3) <223> / repl ace=Arg <220>
<221 > VARIANT <222> (4) . . (4) <223> / repl ace=G U <220>
<221 > VARIANT <222> (5) . . (5) <223> / repl ace= Val <220>
<221 > VARIANT <222> (6) . . (6) <223> / repl ace=G y <220>
<221 > VARIANT <222> (7). . (7) <223> / repl ace= <220>
<221 > rri sc_f eat ur e
Page 83
A1472PCT. t xt
2016244220 11 Oct 2016 <222> (1)..(7) <223> I not e= Resi dues given i n t he sequence have no preference with respect to those i n t he annotations for said positions <220>
<221 > VARIANT <222> (11)..(11) <223> / repl ace=Ser <220>
<221 > VARIANT <222> ( 12) . . ( 12) <223> / repl ace=Q y <220>
<221 > rri sc_f eat ur e <222> (11)..(12) <223> / not e= Resi dues given i n t he sequence have no preference with respect to those i n t he annotations for said positions <400> 127
G u G y Val Ser Gy Ser Ser Pro Tyr Ser lie Ser Trp Tyr Asp Tyr 15 10 15
Tyr Tyr Q y IVbt Asp Val 20 <210> 128 <211> 5 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <220>
<221 > VARIANT <222> (2) . . (2) <223> / repl ace=Tyr <220>
<221 > rri sc_f eat ur e <222> (2) . . (2) <223> / not e= Resi due given i n t he sequence has no preference with respect to that i n t he annotation for said position <400> 128
Ser Phe Q y K/bt Hi s
1 5 <210> 129 <211> 17 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <220>
Page 84
A1472PCT. t xt
2016244220 11 Oct 2016 <221 > VARIANT <222> (4) . . (4) <223> / repi ace=Tyr <220>
<221 > rri sc_f eat ur e <222> (4) . . (4) <223> / not e= Resi due given i n t he sequence has no preference with respect to that i n t he annotation for said position <220>
<221 > VARIANT <222> (8) . . (8) <223> / repi ace=Hi s <220>
<221 > rri sc_f eat ur e <222> (8) . . (8) <223> / not e= Resi due given i n t he sequence has no preference with respect to that i n t he annotation for said position <220>
<221 > VARIANT <222> (11)..(11) <223> / repi ace=Tyr <220>
<221 > VARIANT <222> ( 12) . . ( 12) <223> / repi ace=AI a <220>
<221 > rri sc_f eat ur e <222> (11)..(12) <223> / not e= Resi dues given i n t he sequence have no preference with respect to those i n t he annotations for said positions <400> 129
Val lie Ser Phe Asp Q y Ser I I e Lys Tyr Ser Val Asp Ser Val Lys 15 10 15
Gy <210> 130 <211> 21 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <220>
<221 > VARIANT <222> (1)..(1) <223> / repi ace=G U <220>
<221 > rri sc_f eat ur e <222> (1)..(1) <223> I not e= Resi due given i n t he sequence has no preference with respect to that i n t he annotation for said position
Page 85
A1472PCT. t xt
2016244220 11 Oct 2016 <220>
<221 > VARIANT <222> (3) . . (3) <223> / repl ace=Lys <220>
<221 > VARIANT <222> (4) . . (4) <223> / repl ace=Arg <220>
<221 > VARIANT <222> (5) . . (5) <223> / repl ace= Val <220>
<221 > VARIANT <222> (6) . . (6) <223> / repl ace=Thr <220>
<221 > VARIANT <222> (7). . (7) <223> / repl ace=M3t <220>
<221 > rri sc_f eat ur e <222> (3) . . (7) <223> / not e= Resi dues given i n t he sequence have no preference with respect to those i n t he annotations for said positions <220>
<221 > VARIANT <222> (9) . . (9) <223> / repl ace=Thr <220>
<221 > VARIANT <222> ( 10) . . ( 10) <223> / repl ace=Leu <220>
<221 > rri sc_f eat ur e <222> (9) . . ( 10) <223> / not e= Resi dues given i n t he sequence have no preference with respect to those i n t he annotations for said positions <220>
<221 > VARIANT <222> ( 13) . . ( 13) <223> / repl ace=Tyr <220>
<221 > VARIANT <222> ( 14) . . ( 14) <223> / repl ace= <220>
<221 > VARIANT <222> ( 15) . . ( 15) <223> / repl ace= Phe <220>
<221 > rri sc_f eat ur e <222> ( 13) . . ( 15) <223> I not e= Resi dues given i n t he sequence have no preference with respect to those i n t he annotations for said positions
Page 86
A1472PCT. t xt
2016244220 11 Oct 2016 <220>
<221 > VARI ANT <222> ( 19) . . ( 19) <223> / repl ace=Leu <220>
<221 > VARI ANT <222> (20) . . (20) <223> I r epi ace= Asp <220>
<221 > rri sc_f eat ur e <222> ( 19) . . (20) <223> I not e= Resi dues given i n t he sequence have no preference with respect to those i n t he annotations for said positions <400> 130
Asp Arg Leu Asn Tyr Tyr Asp Ser Ser Qy Tyr Tyr His Tyr Lys Tyr 15 10 15
Tyr Q y IVfet Al a Val 20 <210> 131 <211> 5 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <220>
<221 > VARI ANT <222> (1)..(1) <223> / repl ace=Ser <220>
<221 > VARI ANT <222> (2) . . (2) <223> / repl ace= Tyr or Phe <220>
<221 > VARI ANT <222> (3) . . (3) <223> / r epi ace= Al a or Qy <220>
<221 > rri sc_f eat ur e <222> (1)..(3) <223> / not e= Resi dues given i n t he sequence have no preference with respect to those i n t he annotations for said positions <220>
<221 > VARI ANT <222> (5) . . (5) <223> / repl ace=Hi s <220>
<221 > rri sc_f eat ur e <222> (5) . . (5) <223> I not e= Resi due given i n t he sequence has no preference with respect to that i n t he annotation for said position
Page 87
A1472PCT. t xt
2016244220 11 Oct 2016 <400> 131
Asn Al a Tr p IVbt Ser 1 5 <210> 132 <211> 19 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <220>
<221 > VARIANT <222> (1)..(1) <223> / r epi ace= Al a or Val <220>
<221 > rri sc_f eat ur e <222> (1)..(1) <223> I not e= Resi due given i n t he sequence has no preference with respect to those i n t he annotations for said position <220>
<221 > VARI ANT <222> (3) . . (3) <223> / repl ace= Ser or Trp <220>
<221 > VARIANT <222> (4) . . (4) <223> / repl ace=G y or Phe or Tyr <220>
<221 > VARIANT <222> (5) . . (5) <223> / repl ace=Thr or <220>
<221 > VARIANT <222> (6) . . (6) <223> / repl ace= <220>
<221 > VARIANT <222> (7). . (7) <223> / repl ace=Ser <220>
<221 > rri sc_f eat ur e <222> (3) . . (7) <223> I not e= Resi dues given i n t he sequence have no preference with respect to those i n t he annotations for said positions <220>
<221 > VARIANT <222> (9) . . (9) <223> / repl ace=Ser <220>
<221 > VARIANT <222> ( 10) . . ( 10) <223> / repl ace=Arg or lie or Asn or His
Page 88
A1472PCT. t xt
2016244220 11 Oct 2016 <220>
<221 > VARIANT <222> (11)..(11) <223> / repl ace=Lys <220>
<221 > VARIANT <222> ( 12) . . ( 12) <223> / repl ace=Tyr <220>
<221 > VARIANT <222> ( 13) . . ( 13) <223> / repl ace=Ser <220>
<221 > VARIANT <222> ( 14) . . ( 14) <223> / r epi ace= Al a or Val <220>
<221 > VARIANT <222> ( 15) . . ( 15) <223> I r epi ace= Asp <220>
<221 > VARIANT <222> ( 16) . . ( 16) <223> / repl ace=Ser <220>
<221 > rri sc_f eat ur e <222> (9) . . ( 16) <223> I not e= Resi dues given i n t he sequence have no preference with respect to those i n t he annotations for said positions <400> 132
Arg lie Lys Ser Lys Thr Asp Gy Gy Thr Thr Asp Tyr Thr Ala Pro 15 10 15
Val Lys Q y <210> 133 <211> 21 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <220>
<221 > VARIANT <222> (1)..(1) <223> / r epi ace= Al a or Gu <220>
<221 > VARIANT <222> (2) . . (2) <223> / repl ace=Q n or Gy <220>
<221 > VARIANT
Page 89
A1472PCT. t xt
2016244220 11 Oct 2016
G y or
I I e or
Al a or
Al a or
Tyr
Lys
Arg
Thr
Page 90
A1472PCT. t xt
2016244220 11 Oct 2016 <220>
<221 > rri sc_f eat ur e <222> (1)..(17) <223> / not e= Resi dues given i n t he sequence have no preference with respect to those i n t he annotations for said positions <220>
<221 > VARIANT <222> ( 19) . . ( 19) <223> / repl ace=|_eu <220>
<221 > VARIANT <222> (20) . . (20) <223> / repl ace=AI a <220>
<221 > rri sc_f eat ur e <222> ( 19) . . (20) <223> I not e= Resi dues given i n t he sequence have no preference with respect to those i n t he annotations for said positions
Trp Ser Ser Trp Tyr Tyr Tyr Tyr 10 15 <210> 134 <211> 5 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <220>
<221 > VARIANT <222> (1)..(1) <223> / r epi ace= Q y or Asp or Ser or Ala <220>
<221 > VARIANT <222> (2) . . (2) <223> / repl ace= Phe or Tyr <220>
<221 > VARIANT <222> (3) . . (3) <223> / r epi ace= Tyr or Ala or Gy <220>
<221 > VARIANT <222> (4) . . (4) <223> / repl ace=|_eu <220>
<220>
<221 > VARIANT <222> (5) . . (5) <223> / repl ace=Hi s
Page 91
A1472PCT. t xt
2016244220 11 Oct 2016 <221 > rri sc_f eat ur e <222> (1)..(5) <223> I not e= Resi dues given i n t he sequence have no preference with respect to those i n t he annotations for said positions <400> 134
Asn Al a Tr p IVfet Ser 1 5 <210> 135 <211> 19 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of pept i de t i f i ci al Sequence: Synt het i c or Val or Ser or Phe <220>
<221 > VARIANT <222> (1)..(1) <223> / repl ace=Trp or Ala <220>
Trp or Arg
Phe or Tyr
II II
Ser or Tyr <220>
e sequence has no preference with notations for said position lie or Asn or His or Tyr
Page 92
A1472PCT. t xt
2016244220 11 Oct 2016 <221 > <222> <223>
<220> <221 > <222> <223>
<220> <221 > <222> <223>
VARI ANT (11)--(11) / r epi ace= Lys or Arg or Pro
VARI ANT (12). (12) / repl ace=Asn or Tyr or Gu
VARI ANT (13). (13) / r epi ace= Ser <220> <221 > <222> <223>
VARI ANT (14). (14) / repl ace=AI a or Val <220> <221 > <222> <223>
<220> <221 > <222> <223>
<220> <221 > <222> <223>
VARI ANT (15). (15) / repl ace=G n or Asp
VARI ANT (16). (16) /repl ace= Lys or Ser
VARI ANT (17). (17) /repl ace= Phe <220> <221 > <222> <223>
VARI ANT (18). (18) /repl ace=Q n <220> <221 > <222> <223>
<400> Arg I I 1 rri sc_f eat ur e (3). . (18)
I not e= Resi dues given i n t he sequence have no preference with respect to those i n t he annotations for said positions
135 e Lys Ser Lys Thr Asp Q y Q y Thr Thr Asp Tyr Thr Al a Pro 5 10 15
Val Lys Q y <210> 136 <211> 21 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <220>
<221 > VARIANT <222> (1)..(1)
Page 93
2016244220 11 Oct 2016
Lys <220>
<221 > VARIANT <222> ( 14) . . ( 14) <223> / repl ace= Pro or Asp or His or <220>
Page 94
A1472PCT. t xt
2016244220 11 Oct 2016 <221 > VARIANT <222> ( 15) . . ( 15) <223> /repl ace= Lys or Phe <220>
<221 > VARIANT <222> ( 16) . . ( 17) <223> / repl ace= <220>
<221 > rri sc_f eat ur e <222> (1)..(17) <223> / not e= Resi dues given i n t he sequence have no preference with respect to those i n t he annotations for said positions <220>
<221 > VARIANT <222> ( 19) . . ( 19) <223> / repl ace=Leu <220>
<221 > VARIANT <222> (20) . . (20) <223> / repl ace=AI a <220>
<221 > rri sc_f eat ur e <222> ( 19) . . (20) <223> / not e= Resi dues given i n t he sequence have no preference with respect to those i n t he annotations for said positions <400> 136
Asp Arg Thr Gly Tyr Ser 1 5 e Ser Trp Ser Ser Phe Tyr Tyr Tyr 10 15
Tyr
Tyr Q y K/bt Asp Val 20 <210> 137 <211> 110 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 137
G n
Asn
Leu
Ser
Thr G y Leu G n
Page 95
A1472PCT. t xt
2016244220 11 Oct 2016
100 105 110 <210> 138 <211> 110 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 138
100 105 110 <210> 139 <211> 107 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 139
20 25 30
Page 96
A1472PCT. t xt
2016244220 11 Oct 2016
100 105 <210> 140 <211> 108 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 140
<210> 141 <211> 112 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic
Page 97
A1472PCT. t xt
2016244220 11 Oct 2016 pol ypept i de <400> 141
100 105 110 <210> 142 <211> 110 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 142
Q n Ser Val Leu Thr On Pro Pro Ser Val Ser Al a Al a Pro Qy Qn 15 10 15
Lys Val Thr I I e Ser Cys Ser Q y Ser Ser Ser Asn I I e Q y Asn Asn 20 25 30
Tyr Val Ser Trp Tyr Q n Q n Leu Pro Qy Thr Al a Pro Lys Leu Leu 35 40 45
I I e Tyr Asp Asn Asn Lys Arg Pro Ser Qy lie Pro Asp Arg Phe Ser 50 55 60
Q y Ser Lys Ser Q y Thr Ser Thr Thr Leu Q y I I e Thr Q y Leu Q n 65 70 75 80
Thr G y Asp G u Al a Asp Tyr Tyr Cys G y Thr Trp Asp Ser Arg Leu 85 90 95
Ser Al a Val Val Phe Q y Q y Q y Thr Lys Leu Thr Val Leu 100 105 110
Page 98
A1472PCT. t xt
2016244220 11 Oct 2016 <210> 143 <211> 112 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 143
<210> 144 <211> 112 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 144
50 55 60
Page 99
A1472PCT. t xt
2016244220 11 Oct 2016
100 105 110 <210> 145 <211> 110 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 145
100 105 110 <210> 146 <211> 110 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 146
20 25 30
Page 100
A1472PCT. t xt
2016244220 11 Oct 2016
100 105 110 <210> 147 <211> 110 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de
<210> 148 <211> 110 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source
Page 101
2016244220 11 Oct 2016
A1472PCT. t xt <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 148
100 105 110 <210> 149 <211> 112 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 149
2016244220 11 Oct 2016
A1472PCT. t xt
100 105 110 <210> 150 <211> 110 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 150
100 105 110 <210> 151 <211> 107 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 151
50 55 60
Page 103
A1472PCT. t xt
2016244220 11 Oct 2016
100 105 <210> 152 <211> 108 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 152
100 105 <210> 153 <211> 108 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 153
Qu lie Val Leu Thr Q n Ser Pro Qy Thr Leu Ser Leu Ser Pro Qy
15 10 15
Qu Arg Al a Thr Leu Ser Cys Arg Al a Ser Q n Ser Val Ser Ser Q y Page 104
A1472PCT. t xt
2016244220 11 Oct 2016
100 105 <210> 154 <211> 113 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de
Lys <210> 155 <211> 107
Page 105
A1472PCT. t xt
2016244220 11 Oct 2016 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 155
<210> 156 <211> 108 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 156
Page 106
2016244220 11 Oct 2016
A1472PCT. t xt
Q u Asp Phe Al a Val Tyr Tyr Cys Q n Q n Tyr Asn Tyr Trp Thr Pro 85 90 95
I I e Thr Phe Gl y Q n Gy Thr Arg Leu Guile Lys 100 105 <210> 157 <211> 110 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 157
100 105 110 <210> 158 <211> 130 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 158
35 40 45
Page 107
A1472PCT. t xt
2016244220 11 Oct 2016
115 120
125
Page 108
A1472PCT. t xt
2016244220 11 Oct 2016
Val Ser Ser 130 <210> 160 <211> 130 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 160
115 120 125
Ser Ser 130 <210> 161 <211> 130 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 161
Q n Val Qn Leu Val Q n Ser Qy Ala Qu Val Lys Lys Pro Qy Al a
15 10 15
Ser Val Lys Val Ser Cys Lys Al a Ser Q y Tyr Thr Phe Thr Q y Tyr Page 109
A1472PCT. t xt
2016244220 11 Oct 2016
115 120 125
Ser Ser 130 <210> 162 <211> 129 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de
Page 110
A1472PCT. t xt
2016244220 11 Oct 2016
Tyr Tyr Q y IVbt Asp Val Trp Gly Qn Qy Thr Thr 115 120
Val Thr Val Ser 125
Ser <210> 163 <211> 121 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 163
<210> 164 <211> 131 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 164
Q u Val Qn Leu Val Q u Ser Qy Qy Qy Leu Val Lys Pro Qy Qy
15 10 15
Page 111
A1472PCT. t xt
2016244220 11 Oct 2016
115
120
125
Val Ser Ser 130 <210> 165 <211> 127 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 165
Page 112
2016244220 11 Oct 2016
A1472PCT. t xt
100 105 110
Q y Lfet Asp Val Trp Gy Qn Gy Thr Thr Val Thr Val Ser Ser 115 120 125 <210> 166 <211> 131 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 166
Val Ser Ser 130 <210> 167 <211> 131 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 167
G u Val Gn Leu Val Q u Ser Gy Gy Gy Leu Val Lys Pro Gy Gy
15 10 15
Page 113
A1472PCT. t xt
2016244220 11 Oct 2016
130 <210> 168 <211> 130 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 168
Q n Val Gl n Leu Val Q u Ser Qy Qy Gly Val Val Qn Pro Qy Arg 15 10 15
Ser Leu Arg Leu Ser Cys Al a Al a Ser Q y Phe Thr Phe Ser Ser Phe 20 25 30
Q y IVfet Hi s Trp Val Arg Q n Al a Pro Q y Lys Q y Leu Qu Trp Val 35 40 45
Al a Val lie Ser Phe Asp Q y Ser I I e Lys Tyr Ser Val Asp Ser Val 50 55 60
Lys Qy Arg Phe Thr I I e Ser Arg Asp Asn Ser Lys Asn Thr Leu Phe 65 70 75 80
Leu Q n IVbt Asn Ser Leu Arg Al a Qu Asp Thr Al a Val Tyr Tyr Cys 85 90 95
Page 114
A1472PCT. t xt
2016244220 11 Oct 2016
115 120 125
Ser Ser 130 <210> 169 <211> 131 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 169
130 <210> 170 <211> 126 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de
Page 115
A1472PCT. t xt
2016244220 11 Oct 2016 <400> 170
pol ypept i de <400> 171
Page 116
A1472PCT. t xt
2016244220 11 Oct 2016
Al a Arg Qy Arg Qn Trp Leu Q y Phe Asp Tyr Trp Gy Gn Gy Thr 100 105 110
Leu Val Thr Val Ser Ser 115 <210> 172 <211> 117 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 172
115 <210> 173 <211> 120 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 173
G n Val G n Leu Val Q n Ser G y Al a G u Val Lys Lys Ser G y Al a
15 10 15
Ser Val Lys Val Ser Cys Lys Al a Ser Q y Tyr Thr Phe Thr Q y Tyr Page 117
A1472PCT. t xt
2016244220 11 Oct 2016
115 120 <210> 174 <211> 118 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 174
Leu Val Thr Val Ser Ser 115
Page 118
A1472PCT. t xt
2016244220 11 Oct 2016 <210> 175 <211> 321 <212> DNA <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ynucl eot i de <400> 175
<210> 176 <211> 321 <212> DNA <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ynucl eot i de <400> 176
<210> 177 <211> 359 <212> DNA <213> Ar t i f i ci al Sequence
Page 119
A1472PCT. t xt
2016244220 11 Oct 2016 t ggagct gag caggct gaga t ct gacgaca cggccgt gt a 11 act gt gcg agaaat gagt at agcagt gc ct ggccct t g gggt at t ggg gccagggaac cct ggt cacc gt ct ct agt <210> 178 <211> 336 <212> DNA <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ynucl eot i de <400> 178 gat at t gt ga at ct cct gca t acct gcaga t ccggggt cc agcagagt gg 11 cact 11 eg t gact cagt c ggt ct agt ca agccagggca ct gacaggt t agget gagga gccct gggac t ccact ct cc gagcct cct g gt ct ccacag cagt ggcagt tgt t ggggt t caaagt ggat ct gcccgt ca cat agt 111 g ct cct gat ct ggat caggca t at t act gca at caaa cccct ggaga ggt acaact a at 11 gggt t c cagat 111 ac t gcaagct ct gccggcct cc 111 ggat t gg t aat egggee act gaaaat c acaaact cca
300
359
120
180
240
300
336 <210> 179 <211> 336 <212> DNA <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Arti pol ynucl eot i de <400> 179 gat at t at ac at ct cct gca t acct gcaga t ct ggagt gc agccgggt gg ct cact 11 eg t ggcccagac agt ct agt ca agccaggcca cagat aggt t agget gagga gcggagggac t ccact 11 ct gagcct cct g gcct ccacag cagt ggcagc t gt t gggat t caaggt ggag f i ci al ct gt ccgt ca cacagt get g ct cct gat ct gggt caggga t at t act gca at caaa
Sequence:
Synt het i cccct ggaca gaaagacct a at gaagt 11 c cagat 11 cac t gcaaagt 11 c
gccggcct cc 111 gt at t gg caaccggt t c act gaaaat c t ccgct t ccg
120
180
240
300
336 <210> 180 <211> 336 <212> DNA <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ynucl eot i de <400> 180 gat at t at t c tgacccagac t ccact 11 ct ct gt ccgt ca cccct ggaca gccggcct cc at ct cct gca agt ct agt ca gagcct cct g cacagt gat g gaaagacct a 111 gt at t gg Page 120
120
A1472PCT. t xt
2016244220 11 Oct 2016 t acct gcaga t ct ggagagc agccgggt gg ct cact 11 eg agcccggcca cagat aggt t agget gagga gcggagggac gcct ccacag cagt ggcagc t gt t gggact caaggt ggag ct cct gat ct gggt caggga t at t at t gca at caaa at gaagt 11 c cagat 11 cac t gcaaagt 11 caaccggt t c act gaaaat c t ccgct t ccg <210> 181 <211> 336 <212> DNA <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ynucl eot i de
180
240
300
336
caggggacca aget ggagat caaa
324 <210> 183 <211> 324 <212> DNA <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ynucl eot i de
Page 121
A1472PCT. t xt
2016244220 11 Oct 2016
<210> 184 <211> 324 <212> DNA <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ynucl eot i de <400> 184
<210> 185 <211> 339 <212> DNA <213> Ar t i f i ci al Sequence
<210> 186 <211> 330 <212> DNA <213> Ar t i f i ci al Sequence <220>
Page 122
A1472PCT. t xt
2016244220 11 Oct 2016 <221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ynucl eot i de <400> 186
<210> 187 <211> 330 <212> DNA <213> Ar t i f i ci al Sequence
<210> 188 <211> 330 <212> DNA <213> Ar t i f i ci al Sequence
<210> 189 <211> 330
Page 123
A1472PCT. t xt
2016244220 11 Oct 2016 <212> DNA <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ynucl eot i de <400> 189
<210> 190 <211> 330 <212> DNA <213> Ar t i f i ci al Sequence
<210> 191 <211> 330 <212> DNA <213> Ar t i f i ci al Sequence
Page 124
A1472PCT. t xt
2016244220 11 Oct 2016 <210> 192 <211> 330 <212> DNA <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ynucl eot i de <400> 192
<210> 193 <211> 330 <212> DNA <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ynucl eot i de <400> 193
<210> 194 <211> 330 <212> DNA <213> Ar t i f i ci al Sequence
Page 125
A1472PCT. t xt
2016244220 11 Oct 2016 t ccgaggat g aggct gact a 11 at t gt gca gcat gggat g acagcct gag t ggt t gggt g 300 ttcggcggag ggaccaagct gaccgtccta 330 <210> 195 <211> 324 <212> DNA <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ynucl eot i de
<210> 196 <211> 390 <212> DNA <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ynucl eot i de <400> 196
<210> 197 <211> 381 <212> DNA <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ynucl eot i de <400> 197 caggt gcagc t ggt gcagt c t ggggct gag gt gaagaagc ct ggggcct c agt gaaggt c 60
Page 126
A1472PCT. t xt
2016244220 11 Oct 2016
<210> 198 <211> 354 <212> DNA <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ynucl eot i de
<210> 199 <211> 321 <212> DNA <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ynucl eot i de <400> 199
<210> 200 <211> 393 <212> DNA <213> Ar t i f i ci al Sequence <220>
Page 127
A1472PCT. t xt
2016244220 11 Oct 2016 <221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ynucl eot i de <400> 200
<210> 201 <211> 393 <212> DNA <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ynucl eot i de <400> 201
<210> 202 <211> 393 <212> DNA <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Arti pol ynucl eot i de <400> 202 gaggt acagc t cct gt gcag ccagggaagg gact acgct g ct gt at ct gc gat cggaccg t ggt ggagt c cct ct ggat t ggct ggagt g cacccgt gaa aaat gaacag ggt at agcat tgggggaggc cact 11 cggt ggt t ggccgt aggcagat t c cct gaaaacc cagct ggt ct f i ci al
11 ggt aaagc aacgcct gga at t aaaagca accat ct caa gaggacacag agt t act act
Page 128
Sequence:
Synt het i ct ggggggt c t gagct gggt aaact gat gg gagat gat t c ccgt gt at t a act act acgg c
cct t agact c ccgccaggct t gggacaaca aaaaaacacg ct gt accaca t at ggacgt c
120
180
240
300
360
A1472PCT. t xt
2016244220 11 Oct 2016 tggggccaag ggaccacggt caccgtctct agt 393 <210> 203 <211> 393 <212> DNA <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ynucl eot i de <400> 203
<210> 204 <211> 393 <212> DNA <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ynucl eot i de <400> 204
<210> 205 <211> 390 <212> DNA <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ynucl eot i de <400> 205 gaggt gcagc t at t ggagt c t gggggaggc 11 ggt acagc ct ggggagt c cct gagact c 60
Page 129
A1472PCT. t xt
2016244220 11 Oct 2016 t cct gt gcag ccagggaagg gcagact ccg ct gcaaat ga agggaggtag ggccaaggga
<210> 206 <211> 387 <212> DNA <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ynucl eot i de <400> 206
<210> 207 <211> 390 <212> DNA <213> Ar t i f i ci al Sequence
<210> 208 <211> 390
Page 130
A1472PCT. t xt
2016244220 11 Oct 2016 <212> DNA <213> Ar t i f i ci al Sequence
<210> 209 <211> 363 <212> DNA <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ynucl eot i de <400> 209
<210> 210 <211> 378 <212> DNA <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ynucl eot i de <400> 210 caggt gcagc t cct gt gcag ccaggcaagg gcagact ccg t ggt ggagt c cgt ct ggat t ggct ggagt g t gaagggccg tgggggaggc cacct t cagt ggt ggcagt t at t cat cat c gt ggt ccagc agct at ggca at at ggt at g t ccagagat a Page 131 ct gggaggt c t gcact gggt at ggaagt aa aat ccaagaa cct gagact c ccgccaggct t aaat act at cacgct gt at
120
180
240
A1472PCT. t xt
2016244220 11 Oct 2016
<210> 212 <211> 354 <212> DNA <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ynucl eot i de <400> 212
<210> 213 <211> 13 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pept i de <400> 213
Gy Gy Gy Gy Gy Val Asp G y G y G y G y G y Val Page 132
2016244220 11 Oct 2016
A1472PCT. t xt
1 5 10 <210> 214 <211> 148 <212> PRT <213> Rat t us sp.
<400> 214
145 <210> 215 <211> 148 <212> PRT
A1472PCT. t xt
2016244220 11 Oct 2016
145 <210> 216 <211> 148 <212> PRT
Page 134
A1472PCT. t xt
2016244220 11 Oct 2016
G u G y I I e Val 145 <210> 217 <211> 148 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 217
130 135 140
G u G y I I e Val 145 <210> 218 <211> 148 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 218
IVbt Al a Arg Al a Leu Cys Arg Leu Pro Arg Arg Gy Leu Trp Leu Leu Page 135
A1472PCT. t xt
2016244220 11 Oct 2016
Page 136
A1472PCT. t xt
2016244220 11 Oct 2016
145 <210> 220 <211> 464 <212> PRT <213> Rat t us sp.
<400> 220
Page 137
2016244220 11 Oct 2016
Page 138
2016244220 11 Oct 2016
Page 139
A1472PCT. t xt
2016244220 11 Oct 2016
<400> 222
Page 140
A1472PCT. t xt
2016244220 11 Oct 2016
Page 141
A1472PCT. t xt
2016244220 11 Oct 2016
<210> 223 <211> 460 <212> PRT <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ypept i de <400> 223
K/bt Q u Lys Lys Cys Thr Leu Tyr Phe Leu Val Leu Leu Pro Phe Phe 15 10 15
IVfet I I e Leu Val Thr Ala Q u Ser Gu G u Gy Ala Asn Q n Thr Asp 20 25 30
Leu Qy Val Thr Arg Asn Lys
I I e IVfet Thr Ala G n Tyr Q u Cys Tyr Page 142
A1472PCT. t xt
2016244220 11 Oct 2016
35 40 45
Leu Phe Phe Leu Leu Asn lie Val
Ar g Val Leu I I e Page 143
Thr Lys Leu Lys
2016244220 11 Oct 2016
A1472PCT. t xt
305 310 315 320
<210> 224 <211> 714 <212> DNA <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ynucl eot i de <400> 224 at ggacat ga gggt gcccgc t cagct cct g gggct cct gc t get gt gget gagaggt geg 60 eget gt cagt ct gt gt t gac gcagccgccc t cagt gt ct g aggccccagg acagaaggt c 120 accat ct cct get ct ggaag cagct ccaac at t gggaat a at t at gt at c ct ggt accag 180 cagct cccag gaacagcccc caaact cct c at 11 at gaca at aat aagcg accct caggg 240 at t cct gacc gat t ct ct gg ct ccaagt ct ggcacgt cag ccaccct ggg catcaccgga 300 ct ccagact g gggaegagge egat t at t ac t gcggaacat gggat agccg cct gagt get 360 gt ggt 111 eg gcggagggac caagct gacc gt cct aggt c agcccaaggc caaccccact 420 gt cact ct gt t cccgccct c ct ct gaggag ct ccaagcca acaaggccac act agt gt gt 480 ct gat cagt g act t ct accc gggaget gt g acagt ggcct ggaaggcaga t ggcagcccc 540
Page 144
2016244220 11 Oct 2016 gt caaggcgg agcagct acc gt cacgcat g gagt ggagac t gagcct gac aagggagcac caccaaaccc gcccgagcag cgt ggagaag
A1472PCT. t xt t ccaaacaga gcaacaacaa t ggaagt ccc acagaagct a acagt ggccc ct acagaat g gt acgcggcc cagct gccag
11 ca <210> 225 <211> 714 <212> DNA <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ynucl eot i de <400> 225
600
660
714
<210> 226 <211> 708 <212> DNA <213> Ar t i f i ci al Sequence
Page 145
2016244220 11 Oct 2016 ccgccat ct g
11 ct at ccca t cccaggaga ct gacgct ga cagggcct ga at gagcagt t gagaggccaa gt gt cacaga gcaaagcaga get cgcccgt gaaat ct gga agt acagt gg gcaggacagc ct aegagaaa cacaaagagc
A1472PCT. t xt act gcct ct g aaggt ggat a aaggacagca cacaaagt ct 11 caacaggg
11 gt gt gcct acgccct cca cct acagcct acgcct gega gagagt gt get gaat aac at cgggt aac cagcagcacc agt cacccat <210> 227 <211> 708 <212> DNA <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ynucl eot i de <400> 227
480
540
600
660
708
<210> 228 <211> 723 <212> DNA <213> Ar t i f i ci al Sequence
Page 146
2016244220 11 Oct 2016 aaaat cagcc ct t ccgct ca t ct gt ct t ca t gcct get ga ct ccaat egg agcct cagca t gegaagt ca t gt
A1472PCT. t xt
<210> 229 <211> 714 <212> DNA <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ynucl eot i de <400> 229
<210> 230 <211> 723 <212> DNA <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ynucl eot i de <400> 230 at ggacat ga gggt gcccgc t cagct cct g ggget cct gc t get gt ggct gagaggt geg 60 eget gt gat a 11 gt gat gac t cagt ct cca ct ct ccct gc ccgt cacccc t ggagagccg 120
Page 147
2016244220 11 Oct 2016
t gt 723 <210> 231 <211> 723 <212> DNA <213> Ar t i f i ci al Sequence
<210> 232 <211> 714 <212> DNA <213> Ar t i f i ci al Sequence <220>
<221> source
Page 148
2016244220 11 Oct 2016
A1472PCT. t xt <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ynucl eot i de
<210> 233 <211> 714 <212> DNA <213> Ar t i f i ci al Sequence
<210> 234 <211> 714 <212> DNA
Page 149
2016244220 11 Oct 2016
A1472PCT. t xt <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ynucl eot i de <400> 234
<210> 235 <211> 714 <212> DNA <213> Ar t i f i ci al Sequence
Page 150
2016244220 11 Oct 2016
A1472PCT. t xt <210> 236 <211> 714 <212> DNA <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ynucl eot i de
<210> 237 <211> 723 <212> DNA <213> Ar t i f i ci al Sequence
Page 151
2016244220 11 Oct 2016
A1472PCT. t xt agcctcagca gcaccctgac getgagcaaa gcagactaeg agaaacacaa agtctaegee 660 t gegaagt ca cccat caggg cct gagct eg cccgt cacaa agaget t caa caggggagag 720 t gt 723 <210> 238 <211> 714 <212> DNA <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ynucl eot i de <400> 238
<210> 239 <211> 708 <212> DNA <213> Ar t i f i ci al Sequence
Page 152
2016244220 11 Oct 2016 ccgccat ct g
11 ct at ccca t cccaggaga ct gacgct ga cagggcct ga at gagcagt t gagaggccaa gt gt cacaga gcaaagcaga get cgcccgt gaaat ct gga agt acagt gg gcaggacagc ct aegagaaa cacaaagagc
A1472PCT. t xt act gcct ct g aaggt ggat a aaggacagca cacaaagt ct 11 caacaggg
11 gt gt gcct acgccct cca cct acagcct acgcct gega gagagt gt get gaat aac at cgggt aac cagcagcacc agt cacccat <210> 240 <211> 705 <212> DNA <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ynucl eot i de <400> 240
480
540
600
660
708
<210> 241 <211> 705 <212> DNA <213> Ar t i f i ci al Sequence
Page 153
2016244220 11 Oct 2016
<210> 242 <211> 1434 <212> DNA <213> Ar t i f i ci al Sequence
Page 154
2016244220 11 Oct 2016 aact acaaga ct caccgt gg gaggct ct gc ccacacct cc acaagagcag acaaccact a cat get ggac gt ggcagcag cacgcagaag
A1472 PCT. t ccgacggct gggaacgt ct agcct ct ccc xt cct t ct t cct t ct cat get c t gt ct ccggg ct acagcaag cgt gat gcat t aaa <210> 243 <211> 1437 <212> DNA <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ynucl eot i de
1320
1380
1434
<210> 244
Page 155
2016244220 11 Oct 2016
A1472PCT. t xt <211> 1434 <212> DNA <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ynucl eot i de <400> 244
<210> 245 <211> 1434 <212> DNA <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ynucl eot i de
Page 156
2016244220 11 Oct 2016
A1472PCT. t xt
<210> 246 <211> 1431 <212> DNA <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ynucl eot i de <400> 246 at ggacat ga cgct gt cagg agact ct cct gggt gcccgc t gcagct ggt gt gcagcct c t cagct cct g ggagt ct ggg t ggat t cacc gggct cct gc ggaggcgtgg 11 cagt agct t get gt gget t ccagcct gg at ggcat gca gagaggt gcg gaggt ccct g ct gggt ccgc
120
180
Page 157
2016244220 11 Oct 2016
<210> 247 <211> 1434 <212> DNA <213> Ar t i f i ci al Sequence
Page 158
2016244220 11 Oct 2016
<210> 248 <211> 1407 <212> DNA <213> Ar t i f i ci al Sequence
Page 159
2016244220 11 Oct 2016
<210> 249 <211> 1431 <212> DNA <213> Ar t i f i ci al Sequence
Page 160
2016244220 11 Oct 2016
<210> 250 <211> 1434 <212> DNA <213> Ar t i f i ci al Sequence
Page 161
2016244220 11 Oct 2016 accct gcccc aaaggct t ct aact acaaga ct caccgt gg gaggct ct gc
A1472PCT. t xt
<210> 251 <211> 1437 <212> DNA <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ynucl eot i de
Page 162
2016244220 11 Oct 2016
A1472PCT. t xt cat gaggct c tgcacaacca ctacacgcag aagagcctct ccctgtctcc gggtaaa 1437 <210> 252 <211> 1425 <212> DNA <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ynucl eot i de <400> 252
<210> 253 <211> 1437 <212> DNA <213> Ar t i f i ci al Sequence
Page 163
2016244220 11 Oct 2016
A1472PCT. t xt <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ynucl eot i de <400> 253
<210> 254 <211> 1437 <212> DNA <213> Ar t i f i ci al Sequence <220>
<221> source <223> I not e= Descr i pt i on of Artificial Sequence: Synthetic pol ynucl eot i de <400> 254 at ggacat ga gggt gcccgc t cagct cct g ggget cct gc t get gt ggct gagaggt geg 60
Page 164
2016244220 11 Oct 2016
<210> 255 <211> 1431 <212> DNA <213> Ar t i f i ci al Sequence
Page 165
2016244220 11 Oct 2016
<210> 256 <211> 1434 <212> DNA <213> Ar t i f i ci al Sequence
Page 166
2016244220 11 Oct 2016
<210> 257 <211> 1437 <212> DNA <213> Ar t i f i ci al Sequence
Page 167
2016244220 11 Oct 2016
<210> 258 <211> 1422 <212> DNA <213> Ar t i f i ci al Sequence
Page 168
2016244220 11 Oct 2016
A1472PCT. t xt
Page 169
2016244220 11 Oct 2016
A1472PCT. t xt
Page 170
Priority Applications (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
AU2016244220A AU2016244220B2 (en) | 2008-12-23 | 2016-10-11 | Human CGRP receptor binding proteins |
AU2018203471A AU2018203471B2 (en) | 2008-12-23 | 2018-05-16 | Human CGRP receptor binding proteins |
Applications Claiming Priority (5)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US61/203,569 | 2008-12-23 | ||
US61/264,622 | 2009-11-25 | ||
AU2009330175A AU2009330175C1 (en) | 2008-12-23 | 2009-12-18 | Human CGRP receptor binding proteins |
AU2013205271A AU2013205271C1 (en) | 2008-12-23 | 2013-04-10 | Human CGRP receptor binding proteins |
AU2016244220A AU2016244220B2 (en) | 2008-12-23 | 2016-10-11 | Human CGRP receptor binding proteins |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
AU2013205271A Division AU2013205271C1 (en) | 2008-12-23 | 2013-04-10 | Human CGRP receptor binding proteins |
Related Child Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
AU2018203471A Division AU2018203471B2 (en) | 2008-12-23 | 2018-05-16 | Human CGRP receptor binding proteins |
Publications (2)
Publication Number | Publication Date |
---|---|
AU2016244220A1 AU2016244220A1 (en) | 2016-10-27 |
AU2016244220B2 true AU2016244220B2 (en) | 2018-05-17 |
Family
ID=57189632
Family Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
AU2016244220A Active 2033-07-02 AU2016244220B2 (en) | 2008-12-23 | 2016-10-11 | Human CGRP receptor binding proteins |
AU2018203471A Active AU2018203471B2 (en) | 2008-12-23 | 2018-05-16 | Human CGRP receptor binding proteins |
Family Applications After (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
AU2018203471A Active AU2018203471B2 (en) | 2008-12-23 | 2018-05-16 | Human CGRP receptor binding proteins |
Country Status (1)
Country | Link |
---|---|
AU (2) | AU2016244220B2 (en) |
Families Citing this family (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
SG11202003609VA (en) * | 2017-10-25 | 2020-05-28 | Nouscom Ag | Eukaryotic cell line |
CN112553299A (en) * | 2019-09-10 | 2021-03-26 | 北京大学第一医院 | NOTCH2NLC gene GGC repetitive sequence amplification method |
CN116333041A (en) * | 2023-04-10 | 2023-06-27 | 湖南中晟全肽生化有限公司 | Polypeptide compound for activating GRP receptor and application thereof |
Citations (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20050282252A1 (en) * | 1996-10-11 | 2005-12-22 | Siegel Donald L | Rh(D)-binding proteins and magnetically activated cell sorting method for production thereof |
WO2006068953A2 (en) * | 2004-12-21 | 2006-06-29 | Astrazeneca Ab | Antibodies directed to angiopoietin-2 and uses thereof |
WO2007076336A1 (en) * | 2005-12-22 | 2007-07-05 | Eli Lilly And Company | Treatment of migraine with anti-cgrp antibodies |
US7288251B2 (en) * | 2001-11-09 | 2007-10-30 | Abgenix, Inc. | Antibodies to CD40 |
US20080057063A1 (en) * | 2006-08-03 | 2008-03-06 | Julie Rinkenberger | Antibodies Directed to AlphaVBeta6 and Uses Thereof |
US7423128B2 (en) * | 2004-11-03 | 2008-09-09 | Amgen Fremont Inc. | Anti-properdin antibodies, and methods for making and using same |
-
2016
- 2016-10-11 AU AU2016244220A patent/AU2016244220B2/en active Active
-
2018
- 2018-05-16 AU AU2018203471A patent/AU2018203471B2/en active Active
Patent Citations (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20050282252A1 (en) * | 1996-10-11 | 2005-12-22 | Siegel Donald L | Rh(D)-binding proteins and magnetically activated cell sorting method for production thereof |
US7288251B2 (en) * | 2001-11-09 | 2007-10-30 | Abgenix, Inc. | Antibodies to CD40 |
US7423128B2 (en) * | 2004-11-03 | 2008-09-09 | Amgen Fremont Inc. | Anti-properdin antibodies, and methods for making and using same |
WO2006068953A2 (en) * | 2004-12-21 | 2006-06-29 | Astrazeneca Ab | Antibodies directed to angiopoietin-2 and uses thereof |
WO2007076336A1 (en) * | 2005-12-22 | 2007-07-05 | Eli Lilly And Company | Treatment of migraine with anti-cgrp antibodies |
US20080057063A1 (en) * | 2006-08-03 | 2008-03-06 | Julie Rinkenberger | Antibodies Directed to AlphaVBeta6 and Uses Thereof |
Non-Patent Citations (2)
Title |
---|
DAVIS, C. et al, Current Topics in Medicinal Chemistry, 2008, 8, 1468-1479. * |
TAYLOR, C. et al, Journal of Pharmacology and Experimental Therapeutics, 2006, 319(2), 749-757. * |
Also Published As
Publication number | Publication date |
---|---|
AU2016244220A1 (en) | 2016-10-27 |
AU2018203471B2 (en) | 2020-03-05 |
AU2018203471A1 (en) | 2018-06-07 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US11692031B2 (en) | Antibody constructs for CLDN18.2 and CD3 | |
ES2871146T3 (en) | Polypeptide molecule with enhanced dual specificity | |
CN104371019B (en) | It is a kind of can with GLP-1R specifically bind antibody and its with the fused protein of GLP-1 | |
UA124734C2 (en) | Anti-c5 antibodies and uses thereof | |
UA127308C2 (en) | Protease-activated t cell bispecific molecules | |
CN110462038A (en) | Anti- GPRC5D antibody and the molecule comprising the antibody | |
AU2016247113A1 (en) | Novel modulators and methods of use | |
UA125577C2 (en) | Antigen binding molecules comprising a tnf family ligand trimer | |
CN101443361A (en) | Antibodies binding to the extracellular domain of the receptor tyrosine kinase ALK | |
AU2016244220B2 (en) | Human CGRP receptor binding proteins | |
HU228310B1 (en) | Agonist anti-trk-c monoclonal antibodies | |
UA125757C2 (en) | Anti-par2 antibodies and uses thereof | |
EA026129B1 (en) | Human antigen binding proteins that bind beta-klotho, fgf receptors and complexes thereof | |
PT979246E (en) | Human monoclonal antibodies to epidermal growth factor receptor | |
UA118950C2 (en) | Prostate-specific membrane antigen binding proteins and related compositions and methods | |
CN106459211B (en) | Bifunctional antibodies and uses thereof | |
BR112021006640A2 (en) | train stabilizing antibodies | |
BR112021002953A2 (en) | anti-her2 polypeptides and methods of using them | |
CN101535344A (en) | Novel antiproliferation antibodies | |
CN107922491A (en) | The fusion protein of multivalence and polyspecific combination DR5 | |
CN103476800A (en) | Fusion protein | |
AU2016206264B2 (en) | Agonistic human LCAT antigen binding proteins and their use in therapy | |
JP2006506450A (en) | Peptide-based passive immunotherapy for the treatment of atherosclerosis | |
CN114805582B (en) | anti-Trop 2 nano antibody and application thereof | |
AU2016216524A1 (en) | Antibodies that bind human CD27 and uses thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
FGA | Letters patent sealed or granted (standard patent) | ||
NC | Extension of term for standard patent requested (sect. 70) |
Free format text: PRODUCT NAME: AIMOVIG ERENUMAB Filing date: 20180702 |
|
NDA | Extension of term for standard patent accepted (sect.70) |
Free format text: PRODUCT NAME: AIMOVIG ERENUMAB Filing date: 20180702 |
|
NDB | Extension of term for standard patent granted (sect.76) |
Free format text: PRODUCT NAME: AIMOVIG ERENUMAB Filing date: 20180702 Extension date: 20330702 |